F407113

General Info

Members Datasets Scaffolds Average Seq Length
323 201 646 235

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0370304|Ga0501072_0370304_264_1121
Length 285
Sequence MAEGLSTQERRVEPPAGAPAPMLLLNNVEVIYDGVILVLKGVSLAVASGGITTLLGANGAGKTTTLKAISGLLRPERGEVTKGSIEFDGHRVDRLPAHEIVKRGIAQVFEGRRVFEHLTTEENLIAGAHVRRELREVRRTLEAVYGYFPRLRERRRVPSGYLSGGEQQMLVIGRALMSEPRLMLLDEPSLGLAPMLVEEIFHIVQRLNRERGLTVLLVEQNAALALTIAERGYVMENGRIVLEDSAAALRQNADVREFYLGLTELGTRRSYRDVKHYKRRKRWLS

Samples

Sample ID Description Type Environment
1 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
26 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
27 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
28 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
37 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
38 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
39 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
40 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
54 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
61 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
62 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
63 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
64 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
65 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
69 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
70 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
75 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
76 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
80 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
81 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
82 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
83 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
86 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
87 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
88 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
89 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
90 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
91 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
92 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
98 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
101 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
102 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
103 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
106 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
107 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
110 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
111 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
112 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
113 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
114 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
115 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
124 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
125 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
126 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
127 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
128 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
129 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
130 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
131 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
132 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
133 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
139 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
140 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
141 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
142 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
143 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
