F407100
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 323 | 208 | 318 | 263 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0012354|Ga0501034_0012354_5910_6803 |
| Length | 297 |
| Sequence | MGGQEGDDEPLGAPPDGRLGAGAGGMKIATYNVNGINGRLPVLLRWLKQAKPDVVCLQELKAPEEKFPALALRDAGYGAIWHGQKSWNGVAILARGEAAPVETRRGLPGDPADLHSRYLEATVGGVTVGCLYLPNGNPAPGPKFDYKLKWLARLTKHAARLQKSKVPVVLAGDFNVIPTETDVYKPENWKTDALFLPESRAAFHKLVKQGWIDALRELHPDERVYTFWDYFRNAWPRNAGIRIDHFLLNPAVAKRLVAAGVDREVRGWEKTSDHAPVWIELKSSAPKSRKKVRKVTE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 2 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 3 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 4 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 5 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 6 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 13 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 83 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 141 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 142 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 143 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 144 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 145 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 148 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 149 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 150 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 151 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 152 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 153 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 154 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 184 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 185 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 187 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 188 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 189 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 190 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 191 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 192 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 193 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 194 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 195 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 201 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 202 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 203 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 204 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 205 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 206 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 207 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 208 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.45 |
| Metatranscriptomes | 0 |
| Isolates | 1.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.15 |
| Nodule | 0 |
| Rhizoplane | 2.79 |
| Rhizosphere | 69.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25158J39367_1001886 | 3300002739 | Bacteria | 3542 |
| 2 | JGI25158J39367_1005346 | 3300002739 | Bacteria | 1886 |
| 3 | JGI25152J39213_1000002 | 3300002773 | Bacteria | 219237 |
| 4 | JGI25152J39213_1017356 | 3300002773 | Bacteria | 1361 |
| 5 | JGI25150J39212_1000353 | 3300002774 | Bacteria | 22643 |
| 6 | JGI25150J39212_1004683 | 3300002774 | Bacteria | 3008 |
| 7 | JGI25159J45721_1000898 | 3300002987 | Bacteria | 12949 |
| 8 | JGI25159J45721_1004396 | 3300002987 | Bacteria | 4688 |
| 9 | JGI25165J46597_1000013 | 3300003214 | Bacteria | 402100 |
| 10 | JGI25153J46596_10002515 | 3300003215 | Bacteria | 10526 |
| 11 | JGI25161J50226_1000715 | 3300003374 | Bacteria | 12929 |
| 12 | Ga0055526_1001002 | 3300003771 | Bacteria | 20751 |
| 13 | Ga0055526_1001190 | 3300003771 | Bacteria | 18847 |
| 14 | Ga0055526_1003211 | 3300003771 | Bacteria | 10555 |
| 15 | Ga0055526_1006658 | 3300003771 | Bacteria | 6202 |
| 16 | Ga0055537_1000027 | 3300003773 | Bacteria | 102244 |
| 17 | Ga0055524_1000372 | 3300003775 | Bacteria | 39278 |
| 18 | Ga0055524_1018647 | 3300003775 | Bacteria | 2401 |
| 19 | Ga0055524_1021414 | 3300003775 | Bacteria | 2144 |
| 20 | Ga0055534_1000019 | 3300003784 | Bacteria | 137920 |
| 21 | Ga0055534_1008944 | 3300003784 | Bacteria | 2219 |
| 22 | Ga0055528_1000055 | 3300003790 | Bacteria | 89917 |
| 23 | Ga0055528_1004886 | 3300003790 | Bacteria | 6344 |
| 24 | Ga0055530_10009265 | 3300003791 | Bacteria | 3811 |
| 25 | Ga0055530_10038416 | 3300003791 | Bacteria | 1190 |
| 26 | Ga0055531_10001695 | 3300003794 | Bacteria | 15819 |
| 27 | Ga0055543_1000667 | 3300004625 | Bacteria | 18080 |
| 28 | Ga0055543_1002196 | 3300004625 | Bacteria | 6683 |
| 29 | Ga0065165_1001017 | 3300005262 | Bacteria | 34070 |
| 30 | Ga0065165_1001551 | 3300005262 | Bacteria | 23972 |
| 31 | Ga0065165_1003793 | 3300005262 | Bacteria | 10109 |
| 32 | Ga0065714_10064560 | 3300005288 | Bacteria | 36054 |
| 33 | Ga0065704_10072807 | 3300005289 | Bacteria | 7978 |
| 34 | Ga0070658_10028117 | 3300005327 | Bacteria | 4513 |
| 35 | Ga0070658_10034487 | 3300005327 | Bacteria | 4071 |
| 36 | Ga0070658_10136420 | 3300005327 | Bacteria | 2047 |
| 37 | Ga0070658_10142498 | 3300005327 | Bacteria | 2002 |
| 38 | Ga0070658_10343211 | 3300005327 | Bacteria | 1277 |
| 39 | Ga0070683_100055106 | 3300005329 | Bacteria | 3689 |
| 40 | Ga0070683_100426740 | 3300005329 | Bacteria | 1265 |
| 41 | Ga0070677_10000029 | 3300005333 | Bacteria | 42300 |
| 42 | Ga0070666_10121758 | 3300005335 | Bacteria | 1809 |
| 43 | Ga0070680_100168212 | 3300005336 | Bacteria | 1844 |
| 44 | Ga0070680_100569609 | 3300005336 | Bacteria | 971 |
| 45 | Ga0070660_100018796 | 3300005339 | Bacteria | 5056 |
| 46 | Ga0070660_100024157 | 3300005339 | Bacteria | 4508 |
| 47 | Ga0070660_100486651 | 3300005339 | Bacteria | 1026 |
| 48 | Ga0070689_100394366 | 3300005340 | Bacteria | 1169 |
| 49 | Ga0070692_10006775 | 3300005345 | Bacteria | 4999 |
