F407145

General Info

Members Datasets Scaffolds Average Seq Length
323 235 305 321

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2511231003|2511251922
Length 350
Sequence TPTSAPAAAAPTTSAKTTAMSPLPLLHLPNDRWKPLEIIFWLLPVAAYFVFPDYLILISQIMIVGLFAISLDLILGYGGIVSLGHAAFFGLGAYTAGLLSAHGWGEPISGMLLGAIVAAAFGYIISFLVVRGNDLARLMVTLGIGLMLFEAANKAAFITGGVDGLSGMMVDKIFGVFEFDLNGKVAYIYSFVVLFILFAVLRRLVNSPFGLSLVGIREGGRRMPAIGVNVNQRLTVIFTISAAIAGVAGALLAQTTQFVGLDVLGFPRSAELLIILVLGGTGRLYGGLVGAAIFMLAQDYLSGLNPAYWQFWIGLLLIVIVLFARGGILGGLTLIWNSLRKSSGTKGERS

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
3 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
4 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
5 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
6 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
7 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
8 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
9 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
10 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
11 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
12 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
13 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
14 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
15 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
16 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
17 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
18 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
19 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
20 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
21 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
22 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
25 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
26 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
27 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
28 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
84 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
89 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
90 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
130 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
131 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
154 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
155 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
156 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
174 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.43
Metatranscriptomes 0
Isolates 5.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.72
Nodule 0
Rhizoplane 0
Rhizosphere 90.71
Stem 0
Stem Tuber 0
Unclassified 5.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000828 3300002704 Bacteria 4796
2 JGI25156J39149_1005365 3300002705 Bacteria 3709
3 JGI25154J39366_1001103 3300002738 Bacteria 10529
4 JGI25406J46586_10064295 3300003203 Bacteria 1173
5 rootL2_10143642 3300003322 Bacteria 2328
6 Ga0055538_1000038 3300003751 Bacteria 186588
7 Ga0055539_1000049 3300003752 Bacteria 186588
8 Ga0055533_1000060 3300003756 Bacteria 186588
9 Ga0055525_1000068 3300003759 Bacteria 186588
10 Ga0055541_1000036 3300003841 Bacteria 186588
11 Ga0070658_10300796 3300005327 Bacteria 1368
12 Ga0070658_10416626 3300005327 Bacteria 1155
13 Ga0070676_10056867 3300005328 Bacteria 2313
14 Ga0070690_100063017 3300005330 Bacteria 2391
15 Ga0068869_100026334 3300005334 Bacteria 4048
16 Ga0070680_100391172 3300005336 Bacteria 1184
17 Ga0070660_100281065 3300005339 Bacteria 1362
18 Ga0070689_100079746 3300005340 Bacteria 2568
19 Ga0070689_100084759 3300005340 Bacteria 2491
20 Ga0070687_100098602 3300005343 Bacteria 1631
21 Ga0070687_100105082 3300005343 Bacteria 1588
22 Ga0070687_100202797 3300005343 Bacteria 1203
23 Ga0070692_10015825 3300005345 Bacteria 3576
24 Ga0070668_100051186 3300005347 Bacteria 3182
25 Ga0070669_100026233 3300005353 Bacteria 4191
26 Ga0070675_100091375 3300005354 Bacteria 2550
27 Ga0070675_100367230 3300005354 Bacteria 1279
28 Ga0070673_100108794 3300005364 Bacteria 2296
29 Ga0070673_100548754 3300005364 Bacteria 1050
30 Ga0070705_100010018 3300005440 Bacteria 4733
31 Ga0070700_100006368 3300005441 Bacteria 6305
32 Ga0070700_100056496 3300005441 Bacteria 2460
33 Ga0070694_100002163 3300005444 Bacteria 11644
34 Ga0070694_100019538 3300005444 Bacteria 4310
35 Ga0070662_100224624 3300005457 Bacteria 1500
36 Ga0070681_10007233 3300005458 Bacteria 10831
37 Ga0068867_100010543 3300005459 Bacteria 6521
38 Ga0070707_100365033 3300005468 Bacteria 1403
39 Ga0070679_100222622 3300005530 Bacteria 1848
40 Ga0070695_100078432 3300005545 Bacteria 2178
41 Ga0070695_100364030 3300005545 Bacteria 1087
42 Ga0070696_100003737 3300005546 Bacteria 10164
43 Ga0070696_100075025 3300005546 Bacteria 2385
44 Ga0070704_100018049 3300005549 Bacteria 4501
45 Ga0070704_100162437 3300005549 Bacteria 1768