144 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
147 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
167 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
168 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
169 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
170 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
171 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
172 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
173 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
174 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
175 2643221736 Bosea sp. Root483D1 Isolate Unclassified
176 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
177 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
178 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
179 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
180 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
181 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
182 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
183 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
184 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
185 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
186 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
187 2932406140 Serratia sp. 2723 Isolate Rhizosphere
188 2937539931 Pantoea sp. LS15 Isolate Unclassified
189 2939577877 Serratia sp. 509 Isolate Rhizosphere
190 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
191 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
192 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
193 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
194 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
195 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
196 8004592986 Serratia sp. S119 Isolate Unclassified
197 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
198 8018221730 Enterobacter sp. CM29 Isolate Unclassified
199 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
200 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
201 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.16
Metatranscriptomes 0
Isolates 10.84

Biome Distribution

Category Percentage (%)
Aerial Root 0.62
Bulb 0
Endosphere 1.55
Nodule 0.93
Rhizoplane 2.48
Rhizosphere 82.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501072_0370304 3300049588 Bacteria 1137
2 SwRhRL2b_contig_2947078 2162886007 Bacteria 1526
3 Ga0065714_10066715 3300005288 Bacteria 6419
4 Ga0065704_10077023 3300005289 Bacteria 4852
5 Ga0065704_10200331 3300005289 Bacteria 1149
6 Ga0070680_100046109 3300005336 Bacteria 3545
7 Ga0070680_100078329 3300005336 Bacteria 2723
8 Ga0070680_100727837 3300005336 Bacteria 854
9 Ga0070668_100472775 3300005347 Bacteria 1081
10 Ga0070705_100157361 3300005440 Bacteria 1515
11 Ga0070694_100092334 3300005444 Bacteria 2127
12 Ga0070708_100002834 3300005445 Bacteria 13470
13 Ga0070708_100048549 3300005445 Bacteria 3752
14 Ga0070708_100215862 3300005445 Bacteria 1798
15 Ga0070708_100254536 3300005445 Bacteria 1650
16 Ga0070708_100750630 3300005445 Bacteria 918
17 Ga0068867_100020243 3300005459 Bacteria 4742
18 Ga0070706_100096223 3300005467 Bacteria 2749
19 Ga0070706_100120597 3300005467 Bacteria 2444
20 Ga0070706_100129422 3300005467 Bacteria 2355
21 Ga0070707_100008941 3300005468 Bacteria 9292
22 Ga0070707_100055139 3300005468 Bacteria 3810
23 Ga0070707_100141383 3300005468 Bacteria 2342
24 Ga0070698_100003322 3300005471 Bacteria 17694
25 Ga0070699_100035619 3300005518 Bacteria 4302
26 Ga0070679_100000180 3300005530 Bacteria 50879
27 Ga0070697_100002200 3300005536 Bacteria 14969
28 Ga0070704_100041431 3300005549 Bacteria 3178