| 50 | Ga0070668_100017364 | 3300005347 | Bacteria | 5389 |
| 51 | Ga0070668_100041710 | 3300005347 | Bacteria | 3516 |
| 52 | Ga0070669_100018292 | 3300005353 | Bacteria | 5008 |
| 53 | Ga0070669_100443411 | 3300005353 | Bacteria | 1069 |
| 54 | Ga0070675_100014706 | 3300005354 | Bacteria | 6174 |
| 55 | Ga0070671_100007611 | 3300005355 | Bacteria | 8663 |
| 56 | Ga0070671_100257999 | 3300005355 | Bacteria | 1481 |
| 57 | Ga0070673_100137798 | 3300005364 | Bacteria | 2056 |
| 58 | Ga0070673_100275413 | 3300005364 | Bacteria | 1474 |
| 59 | Ga0070659_100049997 | 3300005366 | Bacteria | 3288 |
| 60 | Ga0070711_100107707 | 3300005439 | Bacteria | 2040 |
| 61 | Ga0070663_100048820 | 3300005455 | Bacteria | 3003 |
| 62 | Ga0070662_100008501 | 3300005457 | Bacteria | 6700 |
| 63 | Ga0070681_10084471 | 3300005458 | Bacteria | 3127 |
| 64 | Ga0070681_10185189 | 3300005458 | Bacteria | 2003 |
| 65 | Ga0070681_10240816 | 3300005458 | Bacteria | 1723 |
| 66 | Ga0070679_100032548 | 3300005530 | Bacteria | 5158 |
| 67 | Ga0070679_100044439 | 3300005530 | Bacteria | 4426 |
| 68 | Ga0070679_100087348 | 3300005530 | Bacteria | 3105 |
| 69 | Ga0070679_100419460 | 3300005530 | Bacteria | 1284 |
| 70 | Ga0070679_100436615 | 3300005530 | Bacteria | 1254 |
| 71 | Ga0070684_100182519 | 3300005535 | Bacteria | 1908 |
| 72 | Ga0070672_100001685 | 3300005543 | Bacteria | 13779 |
| 73 | Ga0070665_100670375 | 3300005548 | Bacteria | 1050 |
| 74 | Ga0070704_100003187 | 3300005549 | Bacteria | 9379 |
| 75 | Ga0068855_100025618 | 3300005563 | Bacteria | 7055 |
| 76 | Ga0068855_100208652 | 3300005563 | Bacteria | 2196 |
| 77 | Ga0070664_100121412 | 3300005564 | Bacteria | 2288 |
| 78 | Ga0068854_100138697 | 3300005578 | Bacteria | 1864 |
| 79 | Ga0068856_100022099 | 3300005614 | Bacteria | 6186 |
| 80 | Ga0068856_100036265 | 3300005614 | Bacteria | 4835 |
| 81 | Ga0068856_100038866 | 3300005614 | Bacteria | 4672 |
| 82 | Ga0068856_100072854 | 3300005614 | Bacteria | 3401 |
| 83 | Ga0068852_100007647 | 3300005616 | Bacteria | 7903 |
| 84 | Ga0068852_100041154 | 3300005616 | Bacteria | 3903 |
| 85 | Ga0068859_100437064 | 3300005617 | Bacteria | 1405 |
| 86 | Ga0068864_100077720 | 3300005618 | Bacteria | 2903 |
| 87 | Ga0068861_100013732 | 3300005719 | Bacteria | 5671 |
| 88 | Ga0068861_100041229 | 3300005719 | Bacteria | 3457 |
| 89 | Ga0068858_100380551 | 3300005842 | Bacteria | 1354 |
| 90 | Ga0068860_100014946 | 3300005843 | Bacteria | 7589 |
| 91 | Ga0068860_100033228 | 3300005843 | Bacteria | 4952 |
| 92 | Ga0068860_100033926 | 3300005843 | Bacteria | 4896 |
| 93 | Ga0097621_100183289 | 3300006237 | Bacteria | 1810 |
| 94 | Ga0075370_10006286 | 3300006353 | Bacteria | 5964 |
| 95 | Ga0068871_100093571 | 3300006358 | Bacteria | 2508 |
| 96 | Ga0075430_100028664 | 3300006846 | Bacteria | 4728 |
| 97 | Ga0075436_100030601 | 3300006914 | Bacteria | 3704 |
| 98 | Ga0097620_100437035 | 3300006931 | Bacteria | 1405 |
| 99 | Ga0105240_10028621 | 3300009093 | Bacteria | 7273 |
| 100 | Ga0105240_10073044 | 3300009093 | Bacteria | 4237 |
| 101 | Ga0105240_10166690 | 3300009093 | Bacteria | 2612 |
| 102 | Ga0105240_10797557 | 3300009093 | Bacteria | 1023 |
| 103 | Ga0111539_10139001 | 3300009094 | Bacteria | 2844 |
| 104 | Ga0105241_10367697 | 3300009174 | Bacteria | 1253 |
| 105 | Ga0105248_10090483 | 3300009177 | Bacteria | 3446 |
| 106 | Ga0105237_10041514 | 3300009545 | Bacteria | 4639 |
| 107 | Ga0105238_10003838 | 3300009551 | Bacteria | 14926 |
| 108 | Ga0105239_10453120 | 3300010375 | Bacteria | 1456 |
| 109 | Ga0157373_10137675 | 3300013100 | Bacteria | 1717 |
| 110 | Ga0157371_10009845 | 3300013102 | Bacteria | 7489 |
| 111 | Ga0157371_10099538 | 3300013102 | Bacteria | 2062 |
| 112 | Ga0157370_10000155 | 3300013104 | Bacteria | 84680 |
| 113 | Ga0157370_10022575 | 3300013104 | Bacteria | 6262 |
| 114 | Ga0157370_10115573 | 3300013104 | Bacteria | 2506 |
| 115 | Ga0157370_10230337 | 3300013104 | Bacteria | 1715 |
| 116 | Ga0157369_10403752 | 3300013105 | Bacteria | 1418 |
| 117 | Ga0163162_10049569 | 3300013306 | Bacteria | 4209 |
| 118 | Ga0163162_10055459 | 3300013306 | Bacteria | 3990 |
| 119 | Ga0157372_10111706 | 3300013307 | Bacteria | 3131 |
| 120 | Ga0157372_10149691 | 3300013307 | Bacteria | 2693 |
| 121 | Ga0157375_10088176 | 3300013308 | Bacteria | 3157 |
| 122 | Ga0157380_10003879 | 3300014326 | Bacteria | 10314 |
| 123 | Ga0157380_10054767 | 3300014326 | Bacteria | 3166 |
| 124 | Ga0182008_10030039 | 3300014497 | Bacteria | 2742 |
| 125 | Ga0157379_10285105 | 3300014968 | Bacteria | 1503 |
| 126 | Ga0157379_10285898 | 3300014968 | Bacteria | 1501 |
| 127 | Ga0157379_10373069 | 3300014968 | Bacteria | 1308 |
| 128 | Ga0157376_10038224 | 3300014969 | Bacteria | 3904 |
| 129 | Ga0157376_10075901 | 3300014969 | Bacteria | 2870 |
| 130 | Ga0163161_10002604 | 3300017792 | Bacteria | 12862 |
| 131 | Ga0163161_10036280 | 3300017792 | Bacteria | 3530 |
| 132 | Ga0213876_10092122 | 3300021384 | Bacteria | 1605 |
| 133 | Ga0209436_102410 | 3300025208 | Bacteria | 5658 |
| 134 | Ga0209436_110203 | 3300025208 | Bacteria | 1733 |
| 135 | Ga0207427_104155 | 3300025231 | Bacteria | 2576 |
| 136 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 137 | Ga0207425_1000115 | 3300025245 | Bacteria | 76109 |
| 138 | Ga0207425_1000790 | 3300025245 | Bacteria | 16150 |
| 139 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 140 | Ga0209233_1000013 | 3300025261 | Bacteria | 1013785 |
| 141 | Ga0209565_1000017 | 3300025263 | Bacteria | 462438 |
| 142 | Ga0209565_1000233 | 3300025263 | Bacteria | 60923 |
| 143 | Ga0209565_1000323 | 3300025263 | Bacteria | 43012 |
| 144 | Ga0209565_1001356 | 3300025263 | Bacteria | 11045 |
| 145 | Ga0209565_1002739 | 3300025263 | Bacteria | 6119 |
| 146 | Ga0209565_1023501 | 3300025263 | Bacteria | 1265 |
| 147 | Ga0209673_1000007 | 3300025273 | Bacteria | 634477 |