46 Ga0068855_100000614 3300005563 Bacteria 43827
47 Ga0068855_100031454 3300005563 Bacteria 6337
48 Ga0068854_100016130 3300005578 Bacteria 4970
49 Ga0068856_100425964 3300005614 Bacteria 1347
50 Ga0070702_100246560 3300005615 Bacteria 1208
51 Ga0068859_100033426 3300005617 Bacteria 5164
52 Ga0068861_100013702 3300005719 Bacteria 5678
53 Ga0068870_10154978 3300005840 Bacteria 1353
54 Ga0068863_100276725 3300005841 Bacteria 1625
55 Ga0068858_100072953 3300005842 Bacteria 3186
56 Ga0068862_100020691 3300005844 Bacteria 5497
57 Ga0068862_100111446 3300005844 Bacteria 2402
58 Ga0075365_10062174 3300006038 Bacteria 2496
59 Ga0075365_10204788 3300006038 Bacteria 1383
60 Ga0075428_100094132 3300006844 Bacteria 3266
61 Ga0075430_100014857 3300006846 Bacteria 6630
62 Ga0075431_100254672 3300006847 Bacteria 1783
63 Ga0075433_10001929 3300006852 Bacteria 15609
64 Ga0075433_10446671 3300006852 Bacteria 1140
65 Ga0075434_100000254 3300006871 Bacteria 37644
66 Ga0075434_100000818 3300006871 Bacteria 24717
67 Ga0075434_100057100 3300006871 Bacteria 3879
68 Ga0075436_100000149 3300006914 Bacteria 43158
69 Ga0097620_100033426 3300006931 Bacteria 5164
70 Ga0075435_100001280 3300007076 Bacteria 16160
71 Ga0105240_10002032 3300009093 Bacteria 33348
72 Ga0111539_10008534 3300009094 Bacteria 13017
73 Ga0111539_10033868 3300009094 Bacteria 6198
74 Ga0111539_10595380 3300009094 Bacteria 1288
75 Ga0105245_10293449 3300009098 Bacteria 1593
76 Ga0114129_10107285 3300009147 Bacteria 3858
77 Ga0105243_10051239 3300009148 Bacteria 3264
78 Ga0105238_10016985 3300009551 Bacteria 7387
79 Ga0105249_10014485 3300009553 Bacteria 6971
80 Ga0157380_10064200 3300014326 Bacteria 2946
81 Ga0157377_10106346 3300014745 Bacteria 1680
82 Ga0182006_1003085 3300015261 Bacteria 8734
83 Ga0213872_10003817 3300021361 Bacteria 8210
84 Ga0209435_100067 3300025206 Bacteria 66388
85 Ga0209784_100021 3300025224 Bacteria 408534
86 Ga0209566_100039 3300025225 Bacteria 303368
87 Ga0209674_100036 3300025226 Bacteria 408534
88 Ga0209563_100040 3300025230 Bacteria 408534
89 Ga0209646_1000061 3300025246 Bacteria 255495
90 Ga0209026_1000754 3300025250 Bacteria 18343
91 Ga0209677_100023 3300025253 Bacteria 408534
92 Ga0209759_1000209 3300025256 Bacteria 90642
93 Ga0207645_10061549 3300025907 Bacteria 2398
94 Ga0207643_10142457 3300025908 Bacteria 1433
95 Ga0207705_10217336 3300025909 Bacteria 1451
96 Ga0207707_10003685 3300025912 Bacteria 13585
97 Ga0207695_10086106 3300025913 Bacteria 3170
98 Ga0207660_10077007 3300025917 Bacteria 2440
99 Ga0207662_10015934 3300025918 Bacteria 4235
100 Ga0207662_10069531 3300025918 Bacteria 2127
101 Ga0207657_10172390 3300025919 Bacteria 1752
102 Ga0207652_10098403 3300025921 Bacteria 2580
103 Ga0207681_10028167 3300025923 Bacteria 3637
104 Ga0207694_10009304 3300025924 Bacteria 7414
105 Ga0207690_10239502 3300025932 Bacteria 1397
106 Ga0207709_10018926 3300025935 Bacteria 3863
107 Ga0207670_10044552 3300025936 Bacteria 2935
108 Ga0207670_10056824 3300025936 Bacteria 2652
109 Ga0207691_10328298 3300025940 Bacteria 1311
110 Ga0207689_10044124 3300025942 Bacteria 3686
111 Ga0207667_10000102 3300025949 Bacteria 137469
112 Ga0207667_10089762 3300025949 Bacteria 3176
113 Ga0207651_10070651 3300025960 Bacteria 2471
114 Ga0207712_10044465 3300025961 Bacteria 3070
115 Ga0207668_10068902 3300025972 Bacteria 2517
116 Ga0207703_10056292 3300026035 Bacteria 3202
117 Ga0207703_10138593 3300026035 Bacteria 2109
118 Ga0207708_10005018 3300026075 Bacteria 9757
119 Ga0207708_10119530 3300026075 Bacteria 2053
120 Ga0207641_10206250 3300026088 Bacteria 1815
121 Ga0207648_10011628 3300026089 Bacteria 8285
122 Ga0207676_10404634 3300026095 Bacteria 1276
123 Ga0207675_100035966 3300026118 Bacteria 4619
124 Ga0209981_1000685 3300027378 Bacteria 4283
125 Ga0210000_1003089 3300027462 Bacteria 2388
126 Ga0210000_1005842 3300027462 Bacteria 1789
127 Ga0207428_10030877 3300027907 Bacteria 4426
128 Ga0207428_10052191 3300027907 Bacteria 3267
129 Ga0207428_10192440 3300027907 Bacteria 1537
130 Ga0268265_10014606 3300028380 Bacteria 5353
131 Ga0268265_10092617 3300028380 Bacteria 2419
132 Ga0268264_10194714 3300028381 Bacteria 1850
133 Ga0265330_10051102 3300031235 Bacteria 1813
134 Ga0265331_10018382 3300031250 Bacteria 3627
135 Ga0307408_100343782 3300031548 Bacteria 1264
136 Ga0265314_10005849 3300031711 Bacteria 11012
137 Ga0307412_10066360 3300031911 Bacteria 2446
138 Ga0307412_10093157 3300031911 Bacteria 2113
139 Ga0307412_10201196 3300031911 Bacteria 1513
140 Ga0307416_100279443 3300032002 Bacteria 1645
141 Ga0373926_0003388 3300035083 Bacteria 5135
142 Ga0373944_0007923 3300035089 Bacteria 2861
143 Ga0373936_0012981 3300035113 Bacteria 3176
144 Ga0373936_0015393 3300035113 Bacteria 2931
145 Ga0373941_0000809 3300035115 Bacteria 6416
146 Ga0373945_0006857 3300035116 Bacteria 3681
147 Ga0373953_0045875 3300035117 Bacteria 1753
148 Ga0373954_0000066 3300035118 Bacteria 37077
149 Ga0373956_0031963 3300035119 Bacteria 2308
150 Ga0373943_0223903 3300035170 Bacteria 1048
151 Ga0373955_0082744 3300035172 Bacteria 1817
152 Ga0373924_0029007 3300035410 Bacteria 2209
153 Ga0373931_0191472 3300035691 Bacteria 1217
154 Ga0373935_0275948 3300035692 Bacteria 1182
155 Ga0373927_0113937 3300035695 Bacteria 1762
156 Ga0373933_0062670 3300035724 Bacteria 2246
157 Ga0373947_0039274 3300035725 Bacteria 2815
158 Ga0373937_0000884 3300036401 Bacteria 25679
159 Ga0373937_0023313 3300036401 Bacteria 5572
160 Ga0373925_0054172 3300037068 Bacteria 2999
161 Ga0395899_0040760 3300037312 Bacteria 3472
162 Ga0395899_0044255 3300037312 Bacteria 3318
163 Ga0395900_0011196 3300037418 Bacteria 9173
164 Ga0395900_0013168 3300037418 Bacteria 8453
165 Ga0395900_0106812 3300037418 Bacteria 2876
166 Ga0395900_0304840 3300037418 Bacteria 1578
167 Ga0395898_0002404 3300037466 Bacteria 22217
168 Ga0395898_0282775 3300037466 Bacteria 1582
169 Ga0395905_0000773 3300037471 Bacteria 42104
170 Ga0395905_0002341 3300037471 Bacteria 21134
171 Ga0395905_0007791 3300037471 Bacteria 10621
172 Ga0395905_0040741 3300037471 Bacteria 4357
173 Ga0395905_0083815 3300037471 Bacteria 2986
174 Ga0395901_0036015 3300038443 Bacteria 5113
175 Ga0395901_0186193 3300038443 Bacteria 2177
176 Ga0395901_0248294 3300038443 Bacteria 1854
177 Ga0395901_0262523 3300038443 Bacteria 1797
178 Ga0436361_0298239 3300039447 Bacteria 16541
179 Ga0439453_0011457 3300041408 Bacteria 1479
180 Ga0439435_0005412 3300042436 Bacteria 2806
181 Ga0439464_0011218 3300042439 Bacteria 2371
182 Ga0439460_0028903 3300042461 Bacteria 1566
183 Ga0439460_0036295 3300042461 Bacteria 1429
184 Ga0466965_0242488 3300044683 Bacteria 965
185 Ga0466966_0250100 3300044684 Bacteria 1068
186 Ga0466961_0024702 3300044693 Bacteria 3865
187 Ga0466959_0027356 3300045049 Bacteria 4231
188 Ga0451576_0135431 3300045051 Bacteria 2568
189 Ga0466967_0027039 3300045976 Bacteria 4765
190 Ga0495592_0010606 3300046454 Bacteria 6950
191 Ga0495641_0030543 3300046461 Bacteria 2583
192 Ga0495653_0191140 3300046463 Bacteria 1397
193 Ga0495580_0008507 3300046472 Bacteria 8157
194 Ga0495639_0012276 3300046475 Bacteria 3694
195 Ga0495662_0008367 3300046476 Bacteria 5088
196 Ga0495662_0120546 3300046476 Bacteria 1287
197 Ga0495608_0004898 3300046511 Bacteria 9586
198 Ga0495618_0120868 3300046514 Bacteria 1677
199 Ga0495628_0000915 3300046516 Bacteria 27087
200 Ga0495630_0007486 3300046517 Bacteria 7804
201 Ga0495666_0017934 3300046526 Bacteria 3525
202 Ga0495642_0070327 3300046528 Bacteria 1463
203 Ga0495652_0061068 3300046529 Bacteria 3183
204 Ga0495665_0022686 3300046531 Bacteria 3373
205 Ga0495640_0007049 3300046533 Bacteria 8847
206 Ga0495586_0000698 3300046535 Bacteria 19053
207 Ga0495586_0004411 3300046535 Bacteria 7512
208 Ga0495587_0017984 3300046536 Bacteria 4383
209 Ga0495621_0046716 3300046539 Bacteria 1537
210 Ga0495634_0003402 3300046642 Bacteria 12776
211 Ga0495634_0184101 3300046642 Bacteria 1306
212 Ga0495635_0018448 3300046663 Bacteria 4869
213 Ga0495635_0043710 3300046663 Bacteria 3091
214 Ga0495599_0026248 3300046678 Bacteria 3650
215 Ga0495647_0000575 3300046681 Bacteria 10842
216 Ga0495669_0001950 3300046684 Bacteria 8478
217 Ga0495613_0043171 3300046689 Bacteria 3335
218 Ga0495624_0075845 3300046690 Bacteria 2087
219 Ga0495600_0009440 3300046809 Bacteria 6027
220 Ga0495604_0005164 3300047317 Bacteria 10338
221 Ga0495674_0062097 3300047319 Bacteria 3254
222 Ga0495676_0141306 3300047321 Bacteria 1725
223 Ga0495680_0004292 3300047322 Bacteria 13673
224 Ga0495675_0079163 3300047444 Bacteria 2070
225 Ga0495684_0167287 3300047471 Bacteria 1637
226 Ga0496121_0035531 3300048924 Bacteria 4465
227 Ga0496126_0238672 3300048929 Unclassified 1520
228 Ga0501031_0218342 3300049568 Bacteria 1242
229 Ga0501032_0033536 3300049569 Bacteria 3517
230 Ga0501033_0133952 3300049570 Bacteria 1793
231 Ga0501034_0000439 3300049571 Bacteria 68932
232 Ga0501034_0000810 3300049571 Bacteria 46526
233 Ga0501034_0009890 3300049571 Bacteria 9969
234 Ga0501034_0014998 3300049571 Bacteria 7971
235 Ga0501034_0108903 3300049571 Bacteria 2761
236 Ga0501036_0005548 3300049572 Bacteria 10230
237 Ga0501036_0022930 3300049572 Bacteria 5256
238 Ga0501036_0108297 3300049572 Bacteria 2349
239 Ga0501036_0144889 3300049572 Bacteria 2004
240 Ga0501036_0175814 3300049572 Bacteria 1802
241 Ga0501036_0181435 3300049572 Bacteria 1772
242 Ga0501037_0022946 3300049573 Bacteria 4615
243 Ga0501037_0085999 3300049573 Bacteria 2276
244 Ga0501038_0027804 3300049574 Bacteria 5027
245 Ga0501038_0232411 3300049574 Bacteria 1467
246 Ga0501039_0035845 3300049575 Bacteria 3829
247 Ga0501039_0098338 3300049575 Bacteria 2283
248 Ga0501040_0052604 3300049576 Bacteria 2788