29 Ga0068861_100002214 3300005719 Bacteria 12613
30 Ga0081539_10016364 3300005985 Bacteria 5303
31 Ga0075364_10014514 3300006051 Bacteria 4869
32 Ga0075364_10169860 3300006051 Bacteria 1474
33 Ga0075428_100001674 3300006844 Bacteria 23616
34 Ga0075428_100075126 3300006844 Bacteria 3691
35 Ga0075430_100000918 3300006846 Bacteria 23148
36 Ga0075431_100261946 3300006847 Bacteria 1754
37 Ga0075429_100000681 3300006880 Bacteria 26415
38 Ga0079104_1000227 3300006946 Bacteria 76897
39 Ga0105251_10000061 3300009011 Bacteria 102789
40 Ga0105251_10021468 3300009011 Bacteria 3370
41 Ga0105251_10054299 3300009011 Bacteria 1903
42 Ga0105251_10179324 3300009011 Bacteria 954
43 Ga0105244_10000147 3300009036 Bacteria 73676
44 Ga0105244_10010648 3300009036 Bacteria 5562
45 Ga0105244_10010687 3300009036 Bacteria 5550
46 Ga0105244_10174670 3300009036 Bacteria 1021
47 Ga0105244_10230316 3300009036 Bacteria 867
48 Ga0105250_10000299 3300009092 Bacteria 39028
49 Ga0105250_10015644 3300009092 Bacteria 3106
50 Ga0111539_10002043 3300009094 Bacteria 26984
51 Ga0111539_10007217 3300009094 Bacteria 14244
52 Ga0111539_10440637 3300009094 Bacteria 1517
53 Ga0114129_10001249 3300009147 Bacteria 33890
54 Ga0114129_10192712 3300009147 Bacteria 2766
55 Ga0105243_10068119 3300009148 Bacteria 2868
56 Ga0105246_10030420 3300011119 Bacteria 3565
57 Ga0157371_10144066 3300013102 Bacteria 1697
58 Ga0157369_10002935 3300013105 Bacteria 20401
59 Ga0157369_10010819 3300013105 Bacteria 10390
60 Ga0157380_10981636 3300014326 Bacteria 877
61 Ga0183360_10096 3300015689 Bacteria 1562
62 Ga0213872_10013227 3300021361 Bacteria 3870
63 Ga0213872_10041093 3300021361 Bacteria 2110
64 Ga0213875_10001013 3300021388 Bacteria 19912
65 Ga0209129_1000021 3300025258 Bacteria 445018
66 Ga0207696_1000034 3300025711 Bacteria 350426
67 Ga0207696_1000332 3300025711 Bacteria 49596
68 Ga0207696_1000337 3300025711 Bacteria 48918
69 Ga0207655_1000264 3300025728 Bacteria 82670
70 Ga0207655_1000745 3300025728 Bacteria 36522
71 Ga0207655_1002022 3300025728 Bacteria 17146
72 Ga0207655_1007855 3300025728 Bacteria 6861
73 Ga0207713_1000014 3300025735 Bacteria 432450
74 Ga0207713_1000066 3300025735 Bacteria 195645
75 Ga0207713_1000177 3300025735 Bacteria 91799
76 Ga0207713_1011708 3300025735 Bacteria 4744
77 Ga0207713_1066669 3300025735 Bacteria 1346
78 Ga0207653_10062919 3300025885 Bacteria 1255
79 Ga0207684_10003106 3300025910 Bacteria 16382
80 Ga0207684_10045871 3300025910 Bacteria 3707
81 Ga0207684_10084397 3300025910 Bacteria 2705
82 Ga0207660_10005211 3300025917 Bacteria 8443
83 Ga0207660_10021414 3300025917 Bacteria 4347
84 Ga0207652_10009982 3300025921 Bacteria 7644
85 Ga0207646_10053861 3300025922 Bacteria 3599
86 Ga0207646_10071528 3300025922 Bacteria 3098
87 Ga0207646_10077173 3300025922 Bacteria 2978
88 Ga0207646_10107211 3300025922 Bacteria 2506
89 Ga0207690_10180748 3300025932 Bacteria 1588
90 Ga0207670_10193072 3300025936 Bacteria 1542
91 Ga0207668_10426266 3300025972 Bacteria 1127
92 Ga0207648_10030050 3300026089 Bacteria 4816
93 Ga0207675_100001660 3300026118 Bacteria 22263
94 Ga0209281_1000065 3300027111 Bacteria 285579
95 Ga0209281_1000316 3300027111 Bacteria 85644
96 Ga0209371_1000478 3300027312 Bacteria 38966
97 Ga0209371_1015196 3300027312 Bacteria 2079
98 Ga0209996_1002392 3300027395 Bacteria 2325
99 Ga0210002_1006881 3300027617 Bacteria 1719
100 Ga0209983_1000662 3300027665 Bacteria 7360
101 Ga0209971_1003813 3300027682 Bacteria 3565
102 Ga0207428_10010100 3300027907 Bacteria 8445
103 Ga0207428_10034101 3300027907 Bacteria 4174
104 Ga0265323_10003700 3300028653 Bacteria 6696
105 Ga0268256_1000406 3300030500 Bacteria 39238
106 Ga0268256_1016831 3300030500 Bacteria 2079
107 Ga0265330_10000073 3300031235 Archaea 87378