| 148 | Ga0209130_1000055 | 3300025284 | Bacteria | 211696 |
| 149 | Ga0209130_1000630 | 3300025284 | Bacteria | 33099 |
| 150 | Ga0209675_1000009 | 3300025291 | Bacteria | 562872 |
| 151 | Ga0209675_1007118 | 3300025291 | Bacteria | 4350 |
| 152 | Ga0209564_1000036 | 3300025295 | Bacteria | 423455 |
| 153 | Ga0209564_1000055 | 3300025295 | Bacteria | 343782 |
| 154 | Ga0209564_1001991 | 3300025295 | Bacteria | 17896 |
| 155 | Ga0209564_1002221 | 3300025295 | Bacteria | 16087 |
| 156 | Ga0209564_1008887 | 3300025295 | Bacteria | 4881 |
| 157 | Ga0209758_1000020 | 3300025297 | Bacteria | 734220 |
| 158 | Ga0209758_1036630 | 3300025297 | Bacteria | 1911 |
| 159 | Ga0209050_1001631 | 3300025298 | Bacteria | 22996 |
| 160 | Ga0209050_1002661 | 3300025298 | Bacteria | 14602 |
| 161 | Ga0209050_1011508 | 3300025298 | Bacteria | 4183 |
| 162 | Ga0209256_1000028 | 3300025299 | Bacteria | 420213 |
| 163 | Ga0209256_1000091 | 3300025299 | Bacteria | 210945 |
| 164 | Ga0209256_1007370 | 3300025299 | Bacteria | 5454 |
| 165 | Ga0207426_1005702 | 3300025302 | Bacteria | 5617 |
| 166 | Ga0207426_1011387 | 3300025302 | Bacteria | 3392 |
| 167 | Ga0209257_1001449 | 3300025304 | Bacteria | 28048 |
| 168 | Ga0209257_1006197 | 3300025304 | Bacteria | 7852 |
| 169 | Ga0207653_10052454 | 3300025885 | Bacteria | 1360 |
| 170 | Ga0207688_10202419 | 3300025901 | Bacteria | 1191 |
| 171 | Ga0207680_10058150 | 3300025903 | Bacteria | 2342 |
| 172 | Ga0207699_10077027 | 3300025906 | Bacteria | 2056 |
| 173 | Ga0207705_10000946 | 3300025909 | Bacteria | 23719 |
| 174 | Ga0207705_10003701 | 3300025909 | Bacteria | 11638 |
| 175 | Ga0207705_10043783 | 3300025909 | Bacteria | 3216 |
| 176 | Ga0207707_10067106 | 3300025912 | Bacteria | 3125 |
| 177 | Ga0207707_10134067 | 3300025912 | Bacteria | 2166 |
| 178 | Ga0207695_10020161 | 3300025913 | Bacteria | 7646 |
| 179 | Ga0207695_10022362 | 3300025913 | Bacteria | 7180 |
| 180 | Ga0207695_10082074 | 3300025913 | Bacteria | 3261 |
| 181 | Ga0207671_10063974 | 3300025914 | Bacteria | 2734 |
| 182 | Ga0207660_10277699 | 3300025917 | Bacteria | 1329 |
| 183 | Ga0207657_10015111 | 3300025919 | Bacteria | 7498 |
| 184 | Ga0207657_10016835 | 3300025919 | Bacteria | 7038 |
| 185 | Ga0207657_10310232 | 3300025919 | Bacteria | 1249 |
| 186 | Ga0207649_10062391 | 3300025920 | Bacteria | 2350 |
| 187 | Ga0207652_10030464 | 3300025921 | Bacteria | 4519 |
| 188 | Ga0207652_10031422 | 3300025921 | Bacteria | 4460 |
| 189 | Ga0207681_10000372 | 3300025923 | Bacteria | 31712 |
| 190 | Ga0207694_10146409 | 3300025924 | Bacteria | 1901 |
| 191 | Ga0207650_10197351 | 3300025925 | Bacteria | 1610 |
| 192 | Ga0207659_10015033 | 3300025926 | Bacteria | 5005 |
| 193 | Ga0207700_10079589 | 3300025928 | Bacteria | 2553 |
| 194 | Ga0207644_10004914 | 3300025931 | Bacteria | 8713 |
| 195 | Ga0207690_10097363 | 3300025932 | Bacteria | 2093 |
| 196 | Ga0207706_10003602 | 3300025933 | Bacteria | 14787 |
| 197 | Ga0207669_10110204 | 3300025937 | Bacteria | 1843 |
| 198 | Ga0207665_10006054 | 3300025939 | Bacteria | 8035 |
| 199 | Ga0207691_10002365 | 3300025940 | Bacteria | 18475 |
| 200 | Ga0207691_10041838 | 3300025940 | Bacteria | 4227 |
| 201 | Ga0207711_10054582 | 3300025941 | Bacteria | 3429 |
| 202 | Ga0207711_10130398 | 3300025941 | Bacteria | 2254 |
| 203 | Ga0207661_10271082 | 3300025944 | Bacteria | 1515 |
| 204 | Ga0207667_10003395 | 3300025949 | Bacteria | 19649 |
| 205 | Ga0207667_10242272 | 3300025949 | Bacteria | 1845 |
| 206 | Ga0207651_10520834 | 3300025960 | Bacteria | 1030 |
| 207 | Ga0207668_10010359 | 3300025972 | Bacteria | 5633 |
| 208 | Ga0207668_10091464 | 3300025972 | Bacteria | 2236 |
| 209 | Ga0207640_10118464 | 3300025981 | Bacteria | 1892 |
| 210 | Ga0207658_10226393 | 3300025986 | Bacteria | 1576 |
| 211 | Ga0207703_10484375 | 3300026035 | Bacteria | 1159 |
| 212 | Ga0207678_10036559 | 3300026067 | Bacteria | 4275 |
| 213 | Ga0207678_10071256 | 3300026067 | Bacteria | 2980 |
| 214 | Ga0207708_10141086 | 3300026075 | Bacteria | 1890 |
| 215 | Ga0207702_10017610 | 3300026078 | Bacteria | 5911 |
| 216 | Ga0207702_10039224 | 3300026078 | Bacteria | 3967 |
| 217 | Ga0207648_10022251 | 3300026089 | Bacteria | 5696 |
| 218 | Ga0207648_10080140 | 3300026089 | Bacteria | 2849 |
| 219 | Ga0207676_10044026 | 3300026095 | Bacteria | 3441 |
| 220 | Ga0207674_10485305 | 3300026116 | Bacteria | 1194 |
| 221 | Ga0207675_100062180 | 3300026118 | Bacteria | 3486 |
| 222 | Ga0207683_10178298 | 3300026121 | Bacteria | 1926 |
| 223 | Ga0268266_10764296 | 3300028379 | Bacteria | 933 |
| 224 | Ga0268265_10412175 | 3300028380 | Bacteria | 1252 |
| 225 | Ga0268264_10028419 | 3300028381 | Bacteria | 4575 |
| 226 | Ga0268264_10047779 | 3300028381 | Unclassified | 3559 |
| 227 | Ga0268264_10091177 | 3300028381 | Bacteria | 2629 |
| 228 | Ga0307408_100000022 | 3300031548 | Bacteria | 310242 |
| 229 | Ga0307408_100001119 | 3300031548 | Bacteria | 20426 |
| 230 | Ga0307408_100037865 | 3300031548 | Bacteria | 3399 |
| 231 | Ga0307414_10033746 | 3300032004 | Bacteria | 3386 |
| 232 | Ga0307414_10420998 | 3300032004 | Bacteria | 1165 |
| 233 | Ga0373941_0024896 | 3300035115 | Bacteria | 1723 |
| 234 | Ga0373953_0040319 | 3300035117 | Bacteria | 1854 |
| 235 | Ga0373954_0032381 | 3300035118 | Bacteria | 2416 |
| 236 | Ga0373935_0240863 | 3300035692 | Bacteria | 1263 |
| 237 | Ga0373935_0274136 | 3300035692 | Bacteria | 1186 |
| 238 | Ga0373937_0470182 | 3300036401 | Bacteria | 1194 |
| 239 | Ga0395899_0038274 | 3300037312 | Bacteria | 3593 |
| 240 | Ga0395899_0051941 | 3300037312 | Bacteria | 3040 |
| 241 | Ga0395899_0122360 | 3300037312 | Bacteria | 1862 |
| 242 | Ga0395900_0006824 | 3300037418 | Bacteria | 11846 |
| 243 | Ga0395900_0065734 | 3300037418 | Bacteria | 3725 |
| 244 | Ga0395900_0119293 | 3300037418 | Bacteria | 2707 |
| 245 | Ga0395900_0296121 | 3300037418 | Bacteria | 1605 |
