F407100

General Info

Members Datasets Scaffolds Average Seq Length
323 208 318 263

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0012354|Ga0501034_0012354_5910_6803
Length 297
Sequence MGGQEGDDEPLGAPPDGRLGAGAGGMKIATYNVNGINGRLPVLLRWLKQAKPDVVCLQELKAPEEKFPALALRDAGYGAIWHGQKSWNGVAILARGEAAPVETRRGLPGDPADLHSRYLEATVGGVTVGCLYLPNGNPAPGPKFDYKLKWLARLTKHAARLQKSKVPVVLAGDFNVIPTETDVYKPENWKTDALFLPESRAAFHKLVKQGWIDALRELHPDERVYTFWDYFRNAWPRNAGIRIDHFLLNPAVAKRLVAAGVDREVRGWEKTSDHAPVWIELKSSAPKSRKKVRKVTE

Samples

Sample ID Description Type Environment
1 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
2 2643221638 Duganella sp. Root336D2 Isolate Unclassified
3 2643221734 Bosea sp. Root670 Isolate Unclassified
4 2842733646 Variovorax sp. R-72446 Isolate Unclassified
5 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
143 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
144 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
154 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
155 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
161 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
165 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
166 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
176 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
177 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
178 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
181 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
201 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
202 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
203 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
204 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
205 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
206 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
207 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
208 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 0
Isolates 1.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.15
Nodule 0
Rhizoplane 2.79
Rhizosphere 69.35
Stem 0
Stem Tuber 0
Unclassified 3.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1001886 3300002739 Bacteria 3542
2 JGI25158J39367_1005346 3300002739 Bacteria 1886
3 JGI25152J39213_1000002 3300002773 Bacteria 219237
4 JGI25152J39213_1017356 3300002773 Bacteria 1361
5 JGI25150J39212_1000353 3300002774 Bacteria 22643
6 JGI25150J39212_1004683 3300002774 Bacteria 3008
7 JGI25159J45721_1000898 3300002987 Bacteria 12949
8 JGI25159J45721_1004396 3300002987 Bacteria 4688
9 JGI25165J46597_1000013 3300003214 Bacteria 402100
10 JGI25153J46596_10002515 3300003215 Bacteria 10526
11 JGI25161J50226_1000715 3300003374 Bacteria 12929
12 Ga0055526_1001002 3300003771 Bacteria 20751
13 Ga0055526_1001190 3300003771 Bacteria 18847
14 Ga0055526_1003211 3300003771 Bacteria 10555
15 Ga0055526_1006658 3300003771 Bacteria 6202
16 Ga0055537_1000027 3300003773 Bacteria 102244
17 Ga0055524_1000372 3300003775 Bacteria 39278
18 Ga0055524_1018647 3300003775 Bacteria 2401
19 Ga0055524_1021414 3300003775 Bacteria 2144
20 Ga0055534_1000019 3300003784 Bacteria 137920
21 Ga0055534_1008944 3300003784 Bacteria 2219
22 Ga0055528_1000055 3300003790 Bacteria 89917
23 Ga0055528_1004886 3300003790 Bacteria 6344
24 Ga0055530_10009265 3300003791 Bacteria 3811
25 Ga0055530_10038416 3300003791 Bacteria 1190
26 Ga0055531_10001695 3300003794 Bacteria 15819
27 Ga0055543_1000667 3300004625 Bacteria 18080
28 Ga0055543_1002196 3300004625 Bacteria 6683
29 Ga0065165_1001017 3300005262 Bacteria 34070
30 Ga0065165_1001551 3300005262 Bacteria 23972
31 Ga0065165_1003793 3300005262 Bacteria 10109
32 Ga0065714_10064560 3300005288 Bacteria 36054
33 Ga0065704_10072807 3300005289 Bacteria 7978
34 Ga0070658_10028117 3300005327 Bacteria 4513
35 Ga0070658_10034487 3300005327 Bacteria 4071
36 Ga0070658_10136420 3300005327 Bacteria 2047
37 Ga0070658_10142498 3300005327 Bacteria 2002
38 Ga0070658_10343211 3300005327 Bacteria 1277
39 Ga0070683_100055106 3300005329 Bacteria 3689
40 Ga0070683_100426740 3300005329 Bacteria 1265
41 Ga0070677_10000029 3300005333 Bacteria 42300
42 Ga0070666_10121758 3300005335 Bacteria 1809
43 Ga0070680_100168212 3300005336 Bacteria 1844
44 Ga0070680_100569609 3300005336 Bacteria 971
45 Ga0070660_100018796 3300005339 Bacteria 5056
46 Ga0070660_100024157 3300005339 Bacteria 4508
47 Ga0070660_100486651 3300005339 Bacteria 1026
48 Ga0070689_100394366 3300005340 Bacteria 1169
49 Ga0070692_10006775 3300005345 Bacteria 4999
50 Ga0070668_100017364 3300005347 Bacteria 5389
51 Ga0070668_100041710 3300005347 Bacteria 3516
52 Ga0070669_100018292 3300005353 Bacteria 5008
53 Ga0070669_100443411 3300005353 Bacteria 1069
54 Ga0070675_100014706 3300005354 Bacteria 6174
55 Ga0070671_100007611 3300005355 Bacteria 8663
56 Ga0070671_100257999 3300005355 Bacteria 1481