108 Ga0265330_10017340 3300031235 Bacteria 3317
109 Ga0265330_10043157 3300031235 Bacteria 1996
110 Ga0265332_10014524 3300031238 Bacteria 3484
111 Ga0265339_10141880 3300031249 Bacteria 1221
112 Ga0265327_10004354 3300031251 Bacteria 12598
113 Ga0265316_10000285 3300031344 Bacteria 56873
114 Ga0265316_10002316 3300031344 Bacteria 19903
115 Ga0265316_10004844 3300031344 Archaea 13270
116 Ga0265316_10052834 3300031344 Bacteria 3186
117 Ga0265314_10168727 3300031711 Bacteria 1323
118 Ga0265342_10000046 3300031712 Archaea 130926
119 Ga0265342_10011707 3300031712 Archaea 5986
120 Ga0265342_10021491 3300031712 Bacteria 4118
121 Ga0265342_10030817 3300031712 Bacteria 3320
122 Ga0265342_10096933 3300031712 Bacteria 1685
123 Ga0316576_10002980 3300031727 Bacteria 9817
124 Ga0316576_10072514 3300031727 Bacteria 2542
125 Ga0316576_10126968 3300031727 Bacteria 1917
126 Ga0316576_10276367 3300031727 Bacteria 1258
127 Ga0316576_10447068 3300031727 Bacteria 955
128 Ga0316578_10231721 3300031728 Bacteria 1109
129 Ga0307413_10019762 3300031824 Bacteria 3567
130 Ga0307412_10199022 3300031911 Bacteria 1520
131 Ga0307416_100046512 3300032002 Bacteria 3425
132 Ga0316585_10079341 3300032137 Bacteria 1069
133 Ga0373931_0003769 3300035691 Bacteria 6855
134 Ga0316584_0251157 3300036712 Bacteria 1292
135 Ga0316584_0440982 3300036712 Bacteria 922
136 Ga0316584_0583077 3300036712 Bacteria 777
137 Ga0395900_0569050 3300037418 Bacteria 1076
138 Ga0395905_0077387 3300037471 Bacteria 3117
139 Ga0436364_0331623 3300037853 Bacteria 59138
140 Ga0400484_05270 3300038725 Bacteria 4921
141 Ga0400484_37922 3300038725 Bacteria 2929
142 Ga0400486_20466 3300038742 Bacteria 33975
143 Ga0400483_006206 3300039062 Bacteria 3456
144 Ga0400483_225905 3300039062 Bacteria 6535
145 Ga0400483_269476 3300039062 Bacteria 14826
146 Ga0400489_25505 3300039093 Bacteria 21940
147 Ga0436365_1241666 3300039437 Bacteria 1352
148 Ga0436361_0127626 3300039447 Bacteria 69494
149 Ga0439437_000213 3300042000 Bacteria 5149
150 Ga0439452_000012 3300042010 Bacteria 412478
151 Ga0439452_017995 3300042010 Bacteria 1889
152 Ga0439456_016277 3300042013 Bacteria 1555
153 Ga0450911_000002 3300042115 Bacteria 277703
154 Ga0450904_000036 3300042139 Bacteria 30421
155 Ga0439435_0004385 3300042436 Bacteria 3034
156 Ga0439459_0000941 3300042438 Bacteria 4113
157 Ga0451577_0017806 3300042876 Bacteria 6555
158 Ga0451577_0429465 3300042876 Bacteria 1199
159 Ga0453683_0006959 3300044673 Bacteria 7711
160 Ga0453684_0025101 3300044712 Bacteria 8670
161 Ga0453684_0033979 3300044712 Bacteria 7092
162 Ga0453684_0050668 3300044712 Bacteria 5457
163 Ga0453684_0071465 3300044712 Archaea 4387
164 Ga0453684_0114123 3300044712 Bacteria 3276
165 Ga0453684_0395258 3300044712 Bacteria 1549
166 Ga0451576_0018554 3300045051 Bacteria 7621
167 Ga0451576_0424480 3300045051 Bacteria 1395
168 Ga0495627_041366 3300046453 Bacteria 1415
169 Ga0495591_007864 3300046458 Bacteria 4453
170 Ga0495638_0024727 3300046460 Bacteria 3911
171 Ga0495650_0000630 3300046471 Bacteria 47358
172 Ga0495650_0002835 3300046471 Bacteria 13268
173 Ga0495650_0042302 3300046471 Bacteria 1940
174 Ga0495650_0067155 3300046471 Bacteria 1417
175 Ga0495605_0000197 3300046474 Bacteria 75351
176 Ga0495605_0007031 3300046474 Bacteria 6416
177 Ga0495605_0007759 3300046474 Bacteria 6077
178 Ga0495584_0010761 3300046491 Bacteria 4698
179 Ga0495585_0003805 3300046492 Bacteria 10050
180 Ga0495594_0002074 3300046499 Bacteria 10431
181 Ga0495596_0052333 3300046500 Bacteria 1598
182 Ga0495607_0000378 3300046501 Bacteria 45897
183 Ga0495607_0001447 3300046501 Bacteria 21118
184 Ga0495583_0000689 3300046506 Bacteria 43732
185 Ga0495583_0002019 3300046506 Bacteria 18493
186 Ga0495606_0000320 3300046507 Bacteria 82551