| 246 | Ga0395898_0042711 | 3300037466 | Bacteria | 4471 |
| 247 | Ga0395898_0064022 | 3300037466 | Bacteria | 3567 |
| 248 | Ga0395898_0487614 | 3300037466 | Bacteria | 1172 |
| 249 | Ga0395905_0020616 | 3300037471 | Bacteria | 6241 |
| 250 | Ga0395905_0054386 | 3300037471 | Bacteria | 3747 |
| 251 | Ga0395905_0073266 | 3300037471 | Bacteria | 3210 |
| 252 | Ga0395901_0115480 | 3300038443 | Bacteria | 2819 |
| 253 | Ga0395901_0139959 | 3300038443 | Bacteria | 2543 |
| 254 | Ga0436365_0550838 | 3300039437 | Bacteria | 7531 |
| 255 | Ga0466969_0011294 | 3300044656 | Bacteria | 4729 |
| 256 | Ga0495617_000384 | 3300046452 | Bacteria | 24540 |
| 257 | Ga0495590_0066774 | 3300046457 | Bacteria | 1260 |
| 258 | Ga0495638_0021647 | 3300046460 | Bacteria | 4232 |
| 259 | Ga0495580_0069168 | 3300046472 | Bacteria | 2467 |
| 260 | Ga0495582_0015102 | 3300046473 | Bacteria | 4247 |
| 261 | Ga0495585_0000406 | 3300046492 | Bacteria | 41715 |
| 262 | Ga0495607_0027335 | 3300046501 | Bacteria | 3529 |
| 263 | Ga0495583_0000049 | 3300046506 | Bacteria | 216069 |
| 264 | Ga0495606_0112637 | 3300046507 | Bacteria | 1639 |
| 265 | Ga0495608_0170847 | 3300046511 | Bacteria | 1379 |
| 266 | Ga0495616_0004686 | 3300046513 | Bacteria | 8576 |
| 267 | Ga0495637_0008454 | 3300046520 | Bacteria | 5056 |
| 268 | Ga0495648_0000057 | 3300046524 | Bacteria | 157446 |
| 269 | Ga0495587_0028617 | 3300046536 | Bacteria | 3388 |
| 270 | Ga0495609_0002345 | 3300046538 | Bacteria | 11687 |
| 271 | Ga0495656_0069892 | 3300046615 | Bacteria | 1557 |
| 272 | Ga0495668_0000018 | 3300046616 | Bacteria | 417480 |
| 273 | Ga0495668_0021825 | 3300046616 | Bacteria | 3665 |
| 274 | Ga0495625_0004566 | 3300046660 | Bacteria | 13025 |
| 275 | Ga0495661_0023873 | 3300046665 | Bacteria | 3964 |
| 276 | Ga0495658_0001375 | 3300046683 | Bacteria | 12752 |
| 277 | Ga0495669_0035732 | 3300046684 | Bacteria | 2194 |
| 278 | Ga0495671_0132199 | 3300046692 | Bacteria | 1217 |
| 279 | Ga0495649_0032251 | 3300046694 | Bacteria | 2887 |
| 280 | Ga0495649_0231524 | 3300046694 | Bacteria | 953 |
| 281 | Ga0495660_0006997 | 3300046810 | Bacteria | 6649 |
| 282 | Ga0495683_0057336 | 3300047323 | Bacteria | 1936 |
| 283 | Ga0495675_0098103 | 3300047444 | Bacteria | 1836 |
| 284 | Ga0495677_0002839 | 3300047445 | Bacteria | 6749 |
| 285 | Ga0495681_0011728 | 3300047470 | Bacteria | 5196 |
| 286 | Ga0495686_0000773 | 3300047472 | Bacteria | 42004 |
| 287 | Ga0495686_0008303 | 3300047472 | Bacteria | 7637 |
| 288 | Ga0496102_0076347 | 3300048905 | Bacteria | 3082 |
| 289 | Ga0496105_0073953 | 3300048908 | Bacteria | 2815 |
| 290 | Ga0496105_0121794 | 3300048908 | Bacteria | 2151 |
| 291 | Ga0496108_0313779 | 3300048911 | Bacteria | 1366 |
| 292 | Ga0496110_0266886 | 3300048913 | Bacteria | 1558 |
| 293 | Ga0496112_0111863 | 3300048915 | Bacteria | 2700 |
| 294 | Ga0496112_0458957 | 3300048915 | Bacteria | 1211 |
| 295 | Ga0496113_0012651 | 3300048916 | Bacteria | 5679 |
| 296 | Ga0496115_0120136 | 3300048918 | Bacteria | 2162 |
| 297 | Ga0496119_0000450 | 3300048922 | Bacteria | 56283 |
| 298 | Ga0496122_0000018 | 3300048925 | Bacteria | 426350 |
| 299 | Ga0496123_0000015 | 3300048926 | Bacteria | 426088 |
| 300 | Ga0496124_0174426 | 3300048927 | Bacteria | 1661 |
| 301 | Ga0496126_0001897 | 3300048929 | Bacteria | 30122 |
| 302 | Ga0495678_051019 | 3300049459 | Bacteria | 1601 |
| 303 | Ga0501034_0012354 | 3300049571 | Bacteria | 8822 |
| 304 | Ga0501034_0162725 | 3300049571 | Bacteria | 2202 |
| 305 | Ga0501034_0444356 | 3300049571 | Bacteria | 1215 |
| 306 | nmdc:mga05p37_1576_c1 | 3300050507 | Bacteria | 19968 |
| 307 | nmdc:mga0qj67_67891_c1 | 3300050509 | Bacteria | 2841 |
| 308 | nmdc:mga0n895_86710_c1 | 3300050512 | Bacteria | 3127 |
| 309 | Ga0500650_0032471 | 3300053098 | Bacteria | 2378 |
| 310 | Ga0500554_001903 | 3300053102 | Bacteria | 4036 |
| 311 | Ga0500592_000041 | 3300053116 | Bacteria | 40085 |
| 312 | Ga0500595_032705 | 3300053119 | Bacteria | 1733 |
| 313 | Ga0500642_0006312 | 3300053130 | Bacteria | 3892 |
| 314 | Ga0500568_0004294 | 3300053139 | Bacteria | 7644 |
| 315 | Ga0500622_0000007 | 3300053156 | Bacteria | 425621 |
| 316 | Ga0500622_0000013 | 3300053156 | Bacteria | 371650 |
| 317 | Ga0500627_0000157 | 3300053158 | Bacteria | 20081 |
| 318 | Ga0500609_010914 | 3300053731 | Bacteria | 1226 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035115 | Ga0373941_0024896 | Ga0373941_0024896_977_1708 | 243 |
| 2 | iso_pu_bacteria | 2842733646 | 2842739115 | 253 |
| 3 | iso_pu_bacteria | 2643221734 | 2644734519 | 255 |
| 4 | 3300002987 | JGI25159J45721_1004396 | JGI25159J45721_10043965 | 256 |
| 5 | 3300003771 | Ga0055526_1006658 | Ga0055526_10066582 | 256 |
| 6 | 3300003773 | Ga0055537_1000027 | Ga0055537_100002761 | 256 |
| 7 | 3300003775 | Ga0055524_1021414 | Ga0055524_10214143 | 256 |
| 8 | 3300003784 | Ga0055534_1000019 | Ga0055534_10000195 | 256 |
| 9 | 3300003790 | Ga0055528_1000055 | Ga0055528_100005532 | 256 |
| 10 | 3300004625 | Ga0055543_1002196 | Ga0055543_10021963 | 256 |
| 11 | 3300005262 | Ga0065165_1001017 | Ga0065165_10010179 | 256 |
| 12 | 3300005327 | Ga0070658_10034487 | Ga0070658_100344875 | 256 |
| 13 | 3300005339 | Ga0070660_100024157 | Ga0070660_1000241572 | 256 |
| 14 | 3300005530 | Ga0070679_100044439 | Ga0070679_1000444392 | 256 |
| 15 | 3300005530 | Ga0070679_100419460 | Ga0070679_1004194601 | 256 |
| 16 | 3300025208 | Ga0209436_110203 | Ga0209436_1102032 | 256 |
| 17 | 3300025263 | Ga0209565_1000017 | Ga0209565_1000017282 | 256 |
| 18 | 3300025273 | Ga0209673_1000007 | Ga0209673_1000007147 | 256 |
| 19 | 3300025284 | Ga0209130_1000630 | Ga0209130_100063032 | 256 |
| 20 | 3300025291 | Ga0209675_1000009 | Ga0209675_1000009371 | 256 |
| 21 | 3300025295 | Ga0209564_1000036 | Ga0209564_1000036147 | 256 |
| 22 | 3300025295 | Ga0209564_1000055 | Ga0209564_1000055306 | 256 |