57 Ga0070673_100137798 3300005364 Bacteria 2056
58 Ga0070673_100275413 3300005364 Bacteria 1474
59 Ga0070659_100049997 3300005366 Bacteria 3288
60 Ga0070711_100107707 3300005439 Bacteria 2040
61 Ga0070663_100048820 3300005455 Bacteria 3003
62 Ga0070662_100008501 3300005457 Bacteria 6700
63 Ga0070681_10084471 3300005458 Bacteria 3127
64 Ga0070681_10185189 3300005458 Bacteria 2003
65 Ga0070681_10240816 3300005458 Bacteria 1723
66 Ga0070679_100032548 3300005530 Bacteria 5158
67 Ga0070679_100044439 3300005530 Bacteria 4426
68 Ga0070679_100087348 3300005530 Bacteria 3105
69 Ga0070679_100419460 3300005530 Bacteria 1284
70 Ga0070679_100436615 3300005530 Bacteria 1254
71 Ga0070684_100182519 3300005535 Bacteria 1908
72 Ga0070672_100001685 3300005543 Bacteria 13779
73 Ga0070665_100670375 3300005548 Bacteria 1050
74 Ga0070704_100003187 3300005549 Bacteria 9379
75 Ga0068855_100025618 3300005563 Bacteria 7055
76 Ga0068855_100208652 3300005563 Bacteria 2196
77 Ga0070664_100121412 3300005564 Bacteria 2288
78 Ga0068854_100138697 3300005578 Bacteria 1864
79 Ga0068856_100022099 3300005614 Bacteria 6186
80 Ga0068856_100036265 3300005614 Bacteria 4835
81 Ga0068856_100038866 3300005614 Bacteria 4672
82 Ga0068856_100072854 3300005614 Bacteria 3401
83 Ga0068852_100007647 3300005616 Bacteria 7903
84 Ga0068852_100041154 3300005616 Bacteria 3903
85 Ga0068859_100437064 3300005617 Bacteria 1405
86 Ga0068864_100077720 3300005618 Bacteria 2903
87 Ga0068861_100013732 3300005719 Bacteria 5671
88 Ga0068861_100041229 3300005719 Bacteria 3457
89 Ga0068858_100380551 3300005842 Bacteria 1354
90 Ga0068860_100014946 3300005843 Bacteria 7589
91 Ga0068860_100033228 3300005843 Bacteria 4952
92 Ga0068860_100033926 3300005843 Bacteria 4896
93 Ga0097621_100183289 3300006237 Bacteria 1810
94 Ga0075370_10006286 3300006353 Bacteria 5964
95 Ga0068871_100093571 3300006358 Bacteria 2508
96 Ga0075430_100028664 3300006846 Bacteria 4728
97 Ga0075436_100030601 3300006914 Bacteria 3704
98 Ga0097620_100437035 3300006931 Bacteria 1405
99 Ga0105240_10028621 3300009093 Bacteria 7273
100 Ga0105240_10073044 3300009093 Bacteria 4237
101 Ga0105240_10166690 3300009093 Bacteria 2612
102 Ga0105240_10797557 3300009093 Bacteria 1023
103 Ga0111539_10139001 3300009094 Bacteria 2844
104 Ga0105241_10367697 3300009174 Bacteria 1253
105 Ga0105248_10090483 3300009177 Bacteria 3446
106 Ga0105237_10041514 3300009545 Bacteria 4639
107 Ga0105238_10003838 3300009551 Bacteria 14926
108 Ga0105239_10453120 3300010375 Bacteria 1456
109 Ga0157373_10137675 3300013100 Bacteria 1717
110 Ga0157371_10009845 3300013102 Bacteria 7489
111 Ga0157371_10099538 3300013102 Bacteria 2062
112 Ga0157370_10000155 3300013104 Bacteria 84680
113 Ga0157370_10022575 3300013104 Bacteria 6262
114 Ga0157370_10115573 3300013104 Bacteria 2506
115 Ga0157370_10230337 3300013104 Bacteria 1715
116 Ga0157369_10403752 3300013105 Bacteria 1418
117 Ga0163162_10049569 3300013306 Bacteria 4209
118 Ga0163162_10055459 3300013306 Bacteria 3990
119 Ga0157372_10111706 3300013307 Bacteria 3131
120 Ga0157372_10149691 3300013307 Bacteria 2693
121 Ga0157375_10088176 3300013308 Bacteria 3157
122 Ga0157380_10003879 3300014326 Bacteria 10314
123 Ga0157380_10054767 3300014326 Bacteria 3166
124 Ga0182008_10030039 3300014497 Bacteria 2742
125 Ga0157379_10285105 3300014968 Bacteria 1503
126 Ga0157379_10285898 3300014968 Bacteria 1501
127 Ga0157379_10373069 3300014968 Bacteria 1308
128 Ga0157376_10038224 3300014969 Bacteria 3904
129 Ga0157376_10075901 3300014969 Bacteria 2870
130 Ga0163161_10002604 3300017792 Bacteria 12862
131 Ga0163161_10036280 3300017792 Bacteria 3530
132 Ga0213876_10092122 3300021384 Bacteria 1605
133 Ga0209436_102410 3300025208 Bacteria 5658
134 Ga0209436_110203 3300025208 Bacteria 1733
135 Ga0207427_104155 3300025231 Bacteria 2576
136 Ga0207425_1000001 3300025245 Bacteria 2525432
137 Ga0207425_1000115 3300025245 Bacteria 76109
138 Ga0207425_1000790 3300025245 Bacteria 16150
139 Ga0209129_1000001 3300025258 Bacteria 1452436
140 Ga0209233_1000013 3300025261 Bacteria 1013785
141 Ga0209565_1000017 3300025263 Bacteria 462438
142 Ga0209565_1000233 3300025263 Bacteria 60923
143 Ga0209565_1000323 3300025263 Bacteria 43012
144 Ga0209565_1001356 3300025263 Bacteria 11045
145 Ga0209565_1002739 3300025263 Bacteria 6119
146 Ga0209565_1023501 3300025263 Bacteria 1265
147 Ga0209673_1000007 3300025273 Bacteria 634477
148 Ga0209130_1000055 3300025284 Bacteria 211696
149 Ga0209130_1000630 3300025284 Bacteria 33099
150 Ga0209675_1000009 3300025291 Bacteria 562872
151 Ga0209675_1007118 3300025291 Bacteria 4350
152 Ga0209564_1000036 3300025295 Bacteria 423455
153 Ga0209564_1000055 3300025295 Bacteria 343782
154 Ga0209564_1001991 3300025295 Bacteria 17896
155 Ga0209564_1002221 3300025295 Bacteria 16087