187 Ga0495606_0017789 3300046507 Bacteria 5355
188 Ga0495610_0036054 3300046512 Bacteria 2531
189 Ga0495620_0000212 3300046515 Bacteria 43700
190 Ga0495631_0018074 3300046518 Bacteria 3323
191 Ga0495637_0000303 3300046520 Bacteria 38131
192 Ga0495637_0000319 3300046520 Bacteria 37329
193 Ga0495643_0020722 3300046522 Bacteria 3784
194 Ga0495648_0004610 3300046524 Bacteria 11730
195 Ga0495648_0027302 3300046524 Bacteria 3824
196 Ga0495654_0003439 3300046530 Bacteria 9695
197 Ga0495654_0045351 3300046530 Bacteria 2169
198 Ga0495654_0181081 3300046530 Bacteria 912
199 Ga0495609_0000273 3300046538 Bacteria 48181
200 Ga0495609_0000397 3300046538 Bacteria 36568
201 Ga0495597_0003381 3300046542 Bacteria 9351
202 Ga0495597_0012894 3300046542 Bacteria 4020
203 Ga0495633_0000428 3300046558 Bacteria 43681
204 Ga0495656_0009558 3300046615 Bacteria 3491
205 Ga0495668_0251998 3300046616 Bacteria 966
206 Ga0495611_0000423 3300046648 Bacteria 26242
207 Ga0495611_0024757 3300046648 Bacteria 2612
208 Ga0495625_0000076 3300046660 Bacteria 163580
209 Ga0495661_0000517 3300046665 Bacteria 40087
210 Ga0495661_0002492 3300046665 Bacteria 14168
211 Ga0495661_0018770 3300046665 Bacteria 4541
212 Ga0495670_0011740 3300046691 Bacteria 4312
213 Ga0495671_0026875 3300046692 Bacteria 2978
214 Ga0495671_0046255 3300046692 Bacteria 2175
215 Ga0495649_0002818 3300046694 Bacteria 12087
216 Ga0495589_0011089 3300046794 Bacteria 4676
217 Ga0495660_0000179 3300046810 Bacteria 68653
218 Ga0495660_0001595 3300046810 Bacteria 15222
219 Ga0495660_0022398 3300046810 Bacteria 3607
220 Ga0495672_0027684 3300047320 Bacteria 3597
221 Ga0495683_0000286 3300047323 Bacteria 43731
222 Ga0495679_000468 3300047446 Bacteria 29418
223 Ga0495679_001781 3300047446 Bacteria 11770
224 Ga0495679_039752 3300047446 Bacteria 1464
225 Ga0495673_0000155 3300047469 Bacteria 120879
226 Ga0495673_0024460 3300047469 Bacteria 2918
227 Ga0495673_0027291 3300047469 Bacteria 2719
228 Ga0495673_0039169 3300047469 Bacteria 2151
229 Ga0495681_0008251 3300047470 Bacteria 6546
230 Ga0495681_0061103 3300047470 Bacteria 1736
231 Ga0495681_0061490 3300047470 Bacteria 1730
232 Ga0495686_0106297 3300047472 Bacteria 1687
233 Ga0495626_0000336 3300048091 Bacteria 49874
234 Ga0495626_0009180 3300048091 Bacteria 5356
235 Ga0496102_0027102 3300048905 Bacteria 5117
236 Ga0496102_0156297 3300048905 Bacteria 2144
237 Ga0496103_0187527 3300048906 Bacteria 1330
238 Ga0496117_0044934 3300048920 Bacteria 3195
239 Ga0496118_0111497 3300048921 Bacteria 1813
240 Ga0496118_0151523 3300048921 Bacteria 1450
241 Ga0496119_0000023 3300048922 Bacteria 259882
242 Ga0496120_0008474 3300048923 Bacteria 7458
243 Ga0496121_0003176 3300048924 Bacteria 23693
244 Ga0496121_0010769 3300048924 Bacteria 10251
245 Ga0496122_0000447 3300048925 Bacteria 86474
246 Ga0496122_0017975 3300048925 Bacteria 6559
247 Ga0496122_0187403 3300048925 Bacteria 1225
248 Ga0496123_0000348 3300048926 Bacteria 86724
249 Ga0496123_0085417 3300048926 Bacteria 1898
250 Ga0496124_0000109 3300048927 Bacteria 166429
251 Ga0496124_0001241 3300048927 Bacteria 39178
252 Ga0496124_0010797 3300048927 Bacteria 9203
253 Ga0496124_0132566 3300048927 Bacteria 1977
254 Ga0496124_0417722 3300048927 Bacteria 925
255 Ga0496125_0035090 3300048928 Bacteria 4407
256 Ga0495678_000401 3300049459 Bacteria 43725
257 Ga0495678_000504 3300049459 Bacteria 38278
258 Ga0495678_028257 3300049459 Bacteria 2369
259 Ga0501031_0161405 3300049568 Bacteria 1465
260 Ga0501036_0323755 3300049572 Bacteria 1288
261 Ga0501036_0599648 3300049572 Bacteria 914
262 Ga0501040_0220474 3300049576 Bacteria 1349
263 Ga0501046_0431232 3300049580 Bacteria 949
264 Ga0501071_0063319 3300049587 Bacteria 2682
265 Ga0501071_0270390 3300049587 Bacteria 1285
266 Ga0501072_0465227 3300049588 Bacteria 1001
267 Ga0501075_0069825 3300049591 Bacteria 2655
268 Ga0501076_0232863 3300049592 Bacteria 1506
269 Ga0501076_0392404 3300049592 Bacteria 1141
270 Ga0501079_0595620 3300049741 Bacteria 870
271 Ga0501081_0054314 3300049743 Bacteria 2768
272 Ga0501081_0138783 3300049743 Bacteria 1741
273 Ga0501045_0347488 3300049824 Bacteria 1104
274 nmdc:mga00v17_17675_c1 3300050491 Bacteria 4042
275 nmdc:mga00v17_249830_c1 3300050491 Bacteria 1150
276 nmdc:mga05p37_112163_c1 3300050507 Bacteria 3353
277 nmdc:mga05p37_15205_c1 3300050507 Bacteria 9243
278 nmdc:mga05p37_1597_c1 3300050507 Bacteria 26325
279 nmdc:mga05p37_512226_c1 3300050507 Bacteria 1374
280 nmdc:mga09592_39507_c1 3300050508 Bacteria 3964
281 nmdc:mga0qj67_2337_c1 3300050509 Bacteria 13494
282 nmdc:mga0qj67_443858_c1 3300050509 Bacteria 1045
283 nmdc:mga06r32_1630_c1 3300050510 Bacteria 20242
284 nmdc:mga08y16_21023_c1 3300050511 Bacteria 6890
285 nmdc:mga08y16_26949_c1 3300050511 Bacteria 6057
286 nmdc:mga0n895_203866_c1 3300050512 Bacteria 2008
287 Ga0501084_0569547 3300054114 Bacteria 957
288 Ga0530510_0519103 3300061734 Bacteria 903
289 2510283352 2510065053 Bacteria 5005518
290 2510292820 2510065055 Bacteria 5037935
291 2510313290 2510065058 Bacteria 5005894
292 2599330202 2599185155 Bacteria 5827168
293 2599973763 2599185307 Bacteria 6194719
294 2601625636 2600255283 Bacteria 6061572
295 2603701793 2602042066 Bacteria 4423871
296 2603868334 2602042109 Bacteria 5152801
297 2644747877 2643221736 Bacteria 6608466
298 2729147219 2728369097 Bacteria 4333476
299 2738689312 2738541271 Bacteria 5657310
300 2739264700 2738543016 Bacteria 5657564
301 2774128878 2773857672 Bacteria 4993178
302 2808939399 2808606379 Bacteria 5022697
303 2888375539 2888373701 Bacteria 5098052
304 2904517919 2904513164 Bacteria 5476410
305 2917832987 2917832318 Bacteria 5346010
306 2919128687 2919125081 Bacteria 5385106
307 2919497057 2919493220 Bacteria 4598500
308 2923526338 2923525760 Bacteria 4472324
309 2932409089 2932406140 Bacteria 5134491
310 2937540470 2937539931 Bacteria 4639830
311 2939581607 2939577877 Bacteria 5132791
312 2939611532 2939607340 Bacteria 4719256
313 2974298999 2974298342 Bacteria 4840922
314 2984501310 2984499530 Bacteria 5020881
315 2984505227 2984504281 Bacteria 5262371
316 640488930 640427133 Bacteria 4567418
317 651177020 651053060 Bacteria 4689946
318 8004593557 8004592986 Bacteria 5122074
319 8016732893 8016728285 Bacteria 5263933
320 8018222129 8018221730 Bacteria 4616064
321 8055092358 8055087960 Bacteria 4784273
322 8055093074 8055092621 Bacteria 4873875
323 8055097715 8055097453 Bacteria 4865496
324 Ga0501072_0370304
325 SwRhRL2b_contig_2947078
326 Ga0065714_10066715
327 Ga0065704_10077023
328 Ga0065704_10200331
329 Ga0070680_100046109
330 Ga0070680_100078329
331 Ga0070680_100727837
332 Ga0070668_100472775
333 Ga0070705_100157361
334 Ga0070694_100092334
335 Ga0070708_100002834
336 Ga0070708_100048549
337 Ga0070708_100215862
338 Ga0070708_100254536
339 Ga0070708_100750630
340 Ga0068867_100020243
341 Ga0070706_100096223
342 Ga0070706_100120597
343 Ga0070706_100129422
344 Ga0070707_100008941
345 Ga0070707_100055139
346 Ga0070707_100141383
347 Ga0070698_100003322
348 Ga0070699_100035619
349 Ga0070679_100000180
350 Ga0070697_100002200
351 Ga0070704_100041431
352 Ga0068861_100002214
353 Ga0081539_10016364
354 Ga0075364_10014514
355 Ga0075364_10169860
356 Ga0075428_100001674
357 Ga0075428_100075126
358 Ga0075430_100000918
359 Ga0075431_100261946
360 Ga0075429_100000681
361 Ga0079104_1000227
362 Ga0105251_10000061
363 Ga0105251_10021468
364 Ga0105251_10054299
365 Ga0105251_10179324
366 Ga0105244_10000147