249 Ga0501043_0010261 3300049579 Bacteria 7339
250 Ga0501043_0018721 3300049579 Bacteria 5433
251 Ga0501043_0065668 3300049579 Bacteria 2849
252 Ga0501046_0162457 3300049580 Bacteria 1679
253 Ga0501046_0242769 3300049580 Bacteria 1328
254 Ga0501047_0000073 3300049581 Bacteria 125990
255 Ga0501047_0043720 3300049581 Bacteria 4327
256 Ga0501047_0201759 3300049581 Bacteria 1850
257 Ga0501048_0000391 3300049582 Bacteria 30448
258 Ga0501048_0058404 3300049582 Bacteria 2734
259 Ga0501048_0130919 3300049582 Bacteria 1774
260 Ga0501067_0036636 3300049583 Bacteria 2723
261 Ga0501068_0001678 3300049584 Bacteria 11821
262 Ga0501068_0020275 3300049584 Bacteria 3870
263 Ga0501069_0012179 3300049585 Bacteria 4569
264 Ga0501070_0027966 3300049586 Bacteria 4730
265 Ga0501070_0201533 3300049586 Bacteria 1634
266 Ga0501071_0133585 3300049587 Bacteria 1845
267 Ga0501072_0021667 3300049588 Bacteria 4984
268 Ga0501072_0052606 3300049588 Bacteria 3207
269 Ga0501072_0169012 3300049588 Bacteria 1745
270 Ga0501072_0259798 3300049588 Bacteria 1382
271 Ga0501073_0023388 3300049589 Bacteria 4436
272 Ga0501074_0009466 3300049590 Bacteria 7074
273 Ga0501074_0010930 3300049590 Bacteria 6589
274 Ga0501074_0011237 3300049590 Bacteria 6506
275 Ga0501079_0058113 3300049741 Bacteria 2984
276 Ga0501079_0105137 3300049741 Bacteria 2190
277 Ga0501080_0006835 3300049742 Bacteria 10289
278 Ga0501080_0026831 3300049742 Bacteria 5355
279 Ga0501080_0108670 3300049742 Bacteria 2570
280 Ga0501080_0109812 3300049742 Bacteria 2556
281 Ga0501080_0281391 3300049742 Bacteria 1512
282 Ga0501081_0155502 3300049743 Bacteria 1645
283 Ga0501083_0000139 3300049744 Bacteria 49384
284 Ga0501083_0072683 3300049744 Bacteria 2286
285 Ga0501035_0014862 3300049822 Bacteria 7185
286 Ga0501035_0126715 3300049822 Bacteria 2229
287 Ga0501035_0218656 3300049822 Bacteria 1627
288 Ga0501044_0026255 3300049823 Bacteria 6167
289 Ga0501044_0044266 3300049823 Bacteria 4620
290 Ga0501044_0289555 3300049823 Bacteria 1569
291 nmdc:mga09592_227467_c1 3300050508 Bacteria 1616
292 nmdc:mga0qj67_136848_c1 3300050509 Bacteria 1985
293 nmdc:mga0qj67_236376_c1 3300050509 Bacteria 1483
294 nmdc:mga06r32_200354_c1 3300050510 Bacteria 1984
295 nmdc:mga06r32_361380_c1 3300050510 Bacteria 1436
296 nmdc:mga08y16_11098_c1 3300050511 Bacteria 9459
297 nmdc:mga08y16_191590_c1 3300050511 Bacteria 2121
298 nmdc:mga0n895_6296_c1 3300050512 Bacteria 10064
299 nmdc:mga0rr50_35947_c1 3300050513 Bacteria 3563
300 nmdc:mga08x19_18374_c1 3300050514 Bacteria 4285
301 nmdc:mga0a205_3271_c1 3300050515 Bacteria 14414
302 Ga0495595_0064475 3300053084 Bacteria 1722
303 Ga0495619_0206163 3300053085 Bacteria 1361
304 Ga0501084_0180798 3300054114 Bacteria 1780
305 Ga0501082_0203879 3300060353 Bacteria 1721

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049588 Ga0501072_0052606 Ga0501072_0052606_1592_2578 283
2 3300031911 Ga0307412_10093157 Ga0307412_100931572 287
3 3300031911 Ga0307412_10201196 Ga0307412_102011962 287
4 3300006852 Ga0075433_10446671 Ga0075433_104466711 294
5 3300046476 Ga0495662_0008367 Ga0495662_0008367_945_1877 295
6 3300046642 Ga0495634_0184101 Ga0495634_0184101_86_1018 295
7 3300046663 Ga0495635_0018448 Ga0495635_0018448_1432_2364 295
8 3300005563 Ga0068855_100031454 Ga0068855_1000314544 296
9 3300025949 Ga0207667_10089762 Ga0207667_100897622 296
10 3300044683 Ga0466965_0242488 Ga0466965_0242488_56_955 299
11 3300005334 Ga0068869_100026334 Ga0068869_1000263342 301
12 3300005545 Ga0070695_100364030 Ga0070695_1003640301 301
13 3300005842 Ga0068858_100072953 Ga0068858_1000729533 301
14 3300025942 Ga0207689_10044124 Ga0207689_100441242 301
15 3300026035 Ga0207703_10056292 Ga0207703_100562923 301
16 3300028381 Ga0268264_10194714 Ga0268264_101947142 301
17 3300005578 Ga0068854_100016130 Ga0068854_1000161302 304
18 3300009551 Ga0105238_10016985 Ga0105238_100169853 304
19 3300025924 Ga0207694_10009304 Ga0207694_100093043 304
20 3300037418 Ga0395900_0304840 Ga0395900_0304840_303_1220 305
21 3300038443 Ga0395901_0262523 Ga0395901_0262523_214_1131 305
22 3300005330 Ga0070690_100063017 Ga0070690_1000630173 306
23 3300005340 Ga0070689_100084759 Ga0070689_1000847591 306
24 3300005343 Ga0070687_100202797 Ga0070687_1002027971 306
25 3300005354 Ga0070675_100367230 Ga0070675_1003672302 306
26 3300005444 Ga0070694_100019538 Ga0070694_1000195384 306
27 3300005545 Ga0070695_100078432 Ga0070695_1000784322 306
28 3300005546 Ga0070696_100003737 Ga0070696_1000037375 306
29 3300005549 Ga0070704_100162437 Ga0070704_1001624372 306
30 3300005617 Ga0068859_100033426 Ga0068859_1000334262 306
31 3300005841 Ga0068863_100276725 Ga0068863_1002767252 306
32 3300006852 Ga0075433_10001929 Ga0075433_100019297 306
33 3300006871 Ga0075434_100000818 Ga0075434_10000081825 306
34 3300006871 Ga0075434_100057100 Ga0075434_1000571004 306
35 3300006914 Ga0075436_100000149 Ga0075436_10000014915 306