156 Ga0209564_1008887 3300025295 Bacteria 4881
157 Ga0209758_1000020 3300025297 Bacteria 734220
158 Ga0209758_1036630 3300025297 Bacteria 1911
159 Ga0209050_1001631 3300025298 Bacteria 22996
160 Ga0209050_1002661 3300025298 Bacteria 14602
161 Ga0209050_1011508 3300025298 Bacteria 4183
162 Ga0209256_1000028 3300025299 Bacteria 420213
163 Ga0209256_1000091 3300025299 Bacteria 210945
164 Ga0209256_1007370 3300025299 Bacteria 5454
165 Ga0207426_1005702 3300025302 Bacteria 5617
166 Ga0207426_1011387 3300025302 Bacteria 3392
167 Ga0209257_1001449 3300025304 Bacteria 28048
168 Ga0209257_1006197 3300025304 Bacteria 7852
169 Ga0207653_10052454 3300025885 Bacteria 1360
170 Ga0207688_10202419 3300025901 Bacteria 1191
171 Ga0207680_10058150 3300025903 Bacteria 2342
172 Ga0207699_10077027 3300025906 Bacteria 2056
173 Ga0207705_10000946 3300025909 Bacteria 23719
174 Ga0207705_10003701 3300025909 Bacteria 11638
175 Ga0207705_10043783 3300025909 Bacteria 3216
176 Ga0207707_10067106 3300025912 Bacteria 3125
177 Ga0207707_10134067 3300025912 Bacteria 2166
178 Ga0207695_10020161 3300025913 Bacteria 7646
179 Ga0207695_10022362 3300025913 Bacteria 7180
180 Ga0207695_10082074 3300025913 Bacteria 3261
181 Ga0207671_10063974 3300025914 Bacteria 2734
182 Ga0207660_10277699 3300025917 Bacteria 1329
183 Ga0207657_10015111 3300025919 Bacteria 7498
184 Ga0207657_10016835 3300025919 Bacteria 7038
185 Ga0207657_10310232 3300025919 Bacteria 1249
186 Ga0207649_10062391 3300025920 Bacteria 2350
187 Ga0207652_10030464 3300025921 Bacteria 4519
188 Ga0207652_10031422 3300025921 Bacteria 4460
189 Ga0207681_10000372 3300025923 Bacteria 31712
190 Ga0207694_10146409 3300025924 Bacteria 1901
191 Ga0207650_10197351 3300025925 Bacteria 1610
192 Ga0207659_10015033 3300025926 Bacteria 5005
193 Ga0207700_10079589 3300025928 Bacteria 2553
194 Ga0207644_10004914 3300025931 Bacteria 8713
195 Ga0207690_10097363 3300025932 Bacteria 2093
196 Ga0207706_10003602 3300025933 Bacteria 14787
197 Ga0207669_10110204 3300025937 Bacteria 1843
198 Ga0207665_10006054 3300025939 Bacteria 8035
199 Ga0207691_10002365 3300025940 Bacteria 18475
200 Ga0207691_10041838 3300025940 Bacteria 4227
201 Ga0207711_10054582 3300025941 Bacteria 3429
202 Ga0207711_10130398 3300025941 Bacteria 2254
203 Ga0207661_10271082 3300025944 Bacteria 1515
204 Ga0207667_10003395 3300025949 Bacteria 19649
205 Ga0207667_10242272 3300025949 Bacteria 1845
206 Ga0207651_10520834 3300025960 Bacteria 1030
207 Ga0207668_10010359 3300025972 Bacteria 5633
208 Ga0207668_10091464 3300025972 Bacteria 2236
209 Ga0207640_10118464 3300025981 Bacteria 1892
210 Ga0207658_10226393 3300025986 Bacteria 1576
211 Ga0207703_10484375 3300026035 Bacteria 1159
212 Ga0207678_10036559 3300026067 Bacteria 4275
213 Ga0207678_10071256 3300026067 Bacteria 2980
214 Ga0207708_10141086 3300026075 Bacteria 1890
215 Ga0207702_10017610 3300026078 Bacteria 5911
216 Ga0207702_10039224 3300026078 Bacteria 3967
217 Ga0207648_10022251 3300026089 Bacteria 5696
218 Ga0207648_10080140 3300026089 Bacteria 2849
219 Ga0207676_10044026 3300026095 Bacteria 3441
220 Ga0207674_10485305 3300026116 Bacteria 1194
221 Ga0207675_100062180 3300026118 Bacteria 3486
222 Ga0207683_10178298 3300026121 Bacteria 1926
223 Ga0268266_10764296 3300028379 Bacteria 933
224 Ga0268265_10412175 3300028380 Bacteria 1252
225 Ga0268264_10028419 3300028381 Bacteria 4575
226 Ga0268264_10047779 3300028381 Unclassified 3559
227 Ga0268264_10091177 3300028381 Bacteria 2629
228 Ga0307408_100000022 3300031548 Bacteria 310242
229 Ga0307408_100001119 3300031548 Bacteria 20426
230 Ga0307408_100037865 3300031548 Bacteria 3399
231 Ga0307414_10033746 3300032004 Bacteria 3386
232 Ga0307414_10420998 3300032004 Bacteria 1165
233 Ga0373941_0024896 3300035115 Bacteria 1723
234 Ga0373953_0040319 3300035117 Bacteria 1854
235 Ga0373954_0032381 3300035118 Bacteria 2416
236 Ga0373935_0240863 3300035692 Bacteria 1263
237 Ga0373935_0274136 3300035692 Bacteria 1186
238 Ga0373937_0470182 3300036401 Bacteria 1194
239 Ga0395899_0038274 3300037312 Bacteria 3593
240 Ga0395899_0051941 3300037312 Bacteria 3040
241 Ga0395899_0122360 3300037312 Bacteria 1862
242 Ga0395900_0006824 3300037418 Bacteria 11846
243 Ga0395900_0065734 3300037418 Bacteria 3725
244 Ga0395900_0119293 3300037418 Bacteria 2707
245 Ga0395900_0296121 3300037418 Bacteria 1605
246 Ga0395898_0042711 3300037466 Bacteria 4471
247 Ga0395898_0064022 3300037466 Bacteria 3567
248 Ga0395898_0487614 3300037466 Bacteria 1172
249 Ga0395905_0020616 3300037471 Bacteria 6241
250 Ga0395905_0054386 3300037471 Bacteria 3747
251 Ga0395905_0073266 3300037471 Bacteria 3210
252 Ga0395901_0115480 3300038443 Bacteria 2819
253 Ga0395901_0139959 3300038443 Bacteria 2543
254 Ga0436365_0550838 3300039437 Bacteria 7531
255 Ga0466969_0011294 3300044656 Bacteria 4729