| 23 | 3300025299 | Ga0209256_1000091 | Ga0209256_1000091147 | 256 |
| 24 | 3300025302 | Ga0207426_1011387 | Ga0207426_10113874 | 256 |
| 25 | 3300025909 | Ga0207705_10000946 | Ga0207705_1000094610 | 256 |
| 26 | 3300025909 | Ga0207705_10003701 | Ga0207705_100037019 | 256 |
| 27 | 3300025919 | Ga0207657_10016835 | Ga0207657_100168355 | 256 |
| 28 | 3300025919 | Ga0207657_10310232 | Ga0207657_103102321 | 256 |
| 29 | 3300025921 | Ga0207652_10030464 | Ga0207652_100304645 | 256 |
| 30 | 3300025940 | Ga0207691_10041838 | Ga0207691_100418382 | 256 |
| 31 | 3300026121 | Ga0207683_10178298 | Ga0207683_101782982 | 256 |
| 32 | 3300032004 | Ga0307414_10033746 | Ga0307414_100337462 | 256 |
| 33 | 3300044656 | Ga0466969_0011294 | Ga0466969_0011294_1189_1968 | 256 |
| 34 | 3300046457 | Ga0495590_0066774 | Ga0495590_0066774_208_978 | 256 |
| 35 | 3300046460 | Ga0495638_0021647 | Ga0495638_0021647_873_1643 | 256 |
| 36 | 3300046501 | Ga0495607_0027335 | Ga0495607_0027335_949_1719 | 256 |
| 37 | 3300046507 | Ga0495606_0112637 | Ga0495606_0112637_579_1349 | 256 |
| 38 | 3300046513 | Ga0495616_0004686 | Ga0495616_0004686_1511_2281 | 256 |
| 39 | 3300046538 | Ga0495609_0002345 | Ga0495609_0002345_3597_4367 | 256 |
| 40 | 3300046616 | Ga0495668_0000018 | Ga0495668_0000018_241751_242521 | 256 |
| 41 | 3300046616 | Ga0495668_0021825 | Ga0495668_0021825_2739_3509 | 256 |
| 42 | 3300046660 | Ga0495625_0004566 | Ga0495625_0004566_4935_5705 | 256 |
| 43 | 3300046665 | Ga0495661_0023873 | Ga0495661_0023873_359_1129 | 256 |
| 44 | 3300046684 | Ga0495669_0035732 | Ga0495669_0035732_337_1107 | 256 |
| 45 | 3300046692 | Ga0495671_0132199 | Ga0495671_0132199_347_1117 | 256 |
| 46 | 3300046694 | Ga0495649_0231524 | Ga0495649_0231524_28_798 | 256 |
| 47 | 3300046810 | Ga0495660_0006997 | Ga0495660_0006997_1412_2182 | 256 |
| 48 | 3300047445 | Ga0495677_0002839 | Ga0495677_0002839_2731_3501 | 256 |
| 49 | 3300047470 | Ga0495681_0011728 | Ga0495681_0011728_3597_4367 | 256 |
| 50 | 3300047472 | Ga0495686_0000773 | Ga0495686_0000773_16917_17687 | 256 |
| 51 | 3300049459 | Ga0495678_051019 | Ga0495678_051019_512_1282 | 256 |
| 52 | 3300053156 | Ga0500622_0000007 | Ga0500622_0000007_31621_32391 | 256 |
| 53 | 3300003771 | Ga0055526_1003211 | Ga0055526_10032118 | 257 |
| 54 | 3300005288 | Ga0065714_10064560 | Ga0065714_1006456012 | 257 |
| 55 | 3300005289 | Ga0065704_10072807 | Ga0065704_100728079 | 257 |
| 56 | 3300005364 | Ga0070673_100275413 | Ga0070673_1002754133 | 257 |
| 57 | 3300005366 | Ga0070659_100049997 | Ga0070659_1000499974 | 257 |
| 58 | 3300005530 | Ga0070679_100032548 | Ga0070679_1000325484 | 257 |
| 59 | 3300005549 | Ga0070704_100003187 | Ga0070704_1000031879 | 257 |
| 60 | 3300006914 | Ga0075436_100030601 | Ga0075436_1000306014 | 257 |
| 61 | 3300009093 | Ga0105240_10166690 | Ga0105240_101666903 | 257 |
| 62 | 3300009094 | Ga0111539_10139001 | Ga0111539_101390012 | 257 |
| 63 | 3300009545 | Ga0105237_10041514 | Ga0105237_100415142 | 257 |
| 64 | 3300013102 | Ga0157371_10099538 | Ga0157371_100995382 | 257 |
| 65 | 3300013104 | Ga0157370_10230337 | Ga0157370_102303372 | 257 |
| 66 | 3300013307 | Ga0157372_10149691 | Ga0157372_101496913 | 257 |
| 67 | 3300014326 | Ga0157380_10003879 | Ga0157380_100038797 | 257 |
| 68 | 3300014968 | Ga0157379_10285105 | Ga0157379_102851051 | 257 |
| 69 | 3300017792 | Ga0163161_10002604 | Ga0163161_100026048 | 257 |
| 70 | 3300025295 | Ga0209564_1001991 | Ga0209564_100199110 | 257 |
| 71 | 3300025297 | Ga0209758_1036630 | Ga0209758_10366302 | 257 |
| 72 | 3300025298 | Ga0209050_1011508 | Ga0209050_10115083 | 257 |
| 73 | 3300025885 | Ga0207653_10052454 | Ga0207653_100524542 | 257 |
| 74 | 3300025906 | Ga0207699_10077027 | Ga0207699_100770272 | 257 |
| 75 | 3300025928 | Ga0207700_10079589 | Ga0207700_100795892 | 257 |
| 76 | 3300025939 | Ga0207665_10006054 | Ga0207665_100060544 | 257 |
| 77 | 3300025944 | Ga0207661_10271082 | Ga0207661_102710822 | 257 |
| 78 | 3300025960 | Ga0207651_10520834 | Ga0207651_105208341 | 257 |
| 79 | 3300026067 | Ga0207678_10071256 | Ga0207678_100712562 | 257 |
| 80 | 3300026089 | Ga0207648_10022251 | Ga0207648_100222516 | 257 |
| 81 | 3300046452 | Ga0495617_000384 | Ga0495617_000384_13486_14259 | 257 |
| 82 | 3300046473 | Ga0495582_0015102 | Ga0495582_0015102_70_843 | 257 |
| 83 | 3300046492 | Ga0495585_0000406 | Ga0495585_0000406_29328_30101 | 257 |
| 84 | 3300046506 | Ga0495583_0000049 | Ga0495583_0000049_94360_95133 | 257 |
| 85 | 3300046524 | Ga0495648_0000057 | Ga0495648_0000057_145853_146626 | 257 |
| 86 | 3300046615 | Ga0495656_0069892 | Ga0495656_0069892_481_1254 | 257 |
| 87 | 3300047323 | Ga0495683_0057336 | Ga0495683_0057336_1066_1839 | 257 |
| 88 | 3300053156 | Ga0500622_0000013 | Ga0500622_0000013_336374_337147 | 257 |
| 89 | 3300005262 | Ga0065165_1001551 | Ga0065165_10015517 | 258 |
| 90 | 3300005327 | Ga0070658_10343211 | Ga0070658_103432112 | 258 |
| 91 | 3300005329 | Ga0070683_100426740 | Ga0070683_1004267401 | 258 |
| 92 | 3300005335 | Ga0070666_10121758 | Ga0070666_101217584 | 258 |
| 93 | 3300005336 | Ga0070680_100168212 | Ga0070680_1001682121 | 258 |
| 94 | 3300005336 | Ga0070680_100569609 | Ga0070680_1005696091 | 258 |
| 95 | 3300005340 | Ga0070689_100394366 | Ga0070689_1003943661 | 258 |
| 96 | 3300005347 | Ga0070668_100017364 | Ga0070668_1000173649 | 258 |
| 97 | 3300005347 | Ga0070668_100041710 | Ga0070668_1000417103 | 258 |
| 98 | 3300005353 | Ga0070669_100018292 | Ga0070669_1000182924 | 258 |
| 99 | 3300005353 | Ga0070669_100443411 | Ga0070669_1004434112 | 258 |
| 100 | 3300005354 | Ga0070675_100014706 | Ga0070675_1000147067 | 258 |
| 101 | 3300005355 | Ga0070671_100007611 | Ga0070671_1000076112 | 258 |
| 102 | 3300005355 | Ga0070671_100257999 | Ga0070671_1002579992 | 258 |
| 103 | 3300005364 | Ga0070673_100137798 | Ga0070673_1001377982 | 258 |
| 104 | 3300005439 | Ga0070711_100107707 | Ga0070711_1001077071 | 258 |