367 Ga0105244_10010648
368 Ga0105244_10010687
369 Ga0105244_10174670
370 Ga0105244_10230316
371 Ga0105250_10000299
372 Ga0105250_10015644
373 Ga0111539_10002043
374 Ga0111539_10007217
375 Ga0111539_10440637
376 Ga0114129_10001249
377 Ga0114129_10192712
378 Ga0105243_10068119
379 Ga0105246_10030420
380 Ga0157371_10144066
381 Ga0157369_10002935
382 Ga0157369_10010819
383 Ga0157380_10981636
384 Ga0183360_10096
385 Ga0213872_10013227
386 Ga0213872_10041093
387 Ga0213875_10001013
388 Ga0209129_1000021
389 Ga0207696_1000034
390 Ga0207696_1000332
391 Ga0207696_1000337
392 Ga0207655_1000264
393 Ga0207655_1000745
394 Ga0207655_1002022
395 Ga0207655_1007855
396 Ga0207713_1000014
397 Ga0207713_1000066
398 Ga0207713_1000177
399 Ga0207713_1011708
400 Ga0207713_1066669
401 Ga0207653_10062919
402 Ga0207684_10003106
403 Ga0207684_10045871
404 Ga0207684_10084397
405 Ga0207660_10005211
406 Ga0207660_10021414
407 Ga0207652_10009982
408 Ga0207646_10053861
409 Ga0207646_10071528
410 Ga0207646_10077173
411 Ga0207646_10107211
412 Ga0207690_10180748
413 Ga0207670_10193072
414 Ga0207668_10426266
415 Ga0207648_10030050
416 Ga0207675_100001660
417 Ga0209281_1000065
418 Ga0209281_1000316
419 Ga0209371_1000478
420 Ga0209371_1015196
421 Ga0209996_1002392
422 Ga0210002_1006881
423 Ga0209983_1000662
424 Ga0209971_1003813
425 Ga0207428_10010100
426 Ga0207428_10034101
427 Ga0265323_10003700
428 Ga0268256_1000406
429 Ga0268256_1016831
430 Ga0265330_10000073
431 Ga0265330_10017340
432 Ga0265330_10043157
433 Ga0265332_10014524
434 Ga0265339_10141880
435 Ga0265327_10004354
436 Ga0265316_10000285
437 Ga0265316_10002316
438 Ga0265316_10004844
439 Ga0265316_10052834
440 Ga0265314_10168727
441 Ga0265342_10000046
442 Ga0265342_10011707
443 Ga0265342_10021491
444 Ga0265342_10030817
445 Ga0265342_10096933
446 Ga0316576_10002980
447 Ga0316576_10072514
448 Ga0316576_10126968
449 Ga0316576_10276367
450 Ga0316576_10447068
451 Ga0316578_10231721
452 Ga0307413_10019762
453 Ga0307412_10199022
454 Ga0307416_100046512
455 Ga0316585_10079341
456 Ga0373931_0003769
457 Ga0316584_0251157
458 Ga0316584_0440982
459 Ga0316584_0583077
460 Ga0395900_0569050
461 Ga0395905_0077387
462 Ga0436364_0331623
463 Ga0400484_05270
464 Ga0400484_37922
465 Ga0400486_20466
466 Ga0400483_006206
467 Ga0400483_225905
468 Ga0400483_269476
469 Ga0400489_25505
470 Ga0436365_1241666
471 Ga0436361_0127626
472 Ga0439437_000213
473 Ga0439452_000012
474 Ga0439452_017995
475 Ga0439456_016277
476 Ga0450911_000002
477 Ga0450904_000036
478 Ga0439435_0004385
479 Ga0439459_0000941
480 Ga0451577_0017806
481 Ga0451577_0429465
482 Ga0453683_0006959
483 Ga0453684_0025101
484 Ga0453684_0033979
485 Ga0453684_0050668
486 Ga0453684_0071465
487 Ga0453684_0114123
488 Ga0453684_0395258
489 Ga0451576_0018554
490 Ga0451576_0424480
491 Ga0495627_041366
492 Ga0495591_007864
493 Ga0495638_0024727
494 Ga0495650_0000630
495 Ga0495650_0002835
496 Ga0495650_0042302
497 Ga0495650_0067155
498 Ga0495605_0000197
499 Ga0495605_0007031
500 Ga0495605_0007759
501 Ga0495584_0010761
502 Ga0495585_0003805
503 Ga0495594_0002074
504 Ga0495596_0052333
505 Ga0495607_0000378
506 Ga0495607_0001447
507 Ga0495583_0000689
508 Ga0495583_0002019
509 Ga0495606_0000320
510 Ga0495606_0017789
511 Ga0495610_0036054
512 Ga0495620_0000212
513 Ga0495631_0018074
514 Ga0495637_0000303
515 Ga0495637_0000319
516 Ga0495643_0020722
517 Ga0495648_0004610
518 Ga0495648_0027302
519 Ga0495654_0003439
520 Ga0495654_0045351
521 Ga0495654_0181081
522 Ga0495609_0000273
523 Ga0495609_0000397
524 Ga0495597_0003381
525 Ga0495597_0012894
526 Ga0495633_0000428
527 Ga0495656_0009558
528 Ga0495668_0251998
529 Ga0495611_0000423
530 Ga0495611_0024757
531 Ga0495625_0000076
532 Ga0495661_0000517
533 Ga0495661_0002492
534 Ga0495661_0018770
535 Ga0495670_0011740
536 Ga0495671_0026875
537 Ga0495671_0046255
538 Ga0495649_0002818
539 Ga0495589_0011089
540 Ga0495660_0000179
541 Ga0495660_0001595
542 Ga0495660_0022398
543 Ga0495672_0027684
544 Ga0495683_0000286
545 Ga0495679_000468
546 Ga0495679_001781
547 Ga0495679_039752
548 Ga0495673_0000155
549 Ga0495673_0024460
550 Ga0495673_0027291
551 Ga0495673_0039169
552 Ga0495681_0008251
553 Ga0495681_0061103
554 Ga0495681_0061490
555 Ga0495686_0106297
556 Ga0495626_0000336
557 Ga0495626_0009180
558 Ga0496102_0027102
559 Ga0496102_0156297
560 Ga0496103_0187527
561 Ga0496117_0044934
562 Ga0496118_0111497
563 Ga0496118_0151523
564 Ga0496119_0000023
565 Ga0496120_0008474
566 Ga0496121_0003176
567 Ga0496121_0010769
568 Ga0496122_0000447
569 Ga0496122_0017975
570 Ga0496122_0187403
571 Ga0496123_0000348
572 Ga0496123_0085417
573 Ga0496124_0000109
574 Ga0496124_0001241
575 Ga0496124_0010797
576 Ga0496124_0132566
577 Ga0496124_0417722
578 Ga0496125_0035090
579 Ga0495678_000401
580 Ga0495678_000504
581 Ga0495678_028257
582 Ga0501031_0161405
583 Ga0501036_0323755
584 Ga0501036_0599648
585 Ga0501040_0220474
586 Ga0501046_0431232
587 Ga0501071_0063319
588 Ga0501071_0270390
589 Ga0501072_0465227
590 Ga0501075_0069825
591 Ga0501076_0232863
592 Ga0501076_0392404
593 Ga0501079_0595620
594 Ga0501081_0054314
595 Ga0501081_0138783
596 Ga0501045_0347488
597 nmdc:mga00v17_17675_c1
598 nmdc:mga00v17_249830_c1
599 nmdc:mga05p37_112163_c1
600 nmdc:mga05p37_15205_c1
601 nmdc:mga05p37_1597_c1
602 nmdc:mga05p37_512226_c1
603 nmdc:mga09592_39507_c1
604 nmdc:mga0qj67_2337_c1
605 nmdc:mga0qj67_443858_c1
606 nmdc:mga06r32_1630_c1
607 nmdc:mga08y16_21023_c1
608 nmdc:mga08y16_26949_c1
609 nmdc:mga0n895_203866_c1
610 Ga0501084_0569547
611 Ga0530510_0519103
612 2510283352
613 2510292820
614 2510313290
615 2599330202
616 2599973763
617 2601625636
618 2603701793
619 2603868334
620 2644747877
621 2729147219
622 2738689312
623 2739264700
624 2774128878
625 2808939399
626 2888375539
627 2904517919
628 2917832987
629 2919128687
630 2919497057
631 2923526338
632 2932409089
633 2937540470
634 2939581607
635 2939611532
636 2974298999
637 2984501310
638 2984505227
639 640488930
640 651177020
641 8004593557
642 8016732893
643 8018222129
644 8055092358
645 8055093074
646 8055097715

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

39

190

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9603 1 237
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9563 1 237
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9325 5 234
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.931 6 224
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9265 5 236
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9995 1 237 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.972 5 236 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9559 5 236 3.40.50.300
1ji0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9537 1 237 3.40.50.300
1ji0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9456 1 237 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7X8Z9E7-F1-model_v4 ABC transporter ATP-binding protein 0.9939 5 237 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-T0QFQ1-F1-model_v4 deleted 0.9925 48 237
AF-A0A2N9MLZ7-F1-model_v4 Amino acid/amide ABC transporter ATP-binding protein 2, HAAT family 0.9914 4 237 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A716CKR5-F1-model_v4 High-affinity branched-chain amino acid ABC transporter permease LivM 0.9894 93 237 GO:0005524
GO:0005886
GO:0015658
GO:0016887
AF-H5XUG3-F1-model_v4 ABC-type branched-chain amino acid transport system, ATPase component 0.9891 5 236 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Map