36 3300006931 Ga0097620_100033426 Ga0097620_1000334262 306
37 3300007076 Ga0075435_100001280 Ga0075435_10000128015 306
38 3300009094 Ga0111539_10008534 Ga0111539_100085345 306
39 3300009094 Ga0111539_10033868 Ga0111539_100338683 306
40 3300014745 Ga0157377_10106346 Ga0157377_101063462 306
41 3300025918 Ga0207662_10069531 Ga0207662_100695312 306
42 3300025936 Ga0207670_10044552 Ga0207670_100445522 306
43 3300026088 Ga0207641_10206250 Ga0207641_102062502 306
44 3300026095 Ga0207676_10404634 Ga0207676_104046342 306
45 3300027907 Ga0207428_10030877 Ga0207428_100308773 306
46 3300027907 Ga0207428_10192440 Ga0207428_101924402 306
47 3300035083 Ga0373926_0003388 Ga0373926_0003388_544_1482 306
48 3300035089 Ga0373944_0007923 Ga0373944_0007923_1718_2656 306
49 3300035113 Ga0373936_0012981 Ga0373936_0012981_2225_3163 306
50 3300035113 Ga0373936_0015393 Ga0373936_0015393_1626_2564 306
51 3300035116 Ga0373945_0006857 Ga0373945_0006857_835_1773 306
52 3300035117 Ga0373953_0045875 Ga0373953_0045875_204_1136 306
53 3300035170 Ga0373943_0223903 Ga0373943_0223903_38_976 306
54 3300035691 Ga0373931_0191472 Ga0373931_0191472_256_1194 306
55 3300035692 Ga0373935_0275948 Ga0373935_0275948_42_980 306
56 3300035695 Ga0373927_0113937 Ga0373927_0113937_14_952 306
57 3300035725 Ga0373947_0039274 Ga0373947_0039274_1719_2657 306
58 3300036401 Ga0373937_0023313 Ga0373937_0023313_3218_4150 306
59 3300037068 Ga0373925_0054172 Ga0373925_0054172_275_1213 306
60 3300046454 Ga0495592_0010606 Ga0495592_0010606_3315_4247 306
61 3300046461 Ga0495641_0030543 Ga0495641_0030543_1241_2173 306
62 3300046463 Ga0495653_0191140 Ga0495653_0191140_403_1335 306
63 3300046472 Ga0495580_0008507 Ga0495580_0008507_6675_7613 306
64 3300046475 Ga0495639_0012276 Ga0495639_0012276_2229_3167 306
65 3300046476 Ga0495662_0120546 Ga0495662_0120546_62_994 306
66 3300046511 Ga0495608_0004898 Ga0495608_0004898_2812_3744 306
67 3300046514 Ga0495618_0120868 Ga0495618_0120868_136_1068 306
68 3300046516 Ga0495628_0000915 Ga0495628_0000915_24598_25530 306
69 3300046517 Ga0495630_0007486 Ga0495630_0007486_6244_7176 306
70 3300046526 Ga0495666_0017934 Ga0495666_0017934_643_1575 306
71 3300046529 Ga0495652_0061068 Ga0495652_0061068_846_1778 306
72 3300046531 Ga0495665_0022686 Ga0495665_0022686_1606_2544 306
73 3300046533 Ga0495640_0007049 Ga0495640_0007049_5910_6842 306
74 3300046535 Ga0495586_0000698 Ga0495586_0000698_5118_6050 306
75 3300046535 Ga0495586_0004411 Ga0495586_0004411_2927_3865 306
76 3300046536 Ga0495587_0017984 Ga0495587_0017984_1495_2427 306
77 3300046642 Ga0495634_0003402 Ga0495634_0003402_8914_9846 306
78 3300046663 Ga0495635_0043710 Ga0495635_0043710_602_1534 306
79 3300046678 Ga0495599_0026248 Ga0495599_0026248_1553_2485 306
80 3300046681 Ga0495647_0000575 Ga0495647_0000575_2090_3028 306
81 3300046689 Ga0495613_0043171 Ga0495613_0043171_2005_2937 306
82 3300046690 Ga0495624_0075845 Ga0495624_0075845_182_1114 306
83 3300046809 Ga0495600_0009440 Ga0495600_0009440_2654_3586 306
84 3300047317 Ga0495604_0005164 Ga0495604_0005164_8066_8998 306
85 3300047319 Ga0495674_0062097 Ga0495674_0062097_1193_2125 306
86 3300047321 Ga0495676_0141306 Ga0495676_0141306_299_1237 306
87 3300047322 Ga0495680_0004292 Ga0495680_0004292_11571_12503 306
88 3300047444 Ga0495675_0079163 Ga0495675_0079163_529_1461 306
89 3300047471 Ga0495684_0167287 Ga0495684_0167287_123_1055 306
90 3300050508 nmdc:mga09592_227467_c1 nmdc:mga09592_227467_c1_197_1132 306
91 3300050511 nmdc:mga08y16_11098_c1 nmdc:mga08y16_11098_c1_6087_7025 306
92 3300050511 nmdc:mga08y16_191590_c1 nmdc:mga08y16_191590_c1_489_1424 306
93 3300050512 nmdc:mga0n895_6296_c1 nmdc:mga0n895_6296_c1_5878_6816 306
94 3300050513 nmdc:mga0rr50_35947_c1 nmdc:mga0rr50_35947_c1_2561_3499 306
95 3300050515 nmdc:mga0a205_3271_c1 nmdc:mga0a205_3271_c1_3249_4187 306
96 3300053084 Ga0495595_0064475 Ga0495595_0064475_231_1163 306
97 3300053085 Ga0495619_0206163 Ga0495619_0206163_77_1009 306
98 3300005327 Ga0070658_10300796 Ga0070658_103007962 307
99 3300005327 Ga0070658_10416626 Ga0070658_104166261 307
100 3300005364 Ga0070673_100548754 Ga0070673_1005487541 307
101 3300005615 Ga0070702_100246560 Ga0070702_1002465601 307
102 3300021361 Ga0213872_10003817 Ga0213872_100038173 307
103 3300025909 Ga0207705_10217336 Ga0207705_102173362 307
104 3300037418 Ga0395900_0106812 Ga0395900_0106812_1018_1947 307
105 3300039447 Ga0436361_0298239 Ga0436361_0298239_12969_14015 307
106 3300048929 Ga0496126_0238672 Ga0496126_0238672_31_1035 307
107 3300037471 Ga0395905_0000773 Ga0395905_0000773_33825_34757 308
108 3300005336 Ga0070680_100391172 Ga0070680_1003911722 309
109 3300005347 Ga0070668_100051186 Ga0070668_1000511863 309
110 3300005353 Ga0070669_100026233 Ga0070669_1000262333 309
111 3300005440 Ga0070705_100010018 Ga0070705_1000100183 309
112 3300005441 Ga0070700_100056496 Ga0070700_1000564962 309
113 3300005444 Ga0070694_100002163 Ga0070694_1000021636 309
114 3300005468 Ga0070707_100365033 Ga0070707_1003650332 309
115 3300005549 Ga0070704_100018049 Ga0070704_1000180493 309
116 3300005844 Ga0068862_100111446 Ga0068862_1001114462 309
117 3300006847 Ga0075431_100254672 Ga0075431_1002546722 309
118 3300027378 Ga0209981_1000685 Ga0209981_10006854 309
119 3300027462 Ga0210000_1003089 Ga0210000_10030893 309
120 3300028380 Ga0268265_10092617 Ga0268265_100926172 309
121 3300031548 Ga0307408_100343782 Ga0307408_1003437822 309
122 3300032002 Ga0307416_100279443 Ga0307416_1002794432 309
123 3300005563 Ga0068855_100000614 Ga0068855_10000061413 310
124 3300015261 Ga0182006_1003085 Ga0182006_10030857 310
125 3300025949 Ga0207667_10000102 Ga0207667_1000010286 310
126 3300037471 Ga0395905_0083815 Ga0395905_0083815_107_1048 311
127 3300003322 rootL2_10143642 rootL2_101436422 313
128 3300044684 Ga0466966_0250100 Ga0466966_0250100_67_1014 313
129 3300005328 Ga0070676_10056867 Ga0070676_100568673 314
130 3300005345 Ga0070692_10015825 Ga0070692_100158255 314
131 3300005354 Ga0070675_100091375 Ga0070675_1000913753 314
132 3300005364 Ga0070673_100108794 Ga0070673_1001087943 314
133 3300005441 Ga0070700_100006368 Ga0070700_1000063686 314
134 3300005458 Ga0070681_10007233 Ga0070681_100072333 314
135 3300005459 Ga0068867_100010543 Ga0068867_1000105433 314
136 3300005530 Ga0070679_100222622 Ga0070679_1002226222 314
137 3300005546 Ga0070696_100075025 Ga0070696_1000750251 314
138 3300005719 Ga0068861_100013702 Ga0068861_1000137023 314
139 3300005840 Ga0068870_10154978 Ga0068870_101549782 314
140 3300005844 Ga0068862_100020691 Ga0068862_1000206916 314
141 3300006844 Ga0075428_100094132 Ga0075428_1000941322 314
142 3300006871 Ga0075434_100000254 Ga0075434_10000025438 314
143 3300009094 Ga0111539_10595380 Ga0111539_105953802 314
144 3300009147 Ga0114129_10107285 Ga0114129_101072855 314
145 3300009148 Ga0105243_10051239 Ga0105243_100512393 314
146 3300009553 Ga0105249_10014485 Ga0105249_100144853 314
147 3300014326 Ga0157380_10064200 Ga0157380_100642003 314
148 3300025907 Ga0207645_10061549 Ga0207645_100615492 314
149 3300025912 Ga0207707_10003685 Ga0207707_1000368520 314
150 3300025917 Ga0207660_10077007 Ga0207660_100770072 314
151 3300025921 Ga0207652_10098403 Ga0207652_100984032 314
152 3300025923 Ga0207681_10028167 Ga0207681_100281673 314
153 3300025935 Ga0207709_10018926 Ga0207709_100189263 314
154 3300025940 Ga0207691_10328298 Ga0207691_103282982 314
155 3300025960 Ga0207651_10070651 Ga0207651_100706513 314
156 3300025961 Ga0207712_10044465 Ga0207712_100444652 314
157 3300025972 Ga0207668_10068902 Ga0207668_100689024 314
158 3300026075 Ga0207708_10005018 Ga0207708_100050183 314
159 3300026075 Ga0207708_10119530 Ga0207708_101195302 314
160 3300026089 Ga0207648_10011628 Ga0207648_100116289 314
161 3300026118 Ga0207675_100035966 Ga0207675_1000359662 314
162 3300027462 Ga0210000_1005842 Ga0210000_10058422 314
163 3300027907 Ga0207428_10052191 Ga0207428_100521912 314
164 3300028380 Ga0268265_10014606 Ga0268265_100146063 314
165 3300031911 Ga0307412_10066360 Ga0307412_100663602 314
166 3300035118 Ga0373954_0000066 Ga0373954_0000066_824_1789 314
167 3300035119 Ga0373956_0031963 Ga0373956_0031963_1081_2046 314
168 3300035172 Ga0373955_0082744 Ga0373955_0082744_292_1257 314
169 3300035410 Ga0373924_0029007 Ga0373924_0029007_394_1359 314
170 3300035724 Ga0373933_0062670 Ga0373933_0062670_1178_2143 314
171 3300036401 Ga0373937_0000884 Ga0373937_0000884_7294_8259 314
172 3300041408 Ga0439453_0011457 Ga0439453_0011457_191_1153 314
173 3300042436 Ga0439435_0005412 Ga0439435_0005412_1381_2343 314
174 3300042461 Ga0439460_0028903 Ga0439460_0028903_471_1433 314
175 3300045051 Ga0451576_0135431 Ga0451576_0135431_1411_2373 314
176 3300045976 Ga0466967_0027039 Ga0466967_0027039_540_1502 314
177 3300046528 Ga0495642_0070327 Ga0495642_0070327_351_1310 314
178 3300046539 Ga0495621_0046716 Ga0495621_0046716_190_1152 314
179 3300046684 Ga0495669_0001950 Ga0495669_0001950_3962_4921 314
180 3300049568 Ga0501031_0218342 Ga0501031_0218342_96_1058 314
181 3300049572 Ga0501036_0144889 Ga0501036_0144889_218_1180 314
182 3300049575 Ga0501039_0098338 Ga0501039_0098338_928_1905 314
183 3300049582 Ga0501048_0130919 Ga0501048_0130919_662_1624 314
184 3300049587 Ga0501071_0133585 Ga0501071_0133585_601_1563 314
185 3300049588 Ga0501072_0259798 Ga0501072_0259798_56_1018 314
186 3300050509 nmdc:mga0qj67_236376_c1 nmdc:mga0qj67_236376_c1_331_1293 314
187 3300050510 nmdc:mga06r32_361380_c1 nmdc:mga06r32_361380_c1_264_1226 314
188 3300050514 nmdc:mga08x19_18374_c1 nmdc:mga08x19_18374_c1_1470_2432 314
189 3300003751 Ga0055538_1000038 Ga0055538_1000038183 316
190 3300003752 Ga0055539_1000049 Ga0055539_1000049183 316
191 3300003756 Ga0055533_1000060 Ga0055533_1000060183 316
192 3300003759 Ga0055525_1000068 Ga0055525_100006812 316
193 3300003841 Ga0055541_1000036 Ga0055541_100003612 316
194 3300005339 Ga0070660_100281065 Ga0070660_1002810652 316
195 3300005614 Ga0068856_100425964 Ga0068856_1004259642 316
196 3300009098 Ga0105245_10293449 Ga0105245_102934492 316
197 3300025224 Ga0209784_100021 Ga0209784_100021280 316
198 3300025225 Ga0209566_100039 Ga0209566_100039281 316
199 3300025226 Ga0209674_100036 Ga0209674_100036280 316
200 3300025230 Ga0209563_100040 Ga0209563_100040280 316
201 3300025253 Ga0209677_100023 Ga0209677_100023280 316
202 3300025919 Ga0207657_10172390 Ga0207657_101723902 316
203 3300025932 Ga0207690_10239502 Ga0207690_102395022 316
204 3300037312 Ga0395899_0040760 Ga0395899_0040760_835_1791 316
205 3300037418 Ga0395900_0011196 Ga0395900_0011196_662_1618 316
206 3300037418 Ga0395900_0013168 Ga0395900_0013168_126_1082 316
207 3300037466 Ga0395898_0002404 Ga0395898_0002404_7949_8905 316
208 3300037471 Ga0395905_0002341 Ga0395905_0002341_12629_13585 316
209 3300037471 Ga0395905_0007791 Ga0395905_0007791_9262_10218 316
210 3300037471 Ga0395905_0040741 Ga0395905_0040741_2608_3564 316
211 3300038443 Ga0395901_0036015 Ga0395901_0036015_3754_4710 316
212 3300038443 Ga0395901_0186193 Ga0395901_0186193_476_1432 316
213 3300044693 Ga0466961_0024702 Ga0466961_0024702_1700_2656 316
214 3300045049 Ga0466959_0027356 Ga0466959_0027356_2034_2990 316
215 3300049574 Ga0501038_0232411 Ga0501038_0232411_199_1155 316
216 3300049579 Ga0501043_0065668 Ga0501043_0065668_1817_2773 316
217 3300049580 Ga0501046_0242769 Ga0501046_0242769_296_1252 316
218 3300049742 Ga0501080_0281391 Ga0501080_0281391_212_1168 316
219 3300049822 Ga0501035_0126715 Ga0501035_0126715_575_1531 316
220 3300049823 Ga0501044_0044266 Ga0501044_0044266_832_1788 316
221 3300005343 Ga0070687_100105082 Ga0070687_1001050822 317
222 3300006846 Ga0075430_100014857 Ga0075430_1000148578 317
223 3300031235 Ga0265330_10051102 Ga0265330_100511022 317
224 3300031250 Ga0265331_10018382 Ga0265331_100183822 317
225 3300031711 Ga0265314_10005849 Ga0265314_100058497 317
226 3300042439 Ga0439464_0011218 Ga0439464_0011218_540_1499 317
227 3300050509 nmdc:mga0qj67_136848_c1 nmdc:mga0qj67_136848_c1_14_988 317
228 3300050510 nmdc:mga06r32_200354_c1 nmdc:mga06r32_200354_c1_805_1779 317
229 3300006038 Ga0075365_10062174 Ga0075365_100621742 318
230 3300037312 Ga0395899_0044255 Ga0395899_0044255_1718_2680 318
231 3300037466 Ga0395898_0282775 Ga0395898_0282775_181_1143 318
232 3300038443 Ga0395901_0248294 Ga0395901_0248294_671_1633 318
233 3300049572 Ga0501036_0108297 Ga0501036_0108297_539_1516 318
234 3300049822 Ga0501035_0218656 Ga0501035_0218656_62_1024 318
235 3300049823 Ga0501044_0289555 Ga0501044_0289555_164_1126 318
236 3300003203 JGI25406J46586_10064295 JGI25406J46586_100642951 319
237 3300005340 Ga0070689_100079746 Ga0070689_1000797462 319
238 3300005343 Ga0070687_100098602 Ga0070687_1000986022 319
239 3300006038 Ga0075365_10204788 Ga0075365_102047882 319
240 3300025918 Ga0207662_10015934 Ga0207662_100159343 319
241 3300025936 Ga0207670_10056824 Ga0207670_100568243 319
242 3300026035 Ga0207703_10138593 Ga0207703_101385932 319
243 3300035115 Ga0373941_0000809 Ga0373941_0000809_3159_4184 319
244 3300049569 Ga0501032_0033536 Ga0501032_0033536_1124_2149 319
245 3300049570 Ga0501033_0133952 Ga0501033_0133952_125_1150 319
246 3300049571 Ga0501034_0000439 Ga0501034_0000439_34801_35826 319
247 3300049571 Ga0501034_0000810 Ga0501034_0000810_21417_22442 319
248 3300049571 Ga0501034_0009890 Ga0501034_0009890_632_1657 319
249 3300049571 Ga0501034_0014998 Ga0501034_0014998_5229_6254 319
250 3300049571 Ga0501034_0108903 Ga0501034_0108903_866_1891 319
251 3300049572 Ga0501036_0005548 Ga0501036_0005548_997_2022 319
252 3300049572 Ga0501036_0022930 Ga0501036_0022930_1814_2839 319
253 3300049572 Ga0501036_0175814 Ga0501036_0175814_449_1474 319
254 3300049572 Ga0501036_0181435 Ga0501036_0181435_688_1713 319
255 3300049573 Ga0501037_0022946 Ga0501037_0022946_2567_3592 319
256 3300049573 Ga0501037_0085999 Ga0501037_0085999_73_1098 319
257 3300049574 Ga0501038_0027804 Ga0501038_0027804_2793_3818 319
258 3300049575 Ga0501039_0035845 Ga0501039_0035845_2379_3404 319
259 3300049576 Ga0501040_0052604 Ga0501040_0052604_107_1132 319
260 3300049579 Ga0501043_0010261 Ga0501043_0010261_187_1212 319
261 3300049579 Ga0501043_0018721 Ga0501043_0018721_2207_3232 319
262 3300049580 Ga0501046_0162457 Ga0501046_0162457_389_1414 319
263 3300049581 Ga0501047_0000073 Ga0501047_0000073_8688_9713 319
264 3300049581 Ga0501047_0043720 Ga0501047_0043720_2950_3975 319
265 3300049582 Ga0501048_0000391 Ga0501048_0000391_21142_22167 319
266 3300049582 Ga0501048_0058404 Ga0501048_0058404_1551_2576 319
267 3300049583 Ga0501067_0036636 Ga0501067_0036636_101_1126 319
268 3300049584 Ga0501068_0001678 Ga0501068_0001678_7081_8106 319