| 105 | 3300005457 | Ga0070662_100008501 | Ga0070662_1000085012 | 258 |
| 106 | 3300005458 | Ga0070681_10084471 | Ga0070681_100844713 | 258 |
| 107 | 3300005530 | Ga0070679_100087348 | Ga0070679_1000873482 | 258 |
| 108 | 3300005530 | Ga0070679_100436615 | Ga0070679_1004366151 | 258 |
| 109 | 3300005535 | Ga0070684_100182519 | Ga0070684_1001825192 | 258 |
| 110 | 3300005543 | Ga0070672_100001685 | Ga0070672_1000016853 | 258 |
| 111 | 3300005617 | Ga0068859_100437064 | Ga0068859_1004370642 | 258 |
| 112 | 3300005618 | Ga0068864_100077720 | Ga0068864_1000777203 | 258 |
| 113 | 3300005719 | Ga0068861_100041229 | Ga0068861_1000412293 | 258 |
| 114 | 3300005842 | Ga0068858_100380551 | Ga0068858_1003805512 | 258 |
| 115 | 3300005843 | Ga0068860_100014946 | Ga0068860_1000149469 | 258 |
| 116 | 3300005843 | Ga0068860_100033926 | Ga0068860_1000339264 | 258 |
| 117 | 3300006237 | Ga0097621_100183289 | Ga0097621_1001832891 | 258 |
| 118 | 3300006358 | Ga0068871_100093571 | Ga0068871_1000935713 | 258 |
| 119 | 3300006931 | Ga0097620_100437035 | Ga0097620_1004370352 | 258 |
| 120 | 3300009174 | Ga0105241_10367697 | Ga0105241_103676972 | 258 |
| 121 | 3300009177 | Ga0105248_10090483 | Ga0105248_100904833 | 258 |
| 122 | 3300013104 | Ga0157370_10115573 | Ga0157370_101155732 | 258 |
| 123 | 3300013306 | Ga0163162_10049569 | Ga0163162_100495693 | 258 |
| 124 | 3300013308 | Ga0157375_10088176 | Ga0157375_100881763 | 258 |
| 125 | 3300014326 | Ga0157380_10054767 | Ga0157380_100547675 | 258 |
| 126 | 3300014968 | Ga0157379_10373069 | Ga0157379_103730692 | 258 |
| 127 | 3300014969 | Ga0157376_10075901 | Ga0157376_100759012 | 258 |
| 128 | 3300017792 | Ga0163161_10036280 | Ga0163161_100362803 | 258 |
| 129 | 3300021384 | Ga0213876_10092122 | Ga0213876_100921222 | 258 |
| 130 | 3300025901 | Ga0207688_10202419 | Ga0207688_102024191 | 258 |
| 131 | 3300025903 | Ga0207680_10058150 | Ga0207680_100581502 | 258 |
| 132 | 3300025912 | Ga0207707_10067106 | Ga0207707_100671063 | 258 |
| 133 | 3300025913 | Ga0207695_10020161 | Ga0207695_100201614 | 258 |
| 134 | 3300025913 | Ga0207695_10022362 | Ga0207695_100223625 | 258 |
| 135 | 3300025923 | Ga0207681_10000372 | Ga0207681_1000037212 | 258 |
| 136 | 3300025925 | Ga0207650_10197351 | Ga0207650_101973512 | 258 |
| 137 | 3300025926 | Ga0207659_10015033 | Ga0207659_100150332 | 258 |
| 138 | 3300025931 | Ga0207644_10004914 | Ga0207644_100049143 | 258 |
| 139 | 3300025933 | Ga0207706_10003602 | Ga0207706_1000360213 | 258 |
| 140 | 3300025937 | Ga0207669_10110204 | Ga0207669_101102041 | 258 |
| 141 | 3300025940 | Ga0207691_10002365 | Ga0207691_1000236514 | 258 |
| 142 | 3300025941 | Ga0207711_10054582 | Ga0207711_100545821 | 258 |
| 143 | 3300025941 | Ga0207711_10130398 | Ga0207711_101303982 | 258 |
| 144 | 3300025972 | Ga0207668_10010359 | Ga0207668_100103597 | 258 |
| 145 | 3300025972 | Ga0207668_10091464 | Ga0207668_100914643 | 258 |
| 146 | 3300025986 | Ga0207658_10226393 | Ga0207658_102263932 | 258 |
| 147 | 3300026035 | Ga0207703_10484375 | Ga0207703_104843752 | 258 |
| 148 | 3300026075 | Ga0207708_10141086 | Ga0207708_101410861 | 258 |
| 149 | 3300026089 | Ga0207648_10080140 | Ga0207648_100801402 | 258 |
| 150 | 3300026095 | Ga0207676_10044026 | Ga0207676_100440264 | 258 |
| 151 | 3300026116 | Ga0207674_10485305 | Ga0207674_104853051 | 258 |
| 152 | 3300026118 | Ga0207675_100062180 | Ga0207675_1000621803 | 258 |
| 153 | 3300028379 | Ga0268266_10764296 | Ga0268266_107642962 | 258 |
| 154 | 3300028380 | Ga0268265_10412175 | Ga0268265_104121752 | 258 |
| 155 | 3300028381 | Ga0268264_10028419 | Ga0268264_100284191 | 258 |
| 156 | 3300028381 | Ga0268264_10091177 | Ga0268264_100911772 | 258 |
| 157 | 3300035692 | Ga0373935_0274136 | Ga0373935_0274136_150_968 | 258 |
| 158 | 3300036401 | Ga0373937_0470182 | Ga0373937_0470182_16_813 | 258 |
| 159 | 3300037466 | Ga0395898_0064022 | Ga0395898_0064022_2542_3372 | 258 |
| 160 | 3300038443 | Ga0395901_0115480 | Ga0395901_0115480_1373_2203 | 258 |
| 161 | 3300039437 | Ga0436365_0550838 | Ga0436365_0550838_182_1009 | 258 |
| 162 | 3300046472 | Ga0495580_0069168 | Ga0495580_0069168_796_1590 | 258 |
| 163 | 3300046683 | Ga0495658_0001375 | Ga0495658_0001375_11854_12648 | 258 |
| 164 | 3300048905 | Ga0496102_0076347 | Ga0496102_0076347_1707_2483 | 258 |
| 165 | 3300048908 | Ga0496105_0073953 | Ga0496105_0073953_1545_2321 | 258 |
| 166 | 3300048911 | Ga0496108_0313779 | Ga0496108_0313779_318_1094 | 258 |
| 167 | 3300048913 | Ga0496110_0266886 | Ga0496110_0266886_269_1045 | 258 |
| 168 | 3300048915 | Ga0496112_0111863 | Ga0496112_0111863_569_1345 | 258 |
| 169 | 3300048915 | Ga0496112_0458957 | Ga0496112_0458957_398_1174 | 258 |
| 170 | 3300048916 | Ga0496113_0012651 | Ga0496113_0012651_1752_2528 | 258 |
| 171 | 3300048918 | Ga0496115_0120136 | Ga0496115_0120136_509_1285 | 258 |
| 172 | 3300048925 | Ga0496122_0000018 | Ga0496122_0000018_67771_68550 | 258 |
| 173 | 3300048926 | Ga0496123_0000015 | Ga0496123_0000015_67771_68550 | 258 |
| 174 | 3300048927 | Ga0496124_0174426 | Ga0496124_0174426_383_1162 | 258 |
| 175 | 3300048929 | Ga0496126_0001897 | Ga0496126_0001897_15464_16240 | 258 |
| 176 | 3300053731 | Ga0500609_010914 | Ga0500609_010914_320_1120 | 258 |
| 177 | iso_pu_bacteria | 2643221554 | 2643790863 | 258 |
| 178 | iso_pu_bacteria | 2643221638 | 2644211782 | 258 |
| 179 | 3300003214 | JGI25165J46597_1000013 | JGI25165J46597_1000013163 | 259 |
| 180 | 3300005719 | Ga0068861_100013732 | Ga0068861_1000137325 | 259 |
| 181 | 3300009093 | Ga0105240_10028621 | Ga0105240_100286216 | 259 |
| 182 | 3300025231 | Ga0207427_104155 | Ga0207427_1041554 | 259 |
| 183 | 3300025261 | Ga0209233_1000013 | Ga0209233_1000013416 | 259 |
| 184 | 3300032004 | Ga0307414_10420998 | Ga0307414_104209981 | 259 |
| 185 | 3300037418 | Ga0395900_0006824 | Ga0395900_0006824_4942_5775 | 259 |
| 186 | 3300037471 | Ga0395905_0054386 | Ga0395905_0054386_550_1332 | 259 |