256 Ga0495617_000384 3300046452 Bacteria 24540
257 Ga0495590_0066774 3300046457 Bacteria 1260
258 Ga0495638_0021647 3300046460 Bacteria 4232
259 Ga0495580_0069168 3300046472 Bacteria 2467
260 Ga0495582_0015102 3300046473 Bacteria 4247
261 Ga0495585_0000406 3300046492 Bacteria 41715
262 Ga0495607_0027335 3300046501 Bacteria 3529
263 Ga0495583_0000049 3300046506 Bacteria 216069
264 Ga0495606_0112637 3300046507 Bacteria 1639
265 Ga0495608_0170847 3300046511 Bacteria 1379
266 Ga0495616_0004686 3300046513 Bacteria 8576
267 Ga0495637_0008454 3300046520 Bacteria 5056
268 Ga0495648_0000057 3300046524 Bacteria 157446
269 Ga0495587_0028617 3300046536 Bacteria 3388
270 Ga0495609_0002345 3300046538 Bacteria 11687
271 Ga0495656_0069892 3300046615 Bacteria 1557
272 Ga0495668_0000018 3300046616 Bacteria 417480
273 Ga0495668_0021825 3300046616 Bacteria 3665
274 Ga0495625_0004566 3300046660 Bacteria 13025
275 Ga0495661_0023873 3300046665 Bacteria 3964
276 Ga0495658_0001375 3300046683 Bacteria 12752
277 Ga0495669_0035732 3300046684 Bacteria 2194
278 Ga0495671_0132199 3300046692 Bacteria 1217
279 Ga0495649_0032251 3300046694 Bacteria 2887
280 Ga0495649_0231524 3300046694 Bacteria 953
281 Ga0495660_0006997 3300046810 Bacteria 6649
282 Ga0495683_0057336 3300047323 Bacteria 1936
283 Ga0495675_0098103 3300047444 Bacteria 1836
284 Ga0495677_0002839 3300047445 Bacteria 6749
285 Ga0495681_0011728 3300047470 Bacteria 5196
286 Ga0495686_0000773 3300047472 Bacteria 42004
287 Ga0495686_0008303 3300047472 Bacteria 7637
288 Ga0496102_0076347 3300048905 Bacteria 3082
289 Ga0496105_0073953 3300048908 Bacteria 2815
290 Ga0496105_0121794 3300048908 Bacteria 2151
291 Ga0496108_0313779 3300048911 Bacteria 1366
292 Ga0496110_0266886 3300048913 Bacteria 1558
293 Ga0496112_0111863 3300048915 Bacteria 2700
294 Ga0496112_0458957 3300048915 Bacteria 1211
295 Ga0496113_0012651 3300048916 Bacteria 5679
296 Ga0496115_0120136 3300048918 Bacteria 2162
297 Ga0496119_0000450 3300048922 Bacteria 56283
298 Ga0496122_0000018 3300048925 Bacteria 426350
299 Ga0496123_0000015 3300048926 Bacteria 426088
300 Ga0496124_0174426 3300048927 Bacteria 1661
301 Ga0496126_0001897 3300048929 Bacteria 30122
302 Ga0495678_051019 3300049459 Bacteria 1601
303 Ga0501034_0012354 3300049571 Bacteria 8822
304 Ga0501034_0162725 3300049571 Bacteria 2202
305 Ga0501034_0444356 3300049571 Bacteria 1215
306 nmdc:mga05p37_1576_c1 3300050507 Bacteria 19968
307 nmdc:mga0qj67_67891_c1 3300050509 Bacteria 2841
308 nmdc:mga0n895_86710_c1 3300050512 Bacteria 3127
309 Ga0500650_0032471 3300053098 Bacteria 2378
310 Ga0500554_001903 3300053102 Bacteria 4036
311 Ga0500592_000041 3300053116 Bacteria 40085
312 Ga0500595_032705 3300053119 Bacteria 1733
313 Ga0500642_0006312 3300053130 Bacteria 3892
314 Ga0500568_0004294 3300053139 Bacteria 7644
315 Ga0500622_0000007 3300053156 Bacteria 425621
316 Ga0500622_0000013 3300053156 Bacteria 371650
317 Ga0500627_0000157 3300053158 Bacteria 20081
318 Ga0500609_010914 3300053731 Bacteria 1226

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035115 Ga0373941_0024896 Ga0373941_0024896_977_1708 243
2 iso_pu_bacteria 2842733646 2842739115 253
3 iso_pu_bacteria 2643221734 2644734519 255
4 3300002987 JGI25159J45721_1004396 JGI25159J45721_10043965 256
5 3300003771 Ga0055526_1006658 Ga0055526_10066582 256
6 3300003773 Ga0055537_1000027 Ga0055537_100002761 256
7 3300003775 Ga0055524_1021414 Ga0055524_10214143 256
8 3300003784 Ga0055534_1000019 Ga0055534_10000195 256
9 3300003790 Ga0055528_1000055 Ga0055528_100005532 256
10 3300004625 Ga0055543_1002196 Ga0055543_10021963 256
11 3300005262 Ga0065165_1001017 Ga0065165_10010179 256
12 3300005327 Ga0070658_10034487 Ga0070658_100344875 256
13 3300005339 Ga0070660_100024157 Ga0070660_1000241572 256
14 3300005530 Ga0070679_100044439 Ga0070679_1000444392 256
15 3300005530 Ga0070679_100419460 Ga0070679_1004194601 256
16 3300025208 Ga0209436_110203 Ga0209436_1102032 256
17 3300025263 Ga0209565_1000017 Ga0209565_1000017282 256
18 3300025273 Ga0209673_1000007 Ga0209673_1000007147 256
19 3300025284 Ga0209130_1000630 Ga0209130_100063032 256
20 3300025291 Ga0209675_1000009 Ga0209675_1000009371 256
21 3300025295 Ga0209564_1000036 Ga0209564_1000036147 256
22 3300025295 Ga0209564_1000055 Ga0209564_1000055306 256
23 3300025299 Ga0209256_1000091 Ga0209256_1000091147 256
24 3300025302 Ga0207426_1011387 Ga0207426_10113874 256
25 3300025909 Ga0207705_10000946 Ga0207705_1000094610 256
26 3300025909 Ga0207705_10003701 Ga0207705_100037019 256
27 3300025919 Ga0207657_10016835 Ga0207657_100168355 256
28 3300025919 Ga0207657_10310232 Ga0207657_103102321 256
29 3300025921 Ga0207652_10030464 Ga0207652_100304645 256
30 3300025940 Ga0207691_10041838 Ga0207691_100418382 256
31 3300026121 Ga0207683_10178298 Ga0207683_101782982 256
32 3300032004 Ga0307414_10033746 Ga0307414_100337462 256
33 3300044656 Ga0466969_0011294 Ga0466969_0011294_1189_1968 256
34 3300046457 Ga0495590_0066774 Ga0495590_0066774_208_978 256
35 3300046460 Ga0495638_0021647 Ga0495638_0021647_873_1643 256
36 3300046501 Ga0495607_0027335 Ga0495607_0027335_949_1719 256
37 3300046507 Ga0495606_0112637 Ga0495606_0112637_579_1349 256
38 3300046513 Ga0495616_0004686 Ga0495616_0004686_1511_2281 256
39 3300046538 Ga0495609_0002345 Ga0495609_0002345_3597_4367 256
40 3300046616 Ga0495668_0000018 Ga0495668_0000018_241751_242521 256
41 3300046616 Ga0495668_0021825 Ga0495668_0021825_2739_3509 256
42 3300046660 Ga0495625_0004566 Ga0495625_0004566_4935_5705 256
43 3300046665 Ga0495661_0023873 Ga0495661_0023873_359_1129 256
44 3300046684 Ga0495669_0035732 Ga0495669_0035732_337_1107 256
45 3300046692 Ga0495671_0132199 Ga0495671_0132199_347_1117 256
46 3300046694 Ga0495649_0231524 Ga0495649_0231524_28_798 256
47 3300046810 Ga0495660_0006997 Ga0495660_0006997_1412_2182 256
48 3300047445 Ga0495677_0002839 Ga0495677_0002839_2731_3501 256
49 3300047470 Ga0495681_0011728 Ga0495681_0011728_3597_4367 256
50 3300047472 Ga0495686_0000773 Ga0495686_0000773_16917_17687 256
51 3300049459 Ga0495678_051019 Ga0495678_051019_512_1282 256
52 3300053156 Ga0500622_0000007 Ga0500622_0000007_31621_32391 256
53 3300003771 Ga0055526_1003211 Ga0055526_10032118 257
54 3300005288 Ga0065714_10064560 Ga0065714_1006456012 257
55 3300005289 Ga0065704_10072807 Ga0065704_100728079 257
56 3300005364 Ga0070673_100275413 Ga0070673_1002754133 257
57 3300005366 Ga0070659_100049997 Ga0070659_1000499974 257
58 3300005530 Ga0070679_100032548 Ga0070679_1000325484 257
59 3300005549 Ga0070704_100003187 Ga0070704_1000031879 257
60 3300006914 Ga0075436_100030601 Ga0075436_1000306014 257
61 3300009093 Ga0105240_10166690 Ga0105240_101666903 257
62 3300009094 Ga0111539_10139001 Ga0111539_101390012 257
63 3300009545 Ga0105237_10041514 Ga0105237_100415142 257
64 3300013102 Ga0157371_10099538 Ga0157371_100995382 257
65 3300013104 Ga0157370_10230337 Ga0157370_102303372 257
66 3300013307 Ga0157372_10149691 Ga0157372_101496913 257
67 3300014326 Ga0157380_10003879 Ga0157380_100038797 257
68 3300014968 Ga0157379_10285105 Ga0157379_102851051 257
69 3300017792 Ga0163161_10002604 Ga0163161_100026048 257
70 3300025295 Ga0209564_1001991 Ga0209564_100199110 257
71 3300025297 Ga0209758_1036630 Ga0209758_10366302 257
72 3300025298 Ga0209050_1011508 Ga0209050_10115083 257
73 3300025885 Ga0207653_10052454 Ga0207653_100524542 257
74 3300025906 Ga0207699_10077027 Ga0207699_100770272 257
75 3300025928 Ga0207700_10079589 Ga0207700_100795892 257
76 3300025939 Ga0207665_10006054 Ga0207665_100060544 257
77 3300025944 Ga0207661_10271082 Ga0207661_102710822 257
78 3300025960 Ga0207651_10520834 Ga0207651_105208341 257
79 3300026067 Ga0207678_10071256 Ga0207678_100712562 257
80 3300026089 Ga0207648_10022251 Ga0207648_100222516 257
81 3300046452 Ga0495617_000384 Ga0495617_000384_13486_14259 257
82 3300046473 Ga0495582_0015102 Ga0495582_0015102_70_843 257
83 3300046492 Ga0495585_0000406 Ga0495585_0000406_29328_30101 257
84 3300046506 Ga0495583_0000049 Ga0495583_0000049_94360_95133 257
85 3300046524 Ga0495648_0000057 Ga0495648_0000057_145853_146626 257
86 3300046615 Ga0495656_0069892 Ga0495656_0069892_481_1254 257
87 3300047323 Ga0495683_0057336 Ga0495683_0057336_1066_1839 257
88 3300053156 Ga0500622_0000013 Ga0500622_0000013_336374_337147 257
89 3300005262 Ga0065165_1001551 Ga0065165_10015517 258
90 3300005327 Ga0070658_10343211 Ga0070658_103432112 258
91 3300005329 Ga0070683_100426740 Ga0070683_1004267401 258
92 3300005335 Ga0070666_10121758 Ga0070666_101217584 258
93 3300005336 Ga0070680_100168212 Ga0070680_1001682121 258
94 3300005336 Ga0070680_100569609 Ga0070680_1005696091 258
95 3300005340 Ga0070689_100394366 Ga0070689_1003943661 258
96 3300005347 Ga0070668_100017364 Ga0070668_1000173649 258
97 3300005347 Ga0070668_100041710 Ga0070668_1000417103 258
98 3300005353 Ga0070669_100018292 Ga0070669_1000182924 258
99 3300005353 Ga0070669_100443411 Ga0070669_1004434112 258
100 3300005354 Ga0070675_100014706 Ga0070675_1000147067 258
101 3300005355 Ga0070671_100007611 Ga0070671_1000076112 258
102 3300005355 Ga0070671_100257999 Ga0070671_1002579992 258
103 3300005364 Ga0070673_100137798 Ga0070673_1001377982 258
104 3300005439 Ga0070711_100107707 Ga0070711_1001077071 258
105 3300005457 Ga0070662_100008501 Ga0070662_1000085012 258
106 3300005458 Ga0070681_10084471 Ga0070681_100844713 258
107 3300005530 Ga0070679_100087348 Ga0070679_1000873482 258
108 3300005530 Ga0070679_100436615 Ga0070679_1004366151 258
109 3300005535 Ga0070684_100182519 Ga0070684_1001825192 258
110 3300005543 Ga0070672_100001685 Ga0070672_1000016853 258
111 3300005617 Ga0068859_100437064 Ga0068859_1004370642 258
112 3300005618 Ga0068864_100077720 Ga0068864_1000777203 258
113 3300005719 Ga0068861_100041229 Ga0068861_1000412293 258
114 3300005842 Ga0068858_100380551 Ga0068858_1003805512 258
115 3300005843 Ga0068860_100014946 Ga0068860_1000149469 258
116 3300005843 Ga0068860_100033926 Ga0068860_1000339264 258
117 3300006237 Ga0097621_100183289 Ga0097621_1001832891 258
118 3300006358 Ga0068871_100093571 Ga0068871_1000935713 258
119 3300006931 Ga0097620_100437035 Ga0097620_1004370352 258
120 3300009174 Ga0105241_10367697 Ga0105241_103676972 258
121 3300009177 Ga0105248_10090483 Ga0105248_100904833 258
122 3300013104 Ga0157370_10115573 Ga0157370_101155732 258
123 3300013306 Ga0163162_10049569 Ga0163162_100495693 258
124 3300013308 Ga0157375_10088176 Ga0157375_100881763 258
125 3300014326 Ga0157380_10054767 Ga0157380_100547675 258
126 3300014968 Ga0157379_10373069 Ga0157379_103730692 258
127 3300014969 Ga0157376_10075901 Ga0157376_100759012 258
128 3300017792 Ga0163161_10036280 Ga0163161_100362803 258
129 3300021384 Ga0213876_10092122 Ga0213876_100921222 258
130 3300025901 Ga0207688_10202419 Ga0207688_102024191 258
131 3300025903 Ga0207680_10058150 Ga0207680_100581502 258
132 3300025912 Ga0207707_10067106 Ga0207707_100671063 258
133 3300025913 Ga0207695_10020161 Ga0207695_100201614 258
134 3300025913 Ga0207695_10022362 Ga0207695_100223625 258
135 3300025923 Ga0207681_10000372 Ga0207681_1000037212 258
136 3300025925 Ga0207650_10197351 Ga0207650_101973512 258
137 3300025926 Ga0207659_10015033 Ga0207659_100150332 258
138 3300025931 Ga0207644_10004914 Ga0207644_100049143 258
139 3300025933 Ga0207706_10003602 Ga0207706_1000360213 258
140 3300025937 Ga0207669_10110204 Ga0207669_101102041 258
141 3300025940 Ga0207691_10002365 Ga0207691_1000236514 258
142 3300025941 Ga0207711_10054582 Ga0207711_100545821 258
143 3300025941 Ga0207711_10130398 Ga0207711_101303982 258
144 3300025972 Ga0207668_10010359 Ga0207668_100103597 258
145 3300025972 Ga0207668_10091464 Ga0207668_100914643 258
146 3300025986 Ga0207658_10226393 Ga0207658_102263932 258
147 3300026035 Ga0207703_10484375 Ga0207703_104843752 258
148 3300026075 Ga0207708_10141086 Ga0207708_101410861 258
149 3300026089 Ga0207648_10080140 Ga0207648_100801402 258
150 3300026095 Ga0207676_10044026 Ga0207676_100440264 258
151 3300026116 Ga0207674_10485305 Ga0207674_104853051 258
152 3300026118 Ga0207675_100062180 Ga0207675_1000621803 258
153 3300028379 Ga0268266_10764296 Ga0268266_107642962 258
154 3300028380 Ga0268265_10412175 Ga0268265_104121752 258
155 3300028381 Ga0268264_10028419 Ga0268264_100284191 258
156 3300028381 Ga0268264_10091177 Ga0268264_100911772 258
157 3300035692 Ga0373935_0274136 Ga0373935_0274136_150_968 258
158 3300036401 Ga0373937_0470182 Ga0373937_0470182_16_813 258
159 3300037466 Ga0395898_0064022 Ga0395898_0064022_2542_3372 258
160 3300038443 Ga0395901_0115480 Ga0395901_0115480_1373_2203 258
161 3300039437 Ga0436365_0550838 Ga0436365_0550838_182_1009 258
162 3300046472 Ga0495580_0069168 Ga0495580_0069168_796_1590 258
163 3300046683 Ga0495658_0001375 Ga0495658_0001375_11854_12648 258
164 3300048905 Ga0496102_0076347 Ga0496102_0076347_1707_2483 258
165 3300048908 Ga0496105_0073953 Ga0496105_0073953_1545_2321 258
166 3300048911 Ga0496108_0313779 Ga0496108_0313779_318_1094 258
167 3300048913 Ga0496110_0266886 Ga0496110_0266886_269_1045 258
168 3300048915 Ga0496112_0111863 Ga0496112_0111863_569_1345 258
169 3300048915 Ga0496112_0458957 Ga0496112_0458957_398_1174 258
170 3300048916 Ga0496113_0012651 Ga0496113_0012651_1752_2528 258
171 3300048918 Ga0496115_0120136 Ga0496115_0120136_509_1285 258
172 3300048925 Ga0496122_0000018 Ga0496122_0000018_67771_68550 258
173 3300048926 Ga0496123_0000015 Ga0496123_0000015_67771_68550 258
174 3300048927 Ga0496124_0174426 Ga0496124_0174426_383_1162 258
175 3300048929 Ga0496126_0001897 Ga0496126_0001897_15464_16240 258
176 3300053731 Ga0500609_010914 Ga0500609_010914_320_1120 258
177 iso_pu_bacteria 2643221554 2643790863 258
178 iso_pu_bacteria 2643221638 2644211782 258
179 3300003214 JGI25165J46597_1000013 JGI25165J46597_1000013163 259
180 3300005719 Ga0068861_100013732 Ga0068861_1000137325 259
181 3300009093 Ga0105240_10028621 Ga0105240_100286216 259
182 3300025231 Ga0207427_104155 Ga0207427_1041554 259
183 3300025261 Ga0209233_1000013 Ga0209233_1000013416 259
184 3300032004 Ga0307414_10420998 Ga0307414_104209981 259
185 3300037418 Ga0395900_0006824 Ga0395900_0006824_4942_5775 259
186 3300037471 Ga0395905_0054386 Ga0395905_0054386_550_1332 259
187 3300046694 Ga0495649_0032251 Ga0495649_0032251_522_1352 259
188 3300049571 Ga0501034_0162725 Ga0501034_0162725_864_1649 259
189 3300049571 Ga0501034_0444356 Ga0501034_0444356_212_1030 259
190 3300053098 Ga0500650_0032471 Ga0500650_0032471_1457_2257 259
191 3300053102 Ga0500554_001903 Ga0500554_001903_3230_4009 259
192 3300053116 Ga0500592_000041 Ga0500592_000041_19448_20278 259
193 3300053130 Ga0500642_0006312 Ga0500642_0006312_334_1134 259
194 3300053139 Ga0500568_0004294 Ga0500568_0004294_1201_2043 259
195 3300053158 Ga0500627_0000157 Ga0500627_0000157_17511_18341 259
196 3300005329 Ga0070683_100055106 Ga0070683_1000551063 260
197 3300005339 Ga0070660_100486651 Ga0070660_1004866511 260
198 3300005345 Ga0070692_10006775 Ga0070692_100067756 260
199 3300005458 Ga0070681_10240816 Ga0070681_102408163 260
200 3300005548 Ga0070665_100670375 Ga0070665_1006703751 260
201 3300005614 Ga0068856_100038866 Ga0068856_1000388663 260
202 3300005843 Ga0068860_100033228 Ga0068860_1000332285 260
203 3300006846 Ga0075430_100028664 Ga0075430_1000286646 260
204 3300013104 Ga0157370_10000155 Ga0157370_1000015543 260
205 3300025912 Ga0207707_10134067 Ga0207707_101340674 260
206 3300025914 Ga0207671_10063974 Ga0207671_100639741 260
207 3300025917 Ga0207660_10277699 Ga0207660_102776991 260
208 3300025921 Ga0207652_10031422 Ga0207652_100314224 260
209 3300026067 Ga0207678_10036559 Ga0207678_100365593 260
210 3300028381 Ga0268264_10047779 Ga0268264_100477792 260
211 3300035692 Ga0373935_0240863 Ga0373935_0240863_258_1073 260
212 3300037312 Ga0395899_0122360 Ga0395899_0122360_303_1094 260
213 3300037418 Ga0395900_0065734 Ga0395900_0065734_255_1046 260
214 3300037418 Ga0395900_0119293 Ga0395900_0119293_279_1070 260
215 3300037466 Ga0395898_0042711 Ga0395898_0042711_204_995 260
216 3300037471 Ga0395905_0020616 Ga0395905_0020616_1631_2422 260
217 3300037471 Ga0395905_0073266 Ga0395905_0073266_1993_2784 260
218 3300038443 Ga0395901_0139959 Ga0395901_0139959_813_1604 260
219 3300047472 Ga0495686_0008303 Ga0495686_0008303_3007_3834 260
220 3300048922 Ga0496119_0000450 Ga0496119_0000450_29325_30116 260
221 3300050509 nmdc:mga0qj67_67891_c1 nmdc:mga0qj67_67891_c1_62_859 260
222 3300053119 Ga0500595_032705 Ga0500595_032705_861_1679 260
223 iso_pu_bacteria 2842805378 2842806400 260
224 3300005327 Ga0070658_10136420 Ga0070658_101364202 261
225 3300005327 Ga0070658_10142498 Ga0070658_101424983 261
226 3300005333 Ga0070677_10000029 Ga0070677_1000002919 261
227 3300005458 Ga0070681_10185189 Ga0070681_101851892 261
228 3300005563 Ga0068855_100025618 Ga0068855_1000256187 261
229 3300005564 Ga0070664_100121412 Ga0070664_1001214124 261
230 3300005614 Ga0068856_100036265 Ga0068856_1000362653 261
231 3300005616 Ga0068852_100041154 Ga0068852_1000411546 261
232 3300006353 Ga0075370_10006286 Ga0075370_100062863 261
233 3300013105 Ga0157369_10403752 Ga0157369_104037522 261
234 3300013306 Ga0163162_10055459 Ga0163162_100554593 261
235 3300013307 Ga0157372_10111706 Ga0157372_101117066 261
236 3300014497 Ga0182008_10030039 Ga0182008_100300394 261
237 3300014968 Ga0157379_10285898 Ga0157379_102858982 261
238 3300014969 Ga0157376_10038224 Ga0157376_100382242 261
239 3300025909 Ga0207705_10043783 Ga0207705_100437832 261
240 3300025920 Ga0207649_10062391 Ga0207649_100623914 261
241 3300025949 Ga0207667_10242272 Ga0207667_102422722 261
242 3300026078 Ga0207702_10039224 Ga0207702_100392244 261
243 3300035117 Ga0373953_0040319 Ga0373953_0040319_313_1140 261
244 3300035118 Ga0373954_0032381 Ga0373954_0032381_1363_2190 261
245 3300037312 Ga0395899_0038274 Ga0395899_0038274_203_1129 261
246 3300046511 Ga0495608_0170847 Ga0495608_0170847_66_893 261
247 3300046536 Ga0495587_0028617 Ga0495587_0028617_840_1667 261
248 3300047444 Ga0495675_0098103 Ga0495675_0098103_671_1498 261
249 3300048908 Ga0496105_0121794 Ga0496105_0121794_853_1680 261
250 3300050507 nmdc:mga05p37_1576_c1 nmdc:mga05p37_1576_c1_7557_8462 261
251 3300050512 nmdc:mga0n895_86710_c1 nmdc:mga0n895_86710_c1_1376_2203 261
252 3300002739 JGI25158J39367_1001886 JGI25158J39367_10018865 262
253 3300002739 JGI25158J39367_1005346 JGI25158J39367_10053461 262
254 3300002773 JGI25152J39213_1000002 JGI25152J39213_1000002170 262
255 3300002773 JGI25152J39213_1017356 JGI25152J39213_10173562 262
256 3300002774 JGI25150J39212_1000353 JGI25150J39212_100035322 262
257 3300002774 JGI25150J39212_1004683 JGI25150J39212_10046834 262
258 3300002987 JGI25159J45721_1000898 JGI25159J45721_100089812 262
259 3300003215 JGI25153J46596_10002515 JGI25153J46596_100025156 262
260 3300003374 JGI25161J50226_1000715 JGI25161J50226_10007156 262
261 3300003771 Ga0055526_1001002 Ga0055526_100100210 262
262 3300003771 Ga0055526_1001190 Ga0055526_100119015 262
263 3300003775 Ga0055524_1000372 Ga0055524_100037222 262
264 3300003775 Ga0055524_1018647 Ga0055524_10186472 262
265 3300003784 Ga0055534_1008944 Ga0055534_10089443 262
266 3300003790 Ga0055528_1004886 Ga0055528_10048867 262
267 3300003791 Ga0055530_10009265 Ga0055530_100092656 262
268 3300003791 Ga0055530_10038416 Ga0055530_100384161 262