269 3300049584 Ga0501068_0020275 Ga0501068_0020275_819_1844 319
270 3300049585 Ga0501069_0012179 Ga0501069_0012179_1112_2137 319
271 3300049586 Ga0501070_0027966 Ga0501070_0027966_3195_4220 319
272 3300049586 Ga0501070_0201533 Ga0501070_0201533_562_1620 319
273 3300049588 Ga0501072_0021667 Ga0501072_0021667_3412_4437 319
274 3300049588 Ga0501072_0169012 Ga0501072_0169012_51_1076 319
275 3300049589 Ga0501073_0023388 Ga0501073_0023388_54_1079 319
276 3300049590 Ga0501074_0009466 Ga0501074_0009466_2117_3142 319
277 3300049590 Ga0501074_0010930 Ga0501074_0010930_2807_3832 319
278 3300049590 Ga0501074_0011237 Ga0501074_0011237_2853_3878 319
279 3300049741 Ga0501079_0058113 Ga0501079_0058113_366_1391 319
280 3300049741 Ga0501079_0105137 Ga0501079_0105137_1110_2135 319
281 3300049742 Ga0501080_0006835 Ga0501080_0006835_1036_2061 319
282 3300049742 Ga0501080_0026831 Ga0501080_0026831_4000_5025 319
283 3300049742 Ga0501080_0108670 Ga0501080_0108670_1094_2119 319
284 3300049742 Ga0501080_0109812 Ga0501080_0109812_79_1104 319
285 3300049743 Ga0501081_0155502 Ga0501081_0155502_565_1590 319
286 3300049744 Ga0501083_0000139 Ga0501083_0000139_13909_14934 319
287 3300049744 Ga0501083_0072683 Ga0501083_0072683_900_1958 319
288 3300049822 Ga0501035_0014862 Ga0501035_0014862_201_1226 319
289 3300049823 Ga0501044_0026255 Ga0501044_0026255_3712_4737 319
290 3300054114 Ga0501084_0180798 Ga0501084_0180798_582_1607 319
291 3300060353 Ga0501082_0203879 Ga0501082_0203879_234_1259 319
292 3300005457 Ga0070662_100224624 Ga0070662_1002246241 320
293 3300049581 Ga0501047_0201759 Ga0501047_0201759_498_1469 320
294 iso_pu_bacteria 2852618963 2852621467 320
295 3300025908 Ga0207643_10142457 Ga0207643_101424572 321
296 3300042461 Ga0439460_0036295 Ga0439460_0036295_311_1336 326
297 iso_pu_bacteria 2521172590 2521559935 327
298 iso_pu_bacteria 2818991449 2819618174 327
299 iso_pu_bacteria 2904439833 2904444509 327
300 iso_pu_bacteria 2904530477 2904535662 327
301 iso_pu_bacteria 2904584206 2904588233 327
302 iso_pu_bacteria 2904589729 2904594878 327
303 iso_pu_bacteria 2904601388 2904606181 327
304 iso_pu_bacteria 2919079590 2919084379 327
305 iso_pu_bacteria 2928130867 2928134415 327
306 iso_pu_bacteria 2895511927 2895513596 328
307 3300009093 Ga0105240_10002032 Ga0105240_100020324 329
308 3300048924 Ga0496121_0035531 Ga0496121_0035531_2836_3825 329
309 iso_pu_bacteria 2551306416 2553006916 331
310 iso_pu_bacteria 2808606386 2808982712 331
311 iso_pu_bacteria 2808606415 2809130213 331
312 iso_pu_bacteria 2808606419 2809150310 331
313 iso_pu_bacteria 2919046199 2919049157 331
314 iso_pu_bacteria 2923510766 2923513725 331
315 3300025913 Ga0207695_10086106 Ga0207695_100861062 336
316 3300002704 JGI25155J39150_1000828 JGI25155J39150_10008283 338
317 3300002705 JGI25156J39149_1005365 JGI25156J39149_10053653 338
318 3300002738 JGI25154J39366_1001103 JGI25154J39366_10011036 338
319 3300025206 Ga0209435_100067 Ga0209435_10006736 338
320 3300025246 Ga0209646_1000061 Ga0209646_100006170 338
321 3300025250 Ga0209026_1000754 Ga0209026_100075410 338
322 3300025256 Ga0209759_1000209 Ga0209759_100020969 338
323 iso_pu_bacteria 2511231003 2511251922 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

54

321

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b57-assembly1.cif.gz_A inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia 0.5305 43 286
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5302 43 314
5b58-assembly1.cif.gz_B inward-facing conformation of abc heme importer bhuuv in complex with periplasmic heme binding protein bhut from burkholderia cenocepacia 0.5254 43 325
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5188 43 314
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.4929 17 327
ID Description Score Start End Superfamily
af_Q58666_4_320_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8589 45 309 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8071 43 309 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8007 44 309 1.10.3470.10
af_P23200_41_325_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7918 41 309 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7896 44 309 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A536T171-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9907 13 283 GO:0005886
GO:0015658
AF-A0A4Q3JE45-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9873 20 289 GO:0005886
GO:0015658
AF-A0A536T171-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9835 13 283 GO:0005886
GO:0015658
AF-A0A4Q3LMC0-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9819 20 313 GO:0005886
GO:0015658
AF-A0A0Q7AE76-F1-model_v4 ABC transporter permease 0.9808 20 313 GO:0005886
GO:0015658

Feature Viewer

pLDDT pTM Quality
84.58 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map