| 187 | 3300046694 | Ga0495649_0032251 | Ga0495649_0032251_522_1352 | 259 |
| 188 | 3300049571 | Ga0501034_0162725 | Ga0501034_0162725_864_1649 | 259 |
| 189 | 3300049571 | Ga0501034_0444356 | Ga0501034_0444356_212_1030 | 259 |
| 190 | 3300053098 | Ga0500650_0032471 | Ga0500650_0032471_1457_2257 | 259 |
| 191 | 3300053102 | Ga0500554_001903 | Ga0500554_001903_3230_4009 | 259 |
| 192 | 3300053116 | Ga0500592_000041 | Ga0500592_000041_19448_20278 | 259 |
| 193 | 3300053130 | Ga0500642_0006312 | Ga0500642_0006312_334_1134 | 259 |
| 194 | 3300053139 | Ga0500568_0004294 | Ga0500568_0004294_1201_2043 | 259 |
| 195 | 3300053158 | Ga0500627_0000157 | Ga0500627_0000157_17511_18341 | 259 |
| 196 | 3300005329 | Ga0070683_100055106 | Ga0070683_1000551063 | 260 |
| 197 | 3300005339 | Ga0070660_100486651 | Ga0070660_1004866511 | 260 |
| 198 | 3300005345 | Ga0070692_10006775 | Ga0070692_100067756 | 260 |
| 199 | 3300005458 | Ga0070681_10240816 | Ga0070681_102408163 | 260 |
| 200 | 3300005548 | Ga0070665_100670375 | Ga0070665_1006703751 | 260 |
| 201 | 3300005614 | Ga0068856_100038866 | Ga0068856_1000388663 | 260 |
| 202 | 3300005843 | Ga0068860_100033228 | Ga0068860_1000332285 | 260 |
| 203 | 3300006846 | Ga0075430_100028664 | Ga0075430_1000286646 | 260 |
| 204 | 3300013104 | Ga0157370_10000155 | Ga0157370_1000015543 | 260 |
| 205 | 3300025912 | Ga0207707_10134067 | Ga0207707_101340674 | 260 |
| 206 | 3300025914 | Ga0207671_10063974 | Ga0207671_100639741 | 260 |
| 207 | 3300025917 | Ga0207660_10277699 | Ga0207660_102776991 | 260 |
| 208 | 3300025921 | Ga0207652_10031422 | Ga0207652_100314224 | 260 |
| 209 | 3300026067 | Ga0207678_10036559 | Ga0207678_100365593 | 260 |
| 210 | 3300028381 | Ga0268264_10047779 | Ga0268264_100477792 | 260 |
| 211 | 3300035692 | Ga0373935_0240863 | Ga0373935_0240863_258_1073 | 260 |
| 212 | 3300037312 | Ga0395899_0122360 | Ga0395899_0122360_303_1094 | 260 |
| 213 | 3300037418 | Ga0395900_0065734 | Ga0395900_0065734_255_1046 | 260 |
| 214 | 3300037418 | Ga0395900_0119293 | Ga0395900_0119293_279_1070 | 260 |
| 215 | 3300037466 | Ga0395898_0042711 | Ga0395898_0042711_204_995 | 260 |
| 216 | 3300037471 | Ga0395905_0020616 | Ga0395905_0020616_1631_2422 | 260 |
| 217 | 3300037471 | Ga0395905_0073266 | Ga0395905_0073266_1993_2784 | 260 |
| 218 | 3300038443 | Ga0395901_0139959 | Ga0395901_0139959_813_1604 | 260 |
| 219 | 3300047472 | Ga0495686_0008303 | Ga0495686_0008303_3007_3834 | 260 |
| 220 | 3300048922 | Ga0496119_0000450 | Ga0496119_0000450_29325_30116 | 260 |
| 221 | 3300050509 | nmdc:mga0qj67_67891_c1 | nmdc:mga0qj67_67891_c1_62_859 | 260 |
| 222 | 3300053119 | Ga0500595_032705 | Ga0500595_032705_861_1679 | 260 |
| 223 | iso_pu_bacteria | 2842805378 | 2842806400 | 260 |
| 224 | 3300005327 | Ga0070658_10136420 | Ga0070658_101364202 | 261 |
| 225 | 3300005327 | Ga0070658_10142498 | Ga0070658_101424983 | 261 |
| 226 | 3300005333 | Ga0070677_10000029 | Ga0070677_1000002919 | 261 |
| 227 | 3300005458 | Ga0070681_10185189 | Ga0070681_101851892 | 261 |
| 228 | 3300005563 | Ga0068855_100025618 | Ga0068855_1000256187 | 261 |
| 229 | 3300005564 | Ga0070664_100121412 | Ga0070664_1001214124 | 261 |
| 230 | 3300005614 | Ga0068856_100036265 | Ga0068856_1000362653 | 261 |
| 231 | 3300005616 | Ga0068852_100041154 | Ga0068852_1000411546 | 261 |
| 232 | 3300006353 | Ga0075370_10006286 | Ga0075370_100062863 | 261 |
| 233 | 3300013105 | Ga0157369_10403752 | Ga0157369_104037522 | 261 |
| 234 | 3300013306 | Ga0163162_10055459 | Ga0163162_100554593 | 261 |
| 235 | 3300013307 | Ga0157372_10111706 | Ga0157372_101117066 | 261 |
| 236 | 3300014497 | Ga0182008_10030039 | Ga0182008_100300394 | 261 |
| 237 | 3300014968 | Ga0157379_10285898 | Ga0157379_102858982 | 261 |
| 238 | 3300014969 | Ga0157376_10038224 | Ga0157376_100382242 | 261 |
| 239 | 3300025909 | Ga0207705_10043783 | Ga0207705_100437832 | 261 |
| 240 | 3300025920 | Ga0207649_10062391 | Ga0207649_100623914 | 261 |
| 241 | 3300025949 | Ga0207667_10242272 | Ga0207667_102422722 | 261 |
| 242 | 3300026078 | Ga0207702_10039224 | Ga0207702_100392244 | 261 |
| 243 | 3300035117 | Ga0373953_0040319 | Ga0373953_0040319_313_1140 | 261 |
| 244 | 3300035118 | Ga0373954_0032381 | Ga0373954_0032381_1363_2190 | 261 |
| 245 | 3300037312 | Ga0395899_0038274 | Ga0395899_0038274_203_1129 | 261 |
| 246 | 3300046511 | Ga0495608_0170847 | Ga0495608_0170847_66_893 | 261 |
| 247 | 3300046536 | Ga0495587_0028617 | Ga0495587_0028617_840_1667 | 261 |
| 248 | 3300047444 | Ga0495675_0098103 | Ga0495675_0098103_671_1498 | 261 |
| 249 | 3300048908 | Ga0496105_0121794 | Ga0496105_0121794_853_1680 | 261 |
| 250 | 3300050507 | nmdc:mga05p37_1576_c1 | nmdc:mga05p37_1576_c1_7557_8462 | 261 |
| 251 | 3300050512 | nmdc:mga0n895_86710_c1 | nmdc:mga0n895_86710_c1_1376_2203 | 261 |
| 252 | 3300002739 | JGI25158J39367_1001886 | JGI25158J39367_10018865 | 262 |
| 253 | 3300002739 | JGI25158J39367_1005346 | JGI25158J39367_10053461 | 262 |
| 254 | 3300002773 | JGI25152J39213_1000002 | JGI25152J39213_1000002170 | 262 |
| 255 | 3300002773 | JGI25152J39213_1017356 | JGI25152J39213_10173562 | 262 |
| 256 | 3300002774 | JGI25150J39212_1000353 | JGI25150J39212_100035322 | 262 |
| 257 | 3300002774 | JGI25150J39212_1004683 | JGI25150J39212_10046834 | 262 |
| 258 | 3300002987 | JGI25159J45721_1000898 | JGI25159J45721_100089812 | 262 |
| 259 | 3300003215 | JGI25153J46596_10002515 | JGI25153J46596_100025156 | 262 |
| 260 | 3300003374 | JGI25161J50226_1000715 | JGI25161J50226_10007156 | 262 |
| 261 | 3300003771 | Ga0055526_1001002 | Ga0055526_100100210 | 262 |
| 262 | 3300003771 | Ga0055526_1001190 | Ga0055526_100119015 | 262 |
| 263 | 3300003775 | Ga0055524_1000372 | Ga0055524_100037222 | 262 |
| 264 | 3300003775 | Ga0055524_1018647 | Ga0055524_10186472 | 262 |
| 265 | 3300003784 | Ga0055534_1008944 | Ga0055534_10089443 | 262 |