269 3300003794 Ga0055531_10001695 Ga0055531_1000169520 262
270 3300004625 Ga0055543_1000667 Ga0055543_10006676 262
271 3300005262 Ga0065165_1003793 Ga0065165_10037939 262
272 3300005327 Ga0070658_10028117 Ga0070658_100281173 262
273 3300005339 Ga0070660_100018796 Ga0070660_1000187963 262
274 3300005455 Ga0070663_100048820 Ga0070663_1000488202 262
275 3300005563 Ga0068855_100208652 Ga0068855_1002086522 262
276 3300005578 Ga0068854_100138697 Ga0068854_1001386972 262
277 3300005614 Ga0068856_100022099 Ga0068856_10002209910 262
278 3300005614 Ga0068856_100072854 Ga0068856_1000728542 262
279 3300005616 Ga0068852_100007647 Ga0068852_1000076476 262
280 3300009093 Ga0105240_10073044 Ga0105240_100730442 262
281 3300009093 Ga0105240_10797557 Ga0105240_107975572 262
282 3300009551 Ga0105238_10003838 Ga0105238_1000383818 262
283 3300010375 Ga0105239_10453120 Ga0105239_104531202 262
284 3300013100 Ga0157373_10137675 Ga0157373_101376753 262
285 3300013102 Ga0157371_10009845 Ga0157371_1000984510 262
286 3300013104 Ga0157370_10022575 Ga0157370_100225753 262
287 3300025208 Ga0209436_102410 Ga0209436_1024102 262
288 3300025245 Ga0207425_1000001 Ga0207425_10000011111 262
289 3300025245 Ga0207425_1000115 Ga0207425_100011569 262
290 3300025245 Ga0207425_1000790 Ga0207425_100079014 262
291 3300025258 Ga0209129_1000001 Ga0209129_1000001288 262
292 3300025263 Ga0209565_1000233 Ga0209565_100023323 262
293 3300025263 Ga0209565_1000323 Ga0209565_100032320 262
294 3300025263 Ga0209565_1001356 Ga0209565_10013568 262
295 3300025263 Ga0209565_1002739 Ga0209565_10027393 262
296 3300025263 Ga0209565_1023501 Ga0209565_10235011 262
297 3300025284 Ga0209130_1000055 Ga0209130_10000556 262
298 3300025291 Ga0209675_1007118 Ga0209675_10071182 262
299 3300025295 Ga0209564_1002221 Ga0209564_10022213 262
300 3300025295 Ga0209564_1008887 Ga0209564_10088877 262
301 3300025297 Ga0209758_1000020 Ga0209758_1000020165 262
302 3300025298 Ga0209050_1001631 Ga0209050_10016318 262
303 3300025298 Ga0209050_1002661 Ga0209050_100266110 262
304 3300025299 Ga0209256_1000028 Ga0209256_1000028138 262
305 3300025299 Ga0209256_1007370 Ga0209256_10073704 262
306 3300025302 Ga0207426_1005702 Ga0207426_10057024 262
307 3300025304 Ga0209257_1001449 Ga0209257_100144915 262
308 3300025304 Ga0209257_1006197 Ga0209257_10061971 262
309 3300025913 Ga0207695_10082074 Ga0207695_100820743 262
310 3300025919 Ga0207657_10015111 Ga0207657_100151118 262
311 3300025924 Ga0207694_10146409 Ga0207694_101464092 262
312 3300025932 Ga0207690_10097363 Ga0207690_100973633 262
313 3300025949 Ga0207667_10003395 Ga0207667_1000339516 262
314 3300025981 Ga0207640_10118464 Ga0207640_101184644 262
315 3300026078 Ga0207702_10017610 Ga0207702_100176109 262
316 3300031548 Ga0307408_100000022 Ga0307408_100000022207 262
317 3300031548 Ga0307408_100001119 Ga0307408_10000111912 262
318 3300031548 Ga0307408_100037865 Ga0307408_1000378653 262
319 3300037312 Ga0395899_0051941 Ga0395899_0051941_2147_2941 262
320 3300037418 Ga0395900_0296121 Ga0395900_0296121_438_1232 262
321 3300037466 Ga0395898_0487614 Ga0395898_0487614_233_1027 262
322 3300046520 Ga0495637_0008454 Ga0495637_0008454_4078_4887 262
323 3300049571 Ga0501034_0012354 Ga0501034_0012354_5910_6803 262

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

29

274

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.9712 4 260
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.9675 4 260
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.967 3 260
2voa-assembly1.cif.gz_B structure of an ap endonuclease from archaeoglobus fulgidus 0.9639 4 260
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.9633 3 260
ID Description Score Start End Superfamily
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9733 3 260 3.60.10.10
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9696 3 260 3.60.10.10
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9637 4 260 3.60.10.10
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9564 4 260 3.60.10.10
af_P09030_1_268_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9513 4 260 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A6I3SU57-F1-model_v4 Exodeoxyribonuclease III (EC 3.1.11.2) 0.999 4 259 GO:0006281
GO:0008311
GO:0046872
AF-A0A2W5ADH5-F1-model_v4 Exodeoxyribonuclease III 0.9973 4 131 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872
AF-A0A530LIU1-F1-model_v4 Exodeoxyribonuclease III 0.9972 4 100 GO:0006281
GO:0008311
AF-A0A4R3FGF6-F1-model_v4 Exodeoxyribonuclease III 0.9969 6 227 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872
AF-A0A1G4ULC5-F1-model_v4 Exodeoxyribonuclease III 0.9966 4 185 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872

Feature Viewer

pLDDT pTM Quality
96.38 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map