| 266 | 3300003790 | Ga0055528_1004886 | Ga0055528_10048867 | 262 |
| 267 | 3300003791 | Ga0055530_10009265 | Ga0055530_100092656 | 262 |
| 268 | 3300003791 | Ga0055530_10038416 | Ga0055530_100384161 | 262 |
| 269 | 3300003794 | Ga0055531_10001695 | Ga0055531_1000169520 | 262 |
| 270 | 3300004625 | Ga0055543_1000667 | Ga0055543_10006676 | 262 |
| 271 | 3300005262 | Ga0065165_1003793 | Ga0065165_10037939 | 262 |
| 272 | 3300005327 | Ga0070658_10028117 | Ga0070658_100281173 | 262 |
| 273 | 3300005339 | Ga0070660_100018796 | Ga0070660_1000187963 | 262 |
| 274 | 3300005455 | Ga0070663_100048820 | Ga0070663_1000488202 | 262 |
| 275 | 3300005563 | Ga0068855_100208652 | Ga0068855_1002086522 | 262 |
| 276 | 3300005578 | Ga0068854_100138697 | Ga0068854_1001386972 | 262 |
| 277 | 3300005614 | Ga0068856_100022099 | Ga0068856_10002209910 | 262 |
| 278 | 3300005614 | Ga0068856_100072854 | Ga0068856_1000728542 | 262 |
| 279 | 3300005616 | Ga0068852_100007647 | Ga0068852_1000076476 | 262 |
| 280 | 3300009093 | Ga0105240_10073044 | Ga0105240_100730442 | 262 |
| 281 | 3300009093 | Ga0105240_10797557 | Ga0105240_107975572 | 262 |
| 282 | 3300009551 | Ga0105238_10003838 | Ga0105238_1000383818 | 262 |
| 283 | 3300010375 | Ga0105239_10453120 | Ga0105239_104531202 | 262 |
| 284 | 3300013100 | Ga0157373_10137675 | Ga0157373_101376753 | 262 |
| 285 | 3300013102 | Ga0157371_10009845 | Ga0157371_1000984510 | 262 |
| 286 | 3300013104 | Ga0157370_10022575 | Ga0157370_100225753 | 262 |
| 287 | 3300025208 | Ga0209436_102410 | Ga0209436_1024102 | 262 |
| 288 | 3300025245 | Ga0207425_1000001 | Ga0207425_10000011111 | 262 |
| 289 | 3300025245 | Ga0207425_1000115 | Ga0207425_100011569 | 262 |
| 290 | 3300025245 | Ga0207425_1000790 | Ga0207425_100079014 | 262 |
| 291 | 3300025258 | Ga0209129_1000001 | Ga0209129_1000001288 | 262 |
| 292 | 3300025263 | Ga0209565_1000233 | Ga0209565_100023323 | 262 |
| 293 | 3300025263 | Ga0209565_1000323 | Ga0209565_100032320 | 262 |
| 294 | 3300025263 | Ga0209565_1001356 | Ga0209565_10013568 | 262 |
| 295 | 3300025263 | Ga0209565_1002739 | Ga0209565_10027393 | 262 |
| 296 | 3300025263 | Ga0209565_1023501 | Ga0209565_10235011 | 262 |
| 297 | 3300025284 | Ga0209130_1000055 | Ga0209130_10000556 | 262 |
| 298 | 3300025291 | Ga0209675_1007118 | Ga0209675_10071182 | 262 |
| 299 | 3300025295 | Ga0209564_1002221 | Ga0209564_10022213 | 262 |
| 300 | 3300025295 | Ga0209564_1008887 | Ga0209564_10088877 | 262 |
| 301 | 3300025297 | Ga0209758_1000020 | Ga0209758_1000020165 | 262 |
| 302 | 3300025298 | Ga0209050_1001631 | Ga0209050_10016318 | 262 |
| 303 | 3300025298 | Ga0209050_1002661 | Ga0209050_100266110 | 262 |
| 304 | 3300025299 | Ga0209256_1000028 | Ga0209256_1000028138 | 262 |
| 305 | 3300025299 | Ga0209256_1007370 | Ga0209256_10073704 | 262 |
| 306 | 3300025302 | Ga0207426_1005702 | Ga0207426_10057024 | 262 |
| 307 | 3300025304 | Ga0209257_1001449 | Ga0209257_100144915 | 262 |
| 308 | 3300025304 | Ga0209257_1006197 | Ga0209257_10061971 | 262 |
| 309 | 3300025913 | Ga0207695_10082074 | Ga0207695_100820743 | 262 |
| 310 | 3300025919 | Ga0207657_10015111 | Ga0207657_100151118 | 262 |
| 311 | 3300025924 | Ga0207694_10146409 | Ga0207694_101464092 | 262 |
| 312 | 3300025932 | Ga0207690_10097363 | Ga0207690_100973633 | 262 |
| 313 | 3300025949 | Ga0207667_10003395 | Ga0207667_1000339516 | 262 |
| 314 | 3300025981 | Ga0207640_10118464 | Ga0207640_101184644 | 262 |
| 315 | 3300026078 | Ga0207702_10017610 | Ga0207702_100176109 | 262 |
| 316 | 3300031548 | Ga0307408_100000022 | Ga0307408_100000022207 | 262 |
| 317 | 3300031548 | Ga0307408_100001119 | Ga0307408_10000111912 | 262 |
| 318 | 3300031548 | Ga0307408_100037865 | Ga0307408_1000378653 | 262 |
| 319 | 3300037312 | Ga0395899_0051941 | Ga0395899_0051941_2147_2941 | 262 |
| 320 | 3300037418 | Ga0395900_0296121 | Ga0395900_0296121_438_1232 | 262 |
| 321 | 3300037466 | Ga0395898_0487614 | Ga0395898_0487614_233_1027 | 262 |
| 322 | 3300046520 | Ga0495637_0008454 | Ga0495637_0008454_4078_4887 | 262 |
| 323 | 3300049571 | Ga0501034_0012354 | Ga0501034_0012354_5910_6803 | 262 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2jc4-assembly1.cif.gz_A | 3'-5' exonuclease (nexo) from neisseria meningitidis | 0.9712 | 4 | 260 |
| 2jc4-assembly1.cif.gz_A | 3'-5' exonuclease (nexo) from neisseria meningitidis | 0.9675 | 4 | 260 |
| 6fke-assembly1.cif.gz_A | structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin | 0.967 | 3 | 260 |
| 2voa-assembly1.cif.gz_B | structure of an ap endonuclease from archaeoglobus fulgidus | 0.9639 | 4 | 260 |
| 6fke-assembly1.cif.gz_A | structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin | 0.9633 | 3 | 260 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6fk4A00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9733 | 3 | 260 | 3.60.10.10 |
| 6fk4A00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9696 | 3 | 260 | 3.60.10.10 |
| 2voaB00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9637 | 4 | 260 | 3.60.10.10 |
| 2voaB00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9564 | 4 | 260 | 3.60.10.10 |
| af_P09030_1_268_3.60.10.10 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9513 | 4 | 260 | 3.60.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I3SU57-F1-model_v4 | Exodeoxyribonuclease III (EC 3.1.11.2) | 0.999 | 4 | 259 |
GO:0006281
GO:0008311 GO:0046872 |
| AF-A0A2W5ADH5-F1-model_v4 | Exodeoxyribonuclease III | 0.9973 | 4 | 131 |
GO:0003677
GO:0004519 GO:0006281 GO:0008311 GO:0046872 |
| AF-A0A530LIU1-F1-model_v4 | Exodeoxyribonuclease III | 0.9972 | 4 | 100 |
GO:0006281
GO:0008311 |
| AF-A0A4R3FGF6-F1-model_v4 | Exodeoxyribonuclease III | 0.9969 | 6 | 227 |
GO:0003677
GO:0004519 GO:0006281 GO:0008311 GO:0046872 |
| AF-A0A1G4ULC5-F1-model_v4 | Exodeoxyribonuclease III | 0.9966 | 4 | 185 |
GO:0003677
GO:0004519 GO:0006281 GO:0008311 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar