F407096
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 323 | 225 | 306 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300049569|Ga0501032_0097657|Ga0501032_0097657_562_1038 |
| Length | 158 |
| Sequence | MGDAPSRTLCRRGIPRPVTIRQLKEIIMRLLHTMLRVGNLDRSIDFYTNVLGMRLLRRKDYPDGKFTLAFVGYQDESEGAVLELTHNWDTDRYELGNAFGHIAVDVPDAYEACDRVRERGGKVTREAGPMKHGTTVIAFVEDPDGYKIEFIQKGTQKD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 2 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 3 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 4 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 5 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 6 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 7 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 8 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 9 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 10 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 11 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 12 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 13 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 14 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 15 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 16 | 2941479691 | |||
| 17 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 94 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 145 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 146 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 148 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 149 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 150 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 151 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 153 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 154 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 155 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 156 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 157 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 158 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 159 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 160 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 161 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 162 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 163 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 164 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 165 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 166 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 167 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 168 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 169 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 170 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 171 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 187 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 188 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 189 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 190 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 191 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 192 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 193 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 194 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 195 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 196 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 197 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 198 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 199 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 200 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 213 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 216 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 219 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 220 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 221 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 222 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 223 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 224 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 225 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.12 |
| Metatranscriptomes | 0.62 |
| Isolates | 5.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.29 |
| Nodule | 0.93 |
| Rhizoplane | 2.79 |
| Rhizosphere | 78.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000615 | 3300003187 | Bacteria | 31195 |
| 2 | rootL2_10062710 | 3300003322 | Bacteria | 5008 |
| 3 | Ga0055532_1003036 | 3300003758 | Bacteria | 3106 |
| 4 | Ga0055529_1000561 | 3300003763 | Bacteria | 30975 |
| 5 | Ga0055528_1002578 | 3300003790 | Bacteria | 9599 |
| 6 | Ga0058692_1002896 | 3300003856 | Bacteria | 5553 |
| 7 | Ga0070676_10043699 | 3300005328 | Bacteria | 2605 |
| 8 | Ga0070676_10135599 | 3300005328 | Bacteria | 1561 |
| 9 | Ga0070690_100020852 | 3300005330 | Bacteria | 3996 |
| 10 | Ga0070677_10690673 | 3300005333 | Bacteria | 574 |
| 11 | Ga0068869_100000049 | 3300005334 | Bacteria | 50658 |
| 12 | Ga0070666_10698658 | 3300005335 | Bacteria | 744 |
| 13 | Ga0068868_100025761 | 3300005338 | Bacteria | 4477 |
| 14 | Ga0068868_100521603 | 3300005338 | Bacteria | 1043 |
| 15 | Ga0070660_100146351 | 3300005339 | Bacteria | 1898 |
| 16 | Ga0070689_100058612 | 3300005340 | Bacteria | 2990 |
| 17 | Ga0070687_100115956 | 3300005343 | Bacteria | 1524 |
| 18 | Ga0070687_100166187 | 3300005343 | Bacteria | 1309 |
| 19 | Ga0070692_10125740 | 3300005345 | Bacteria | 1435 |
| 20 | Ga0070668_100148676 | 3300005347 | Bacteria | 1893 |
| 21 | Ga0070669_101441533 | 3300005353 | Bacteria | 598 |
| 22 | Ga0070674_100198143 | 3300005356 | Bacteria | 1549 |
| 23 | Ga0070674_100617240 | 3300005356 | Bacteria | 918 |
| 24 | Ga0070673_100173552 | 3300005364 | Bacteria | 1841 |
| 25 | Ga0070673_100320037 | 3300005364 | Bacteria | 1370 |
| 26 | Ga0070688_100242777 | 3300005365 | Bacteria | 1279 |
| 27 | Ga0070659_100338734 | 3300005366 | Bacteria | 1260 |
| 28 | Ga0070701_10006693 | 3300005438 | Bacteria | 4866 |
| 29 | Ga0070701_10957496 | 3300005438 | Bacteria | 594 |
| 30 | Ga0070705_100007749 | 3300005440 | Bacteria | 5301 |
| 31 | Ga0070700_100000172 | 3300005441 | Bacteria | 36746 |
| 32 | Ga0070700_100527597 | 3300005441 | Bacteria | 913 |
| 33 | Ga0070694_100177095 | 3300005444 | Bacteria | 1575 |
| 34 | Ga0070708_100158267 | 3300005445 | Bacteria | 2110 |
| 35 | Ga0070678_101616064 | 3300005456 | Bacteria | 609 |
| 36 | Ga0070678_101690204 | 3300005456 | Bacteria | 595 |
| 37 | Ga0070662_100152700 | 3300005457 | Bacteria | 1799 |
| 38 | Ga0070662_100837666 | 3300005457 | Bacteria | 783 |
| 39 | Ga0070662_100934071 | 3300005457 | Bacteria | 741 |
| 40 | Ga0068867_100027676 | 3300005459 | Bacteria | 4077 |
| 41 | Ga0070685_10261826 | 3300005466 | Bacteria | 1150 |
| 42 | Ga0070706_100113839 | 3300005467 | Bacteria | 2519 |
| 43 | Ga0070706_100794931 | 3300005467 | Bacteria | 876 |
| 44 | Ga0070707_100399861 | 3300005468 | Bacteria | 1334 |
| 45 | Ga0070698_100935847 | 3300005471 | Bacteria | 813 |
| 46 | Ga0070697_100288559 | 3300005536 | Bacteria | 1409 |
| 47 | Ga0070697_100671859 | 3300005536 | Bacteria | 913 |
| 48 | Ga0068853_100468292 | 3300005539 | Bacteria | 1187 |
| 49 | Ga0070672_100283512 | 3300005543 | Bacteria | 1401 |
| 50 | Ga0070686_100000603 | 3300005544 | Bacteria | 21221 |
| 51 | Ga0070695_100007775 | 3300005545 | Bacteria | 6351 |
| 52 | Ga0070696_100004853 | 3300005546 | Bacteria | 8985 |
| 53 | Ga0070693_100040479 | 3300005547 | Bacteria | 2616 |
| 54 | Ga0070665_100205712 | 3300005548 | Bacteria | 1969 |
| 55 | Ga0068855_100379318 | 3300005563 | Bacteria | 1553 |
| 56 | Ga0070664_100746811 | 3300005564 | Bacteria | 913 |
| 57 | Ga0068856_101046613 | 3300005614 | Bacteria | 834 |
| 58 | Ga0068856_101564875 | 3300005614 | Bacteria | 673 |
| 59 | Ga0070702_100069419 | 3300005615 | Bacteria | 2076 |
| 60 | Ga0068864_101614931 | 3300005618 | Bacteria | 652 |
| 61 | Ga0068866_10003682 | 3300005718 | Bacteria | 6279 |
| 62 | Ga0068861_100022421 | 3300005719 | Bacteria | 4549 |
| 63 | Ga0068870_10014318 | 3300005840 | Bacteria | 3745 |
| 64 | Ga0068870_10707639 | 3300005840 | Bacteria | 695 |
| 65 | Ga0068863_100191053 | 3300005841 | Bacteria | 1968 |
| 66 | Ga0068858_100000973 | 3300005842 | Bacteria | 29642 |
| 67 | Ga0068860_100009793 | 3300005843 | Bacteria | 9512 |
| 68 | Ga0068862_100011372 | 3300005844 | Bacteria | 7349 |
| 69 | Ga0068862_100271470 | 3300005844 | Bacteria | 1551 |
| 70 | Ga0075364_10498977 | 3300006051 | Bacteria | 832 |
| 71 | Ga0075369_10037044 | 3300006186 | Bacteria | 2077 |
| 72 | Ga0097621_100000366 | 3300006237 | Bacteria | 31321 |
| 73 | Ga0075370_10173146 | 3300006353 | Bacteria | 1269 |
| 74 | Ga0068871_100841563 | 3300006358 | Bacteria | 848 |
| 75 | Ga0068871_100854172 | 3300006358 | Bacteria | 841 |
| 76 | Ga0075428_101252243 | 3300006844 | Bacteria | 781 |
| 77 | Ga0075430_101421854 | 3300006846 | Bacteria | 570 |
| 78 | Ga0075434_101032061 | 3300006871 | Bacteria | 836 |
| 79 | Ga0068865_100000303 | 3300006881 | Bacteria | 27172 |
| 80 | Ga0105240_10046484 | 3300009093 | Bacteria | 5500 |
| 81 | Ga0111539_12673234 | 3300009094 | Bacteria | 579 |
| 82 | Ga0114129_12344175 | 3300009147 | Bacteria | 640 |
| 83 | Ga0105239_10430398 | 3300010375 | Bacteria | 1496 |
| 84 | Ga0105246_11319133 | 3300011119 | Bacteria | 670 |
| 85 | Ga0157370_10004509 | 3300013104 | Bacteria | 15960 |
| 86 | Ga0157370_11923579 | 3300013104 | Bacteria | 531 |
| 87 | Ga0157375_10616490 | 3300013308 | Bacteria | 1243 |
| 88 | Ga0157380_10266441 | 3300014326 | Bacteria | 1559 |
| 89 | Ga0157380_11381974 | 3300014326 | Bacteria | 754 |
| 90 | Ga0157379_11403292 | 3300014968 | Bacteria | 677 |
| 91 | Ga0182007_10071247 | 3300015262 | Bacteria | 1139 |
| 92 | Ga0163161_10049380 | 3300017792 | Bacteria | 3041 |
| 93 | Ga0206354_10638157 | 3300020081 | Bacteria | 822 |
| 94 | Ga0206353_11743754 | 3300020082 | Bacteria | 1621 |
| 95 | Ga0213872_10317371 | 3300021361 | Bacteria | 644 |
| 96 | Ga0209672_100046 | 3300025228 | Bacteria | 264244 |
| 97 | Ga0209672_101446 | 3300025228 | Bacteria | 8496 |
| 98 | Ga0209147_100043 | 3300025229 | Bacteria | 300460 |
| 99 | Ga0209258_100023 | 3300025242 | Bacteria | 547286 |
| 100 | Ga0209148_1000029 | 3300025254 | Bacteria | 579199 |
| 101 | Ga0209148_1000353 | 3300025254 | Bacteria | 59341 |
| 102 | Ga0209565_1022149 | 3300025263 | Bacteria | 1319 |
| 103 | Ga0209455_1000064 | 3300025272 | Bacteria | 332404 |
| 104 | Ga0209455_1000398 | 3300025272 | Bacteria | 37150 |
| 105 | Ga0209673_1000115 | 3300025273 | Bacteria | 176939 |
| 106 | Ga0209675_1039522 | 3300025291 | Bacteria | 1044 |
| 107 | Ga0209676_1034636 | 3300025292 | Bacteria | 1491 |
| 108 | Ga0209025_1000055 | 3300025294 | Bacteria | 316748 |
| 109 | Ga0209050_1008665 | 3300025298 | Bacteria | 5370 |
| 110 | Ga0209051_1041026 | 3300025303 | Bacteria | 1652 |
| 111 | Ga0207642_10002519 | 3300025899 | Bacteria | 5707 |
| 112 | Ga0207680_10187096 | 3300025903 | Bacteria | 1403 |
| 113 | Ga0207680_10543041 | 3300025903 | Bacteria | 830 |
| 114 | Ga0207643_10002271 | 3300025908 | Bacteria | 10467 |
| 115 | Ga0207695_10014762 | 3300025913 | Bacteria | 9231 |
| 116 | Ga0207662_10058513 | 3300025918 | Bacteria | 2307 |
| 117 | Ga0207657_10081868 | 3300025919 | Bacteria | 2710 |
| 118 | Ga0207649_11246589 | 3300025920 | Bacteria | 588 |
| 119 | Ga0207652_11350385 | 3300025921 | Bacteria | 616 |
| 120 | Ga0207681_10448901 | 3300025923 | Bacteria | 1049 |
| 121 | Ga0207681_11281656 | 3300025923 | Bacteria | 615 |
| 122 | Ga0207659_10126207 | 3300025926 | Bacteria | 1968 |
| 123 | Ga0207664_11761193 | 3300025929 | Bacteria | 542 |
| 124 | Ga0207644_10075600 | 3300025931 | Bacteria | 2475 |
| 125 | Ga0207644_10723925 | 3300025931 | Bacteria | 830 |
| 126 | Ga0207690_10416246 | 3300025932 | Bacteria | 1074 |
| 127 | Ga0207706_10213289 | 3300025933 | Bacteria | 1692 |
| 128 | Ga0207706_10861104 | 3300025933 | Bacteria | 767 |
| 129 | Ga0207686_10001851 | 3300025934 | Bacteria | 11747 |
| 130 | Ga0207709_10005925 | 3300025935 | Bacteria | 6896 |
| 131 | Ga0207670_10017311 | 3300025936 | Bacteria | 4356 |
| 132 | Ga0207669_10910181 | 3300025937 | Bacteria | 735 |
| 133 | Ga0207704_10001040 | 3300025938 | Bacteria | 12321 |
| 134 | Ga0207691_10283547 | 3300025940 | Bacteria | 1425 |
| 135 | Ga0207711_10305771 | 3300025941 | Bacteria | 1467 |
| 136 | Ga0207711_11809879 | 3300025941 | Bacteria | 554 |
| 137 | Ga0207689_10000156 | 3300025942 | Bacteria | 59034 |
| 138 | Ga0207667_11956587 | 3300025949 | Bacteria | 547 |
| 139 | Ga0207668_10438405 | 3300025972 | Bacteria | 1112 |
| 140 | Ga0207658_10130751 | 3300025986 | Bacteria | 2017 |
| 141 | Ga0207677_10510835 | 3300026023 | Bacteria | 1041 |
| 142 | Ga0207703_10251798 | 3300026035 | Bacteria | 1592 |
| 143 | Ga0207703_10419295 | 3300026035 | Bacteria | 1245 |
| 144 | Ga0207639_11382979 | 3300026041 | Bacteria | 661 |
| 145 | Ga0207708_10000176 | 3300026075 | Bacteria | 50684 |
| 146 | Ga0207641_10136327 | 3300026088 | Bacteria | 2209 |
| 147 | Ga0207648_10155359 | 3300026089 | Bacteria | 2020 |
| 148 | Ga0207648_10393099 | 3300026089 | Bacteria | 1255 |
| 149 | Ga0207676_11316159 | 3300026095 | Bacteria | 717 |
| 150 | Ga0207675_100000084 | 3300026118 | Bacteria | 74312 |
| 151 | Ga0207683_10071005 | 3300026121 | Bacteria | 3077 |
| 152 | Ga0209371_1000065 | 3300027312 | Bacteria | 214464 |
| 153 | Ga0207428_10938364 | 3300027907 | Bacteria | 610 |
| 154 | Ga0268265_10070983 | 3300028380 | Bacteria | 2710 |
| 155 | Ga0268264_10009264 | 3300028381 | Bacteria | 8152 |
| 156 | Ga0265334_10000034 | 3300028573 | Bacteria | 105710 |
| 157 | Ga0268256_1000118 | 3300030500 | Bacteria | 115175 |
| 158 | Ga0268256_1008408 | 3300030500 | Bacteria | 3538 |
| 159 | Ga0265332_10002163 | 3300031238 | Bacteria | 10131 |
| 160 | Ga0265328_10000501 | 3300031239 | Bacteria | 18180 |
| 161 | Ga0265328_10046456 | 3300031239 | Bacteria | 1596 |
| 162 | Ga0265331_10000121 | 3300031250 | Bacteria | 102519 |
| 163 | Ga0265331_10008717 | 3300031250 | Bacteria | 5747 |
| 164 | Ga0265331_10029420 | 3300031250 | Bacteria | 2742 |
| 165 | Ga0265331_10214285 | 3300031250 | Bacteria | 866 |
| 166 | Ga0265327_10000269 | 3300031251 | Bacteria | 102772 |
| 167 | Ga0265327_10000706 | 3300031251 | Bacteria | 52819 |
| 168 | Ga0265327_10000934 | 3300031251 | Bacteria | 42807 |
| 169 | Ga0265327_10003535 | 3300031251 | Bacteria | 14809 |
| 170 | Ga0265327_10020068 | 3300031251 | Bacteria | 4086 |
| 171 | Ga0265327_10032676 | 3300031251 | Bacteria | 2909 |
| 172 | Ga0265327_10089878 | 3300031251 | Bacteria | 1499 |
| 173 | Ga0265327_10214791 | 3300031251 | Bacteria | 867 |
| 174 | Ga0265316_10000186 | 3300031344 | Bacteria | 71372 |
| 175 | Ga0265316_11052474 | 3300031344 | Bacteria | 565 |
| 176 | Ga0265313_10100120 | 3300031595 | Bacteria | 1287 |
| 177 | Ga0316578_10357971 | 3300031728 | Bacteria | 868 |
| 178 | Ga0307410_10220097 | 3300031852 | Bacteria | 1460 |
| 179 | Ga0307415_100306444 | 3300032126 | Bacteria | 1318 |
| 180 | Ga0316583_10084032 | 3300032133 | Bacteria | 1112 |
| 181 | Ga0373955_0972770 | 3300035172 | Bacteria | 523 |
| 182 | Ga0373931_0945857 | 3300035691 | Bacteria | 581 |
| 183 | Ga0373927_0098515 | 3300035695 | Bacteria | 1901 |
| 184 | Ga0373933_0098389 | 3300035724 | Bacteria | 1813 |
| 185 | Ga0395900_0016999 | 3300037418 | Bacteria | 7424 |
| 186 | Ga0395900_0038297 | 3300037418 | Bacteria | 4942 |
| 187 | Ga0395900_1737448 | 3300037418 | Bacteria | 535 |
| 188 | Ga0395905_0000014 | 3300037471 | Bacteria | 394209 |
| 189 | Ga0395905_0391559 | 3300037471 | Bacteria | 1284 |
| 190 | Ga0395901_0031209 | 3300038443 | Bacteria | 5494 |
| 191 | Ga0395901_0309907 | 3300038443 | Bacteria | 1635 |
| 192 | Ga0395901_0730375 | 3300038443 | Bacteria | 985 |
| 193 | Ga0400484_26491 | 3300038725 | Bacteria | 6602 |
| 194 | Ga0436361_0455484 | 3300039447 | Bacteria | 12588 |
| 195 | Ga0436361_0970448 | 3300039447 | Bacteria | 1085 |
| 196 | Ga0451853_0122655 | 3300041512 | Bacteria | 912 |
| 197 | Ga0451577_0046809 | 3300042876 | Bacteria | 3868 |
| 198 | Ga0451577_0330194 | 3300042876 | Bacteria | 1383 |
| 199 | Ga0451577_0847555 | 3300042876 | Bacteria | 824 |
| 200 | Ga0466961_0152293 | 3300044693 | Bacteria | 1443 |
| 201 | Ga0453684_0303243 | 3300044712 | Bacteria | 1815 |
| 202 | Ga0466957_0913847 | 3300044842 | Bacteria | 628 |
| 203 | Ga0451576_0039345 | 3300045051 | Bacteria | 5005 |
| 204 | Ga0451576_2047447 | 3300045051 | Bacteria | 589 |
| 205 | Ga0495651_0170734 | 3300046462 | Bacteria | 1549 |
| 206 | Ga0495580_0000541 | 3300046472 | Bacteria | 31897 |
| 207 | Ga0495630_0008419 | 3300046517 | Bacteria | 7396 |
| 208 | Ga0495622_0059122 | 3300046557 | Bacteria | 1775 |
| 209 | Ga0495599_0071256 | 3300046678 | Bacteria | 2169 |
| 210 | Ga0495623_0004680 | 3300046679 | Bacteria | 8992 |
| 211 | Ga0495646_0021743 | 3300046680 | Bacteria | 4053 |
| 212 | Ga0495647_0368540 | 3300046681 | Bacteria | 656 |
| 213 | Ga0495604_0006971 | 3300047317 | Bacteria | 8957 |
| 214 | Ga0495604_0047913 | 3300047317 | Bacteria | 3326 |
| 215 | Ga0495680_0044951 | 3300047322 | Bacteria | 3489 |
| 216 | Ga0495680_0086341 | 3300047322 | Bacteria | 2361 |
| 217 | Ga0495602_0027609 | 3300048088 | Bacteria | 5452 |
| 218 | Ga0495602_0616375 | 3300048088 | Bacteria | 744 |
| 219 | Ga0496100_1377046 | 3300048903 | Bacteria | 557 |
| 220 | Ga0496101_0528749 | 3300048904 | Bacteria | 932 |
| 221 | Ga0496108_0058563 | 3300048911 | Bacteria | 3238 |
| 222 | Ga0496109_0140133 | 3300048912 | Bacteria | 2261 |
| 223 | Ga0496110_0597026 | 3300048913 | Bacteria | 1002 |
| 224 | Ga0496113_0009554 | 3300048916 | Bacteria | 6362 |
| 225 | Ga0496114_0154106 | 3300048917 | Bacteria | 1994 |
| 226 | Ga0496115_0890324 | 3300048918 | Bacteria | 687 |
| 227 | Ga0496116_0361975 | 3300048919 | Bacteria | 659 |
| 228 | Ga0496118_0022743 | 3300048921 | Bacteria | 5467 |
| 229 | Ga0496119_0004596 | 3300048922 | Bacteria | 13625 |
| 230 | Ga0496120_0009252 | 3300048923 | Bacteria | 7014 |
| 231 | Ga0496121_0000314 | 3300048924 | Bacteria | 100909 |
| 232 | Ga0496121_0053762 | 3300048924 | Bacteria | 3371 |
| 233 | Ga0496121_0204025 | 3300048924 | Bacteria | 1406 |
| 234 | Ga0496122_0061908 | 3300048925 | Bacteria | 2742 |
| 235 | Ga0496123_0179480 | 3300048926 | Bacteria | 1107 |
| 236 | Ga0496124_0110024 | 3300048927 | Bacteria | 2219 |
| 237 | Ga0496124_0257166 | 3300048927 | Bacteria | 1287 |
| 238 | Ga0496125_0000028 | 3300048928 | Bacteria | 387222 |
| 239 | Ga0496125_0099269 | 3300048928 | Bacteria | 2151 |
| 240 | Ga0496126_0001519 | 3300048929 | Bacteria | 35767 |
| 241 | Ga0496126_0216859 | 3300048929 | Bacteria | 1609 |
| 242 | Ga0501031_0060693 | 3300049568 | Bacteria | 2464 |
| 243 | Ga0501032_0000993 | 3300049569 | Bacteria | 22838 |
| 244 | Ga0501032_0001682 | 3300049569 | Bacteria | 17543 |
| 245 | Ga0501032_0001947 | 3300049569 | Bacteria | 16245 |
| 246 | Ga0501032_0097657 | 3300049569 | Bacteria | 1947 |
| 247 | Ga0501032_0360403 | 3300049569 | Bacteria | 936 |
| 248 | Ga0501033_0000288 | 3300049570 | Bacteria | 48339 |
| 249 | Ga0501033_0001731 | 3300049570 | Bacteria | 19081 |
| 250 | Ga0501033_0003258 | 3300049570 | Bacteria | 13438 |
| 251 | Ga0501033_0010351 | 3300049570 | Bacteria | 7160 |
| 252 | Ga0501034_0026091 | 3300049571 | Bacteria | 5950 |
| 253 | Ga0501034_0026221 | 3300049571 | Bacteria | 5936 |
| 254 | Ga0501034_0656729 | 3300049571 | Bacteria | 950 |
| 255 | Ga0501036_0000142 | 3300049572 | Bacteria | 46404 |
| 256 | Ga0501036_0001944 | 3300049572 | Bacteria | 16036 |
| 257 | Ga0501036_0009398 | 3300049572 | Bacteria | 8043 |
| 258 | Ga0501037_0000670 | 3300049573 | Bacteria | 26232 |
| 259 | Ga0501037_0045436 | 3300049573 | Bacteria | 3225 |
| 260 | Ga0501037_0071264 | 3300049573 | Bacteria | 2528 |
| 261 | Ga0501038_0001606 | 3300049574 | Bacteria | 20982 |
| 262 | Ga0501038_0071422 | 3300049574 | Bacteria | 2944 |
| 263 | Ga0501038_0089678 | 3300049574 | Bacteria | 2578 |
| 264 | Ga0501038_0367426 | 3300049574 | Bacteria | 1118 |
| 265 | Ga0501039_0023206 | 3300049575 | Bacteria | 4761 |
| 266 | Ga0501042_0600571 | 3300049578 | Bacteria | 800 |
| 267 | Ga0501043_0001095 | 3300049579 | Bacteria | 23800 |
| 268 | Ga0501043_0021786 | 3300049579 | Bacteria | 5025 |
| 269 | Ga0501043_0117112 | 3300049579 | Bacteria | 2090 |
| 270 | Ga0501043_0873377 | 3300049579 | Bacteria | 646 |
| 271 | Ga0501046_0003542 | 3300049580 | Bacteria | 14302 |
| 272 | Ga0501046_0117467 | 3300049580 | Bacteria | 2026 |
| 273 | Ga0501046_0759128 | 3300049580 | Bacteria | 681 |
| 274 | Ga0501047_0002544 | 3300049581 | Bacteria | 17375 |
| 275 | Ga0501047_0010522 | 3300049581 | Bacteria | 8750 |
| 276 | Ga0501047_0031778 | 3300049581 | Bacteria | 5093 |
| 277 | Ga0501047_0445382 | 3300049581 | Bacteria | 1125 |
| 278 | Ga0501280_000920 | 3300049776 | Bacteria | 6213 |
| 279 | Ga0501035_0000737 | 3300049822 | Bacteria | 35342 |
| 280 | Ga0501035_0004300 | 3300049822 | Bacteria | 13526 |
| 281 | Ga0501035_0011764 | 3300049822 | Bacteria | 8102 |
| 282 | Ga0501035_0017152 | 3300049822 | Bacteria | 6673 |
| 283 | Ga0501035_0022150 | 3300049822 | Bacteria | 5836 |
| 284 | Ga0501035_0039883 | 3300049822 | Bacteria | 4247 |
| 285 | Ga0501035_0077894 | 3300049822 | Bacteria | 2929 |
| 286 | Ga0501035_0862223 | 3300049822 | Bacteria | 720 |
| 287 | Ga0501044_0000022 | 3300049823 | Bacteria | 201689 |
| 288 | Ga0501044_0000825 | 3300049823 | Bacteria | 37302 |
| 289 | Ga0501044_0001132 | 3300049823 | Bacteria | 31684 |
| 290 | Ga0501044_0002899 | 3300049823 | Bacteria | 19530 |
| 291 | Ga0501044_0015429 | 3300049823 | Bacteria | 8229 |
| 292 | Ga0501044_0034091 | 3300049823 | Bacteria | 5343 |
| 293 | Ga0501044_0036566 | 3300049823 | Bacteria | 5137 |
| 294 | Ga0501044_0309918 | 3300049823 | Bacteria | 1505 |
| 295 | Ga0501044_0610775 | 3300049823 | Bacteria | 983 |
| 296 | nmdc:mga00v17_406308_c1 | 3300050491 | Bacteria | 885 |
| 297 | nmdc:mga05p37_1490804_c1 | 3300050507 | Bacteria | 674 |
| 298 | nmdc:mga08y16_2167395_c1 | 3300050511 | Bacteria | 502 |
| 299 | nmdc:mga08y16_434486_c1 | 3300050511 | Bacteria | 1341 |
| 300 | nmdc:mga0sz30_79261_c1 | 3300050516 | Bacteria | 1420 |
| 301 | Ga0500607_074253 | 3300053121 | Bacteria | 1748 |
| 302 | Ga0500618_046851 | 3300053125 | Bacteria | 984 |
| 303 | Ga0500559_0015348 | 3300053136 | Bacteria | 3235 |
| 304 | Ga0500636_0005880 | 3300053177 | Bacteria | 7030 |
| 305 | Ga0500637_0219520 | 3300053178 | Bacteria | 1075 |
| 306 | Ga0500625_072518 | 3300053729 | Bacteria | 1527 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003763 | Ga0055529_1000561 | Ga0055529_100056111 | 127 |
| 2 | 3300003790 | Ga0055528_1002578 | Ga0055528_10025782 | 127 |
| 3 | 3300003856 | Ga0058692_1002896 | Ga0058692_10028962 | 127 |
| 4 | 3300005356 | Ga0070674_100198143 | Ga0070674_1001981433 | 127 |
| 5 | 3300006846 | Ga0075430_101421854 | Ga0075430_1014218541 | 127 |
| 6 | 3300015262 | Ga0182007_10071247 | Ga0182007_100712471 | 127 |
| 7 | 3300020082 | Ga0206353_11743754 | Ga0206353_117437541 | 127 |
| 8 | 3300025228 | Ga0209672_100046 | Ga0209672_100046180 | 127 |
| 9 | 3300025229 | Ga0209147_100043 | Ga0209147_10004384 | 127 |
| 10 | 3300025242 | Ga0209258_100023 | Ga0209258_100023284 | 127 |
| 11 | 3300025254 | Ga0209148_1000029 | Ga0209148_1000029350 | 127 |
| 12 | 3300025254 | Ga0209148_1000353 | Ga0209148_100035339 | 127 |
| 13 | 3300025263 | Ga0209565_1022149 | Ga0209565_10221491 | 127 |
| 14 | 3300025272 | Ga0209455_1000064 | Ga0209455_100006479 | 127 |
| 15 | 3300025273 | Ga0209673_1000115 | Ga0209673_1000115102 | 127 |
| 16 | 3300025291 | Ga0209675_1039522 | Ga0209675_10395221 | 127 |
| 17 | 3300025921 | Ga0207652_11350385 | Ga0207652_113503852 | 127 |
| 18 | 3300026089 | Ga0207648_10393099 | Ga0207648_103930992 | 127 |
| 19 | 3300027312 | Ga0209371_1000065 | Ga0209371_100006554 | 127 |
| 20 | 3300030500 | Ga0268256_1000118 | Ga0268256_100011854 | 127 |
| 21 | 3300031728 | Ga0316578_10357971 | Ga0316578_103579712 | 127 |
| 22 | 3300035172 | Ga0373955_0972770 | Ga0373955_0972770_47_430 | 127 |
| 23 | 3300038725 | Ga0400484_26491 | Ga0400484_26491_6074_6457 | 127 |
| 24 | 3300039447 | Ga0436361_0970448 | Ga0436361_0970448_394_777 | 127 |
| 25 | 3300044693 | Ga0466961_0152293 | Ga0466961_0152293_430_813 | 127 |
| 26 | 3300044842 | Ga0466957_0913847 | Ga0466957_0913847_97_534 | 127 |
| 27 | 3300046681 | Ga0495647_0368540 | Ga0495647_0368540_97_480 | 127 |
| 28 | 3300048924 | Ga0496121_0204025 | Ga0496121_0204025_714_1097 | 127 |
| 29 | 3300049581 | Ga0501047_0445382 | Ga0501047_0445382_68_451 | 127 |
| 30 | 3300049823 | Ga0501044_0610775 | Ga0501044_0610775_127_510 | 127 |
| 31 | iso_pu_bacteria | 2515154122 | 2515679480 | 127 |
| 32 | iso_pu_bacteria | 2599185292 | 2599905505 | 127 |
| 33 | iso_pu_bacteria | 2643221569 | 2643862723 | 127 |
| 34 | iso_pu_bacteria | 2643221594 | 2643980268 | 127 |
| 35 | iso_pu_bacteria | 2643221621 | 2644124749 | 127 |
| 36 | iso_pu_bacteria | 2808606395 | 2809032419 | 127 |
| 37 | iso_pu_bacteria | 2855730933 | 2855736292 | 127 |
| 38 | iso_pu_bacteria | 2855767633 | 2855773229 | 127 |
| 39 | iso_pu_bacteria | 2857537821 | 2857542445 | 127 |
| 40 | iso_pu_bacteria | 2858950400 | 2858952796 | 127 |
| 41 | iso_pu_bacteria | 2881412998 | 2881417321 | 127 |
| 42 | iso_pu_bacteria | 2881927736 | 2881929649 | 127 |
| 43 | iso_pu_bacteria | 2887375801 | 2887379843 | 127 |
| 44 | iso_pu_bacteria | 2902682994 | 2902689239 | 127 |
| 45 | iso_pu_bacteria | 2904504865 | 2904504966 | 127 |
| 46 | iso_pu_bacteria | 2941479691 | 2941485170 | 127 |
| 47 | iso_pu_bacteria | 8002392321 | 8002393144 | 127 |
| 48 | 3300005328 | Ga0070676_10043699 | Ga0070676_100436991 | 128 |
| 49 | 3300005330 | Ga0070690_100020852 | Ga0070690_1000208526 | 128 |
| 50 | 3300005334 | Ga0068869_100000049 | Ga0068869_1000000496 | 128 |
| 51 | 3300005338 | Ga0068868_100025761 | Ga0068868_1000257616 | 128 |
| 52 | 3300005340 | Ga0070689_100058612 | Ga0070689_1000586123 | 128 |
| 53 | 3300005343 | Ga0070687_100115956 | Ga0070687_1001159563 | 128 |
| 54 | 3300005345 | Ga0070692_10125740 | Ga0070692_101257403 | 128 |
| 55 | 3300005356 | Ga0070674_100617240 | Ga0070674_1006172403 | 128 |
| 56 | 3300005365 | Ga0070688_100242777 | Ga0070688_1002427771 | 128 |
| 57 | 3300005438 | Ga0070701_10006693 | Ga0070701_100066931 | 128 |
| 58 | 3300005440 | Ga0070705_100007749 | Ga0070705_1000077498 | 128 |
| 59 | 3300005441 | Ga0070700_100000172 | Ga0070700_1000001728 | 128 |
| 60 | 3300005444 | Ga0070694_100177095 | Ga0070694_1001770951 | 128 |
| 61 | 3300005456 | Ga0070678_101616064 | Ga0070678_1016160641 | 128 |
| 62 | 3300005459 | Ga0068867_100027676 | Ga0068867_1000276765 | 128 |
| 63 | 3300005466 | Ga0070685_10261826 | Ga0070685_102618263 | 128 |
| 64 | 3300005539 | Ga0068853_100468292 | Ga0068853_1004682921 | 128 |
| 65 | 3300005544 | Ga0070686_100000603 | Ga0070686_1000006038 | 128 |
| 66 | 3300005545 | Ga0070695_100007775 | Ga0070695_1000077752 | 128 |
| 67 | 3300005546 | Ga0070696_100004853 | Ga0070696_10000485310 | 128 |
| 68 | 3300005547 | Ga0070693_100040479 | Ga0070693_1000404794 | 128 |
| 69 | 3300005614 | Ga0068856_101046613 | Ga0068856_1010466131 | 128 |
| 70 | 3300005615 | Ga0070702_100069419 | Ga0070702_1000694193 | 128 |
| 71 | 3300005718 | Ga0068866_10003682 | Ga0068866_100036826 | 128 |
| 72 | 3300005719 | Ga0068861_100022421 | Ga0068861_1000224217 | 128 |
| 73 | 3300005840 | Ga0068870_10014318 | Ga0068870_100143186 | 128 |
| 74 | 3300005842 | Ga0068858_100000973 | Ga0068858_10000097324 | 128 |
| 75 | 3300005843 | Ga0068860_100009793 | Ga0068860_1000097931 | 128 |
| 76 | 3300005844 | Ga0068862_100011372 | Ga0068862_10001137210 | 128 |
| 77 | 3300006237 | Ga0097621_100000366 | Ga0097621_10000036621 | 128 |
| 78 | 3300006881 | Ga0068865_100000303 | Ga0068865_10000030324 | 128 |
| 79 | 3300025899 | Ga0207642_10002519 | Ga0207642_100025191 | 128 |
| 80 | 3300025903 | Ga0207680_10543041 | Ga0207680_105430412 | 128 |
| 81 | 3300025908 | Ga0207643_10002271 | Ga0207643_100022719 | 128 |
| 82 | 3300025934 | Ga0207686_10001851 | Ga0207686_100018515 | 128 |
| 83 | 3300025935 | Ga0207709_10005925 | Ga0207709_100059256 | 128 |
| 84 | 3300025936 | Ga0207670_10017311 | Ga0207670_100173115 | 128 |
| 85 | 3300025937 | Ga0207669_10910181 | Ga0207669_109101812 | 128 |
| 86 | 3300025938 | Ga0207704_10001040 | Ga0207704_1000104015 | 128 |
| 87 | 3300025941 | Ga0207711_10305771 | Ga0207711_103057712 | 128 |
| 88 | 3300025942 | Ga0207689_10000156 | Ga0207689_1000015639 | 128 |
| 89 | 3300026023 | Ga0207677_10510835 | Ga0207677_105108351 | 128 |
| 90 | 3300026035 | Ga0207703_10251798 | Ga0207703_102517981 | 128 |
| 91 | 3300026075 | Ga0207708_10000176 | Ga0207708_1000017639 | 128 |
| 92 | 3300026089 | Ga0207648_10155359 | Ga0207648_101553593 | 128 |
| 93 | 3300026118 | Ga0207675_100000084 | Ga0207675_10000008420 | 128 |
| 94 | 3300026121 | Ga0207683_10071005 | Ga0207683_100710054 | 128 |
| 95 | 3300028380 | Ga0268265_10070983 | Ga0268265_100709835 | 128 |
| 96 | 3300028381 | Ga0268264_10009264 | Ga0268264_100092644 | 128 |
| 97 | 3300031238 | Ga0265332_10002163 | Ga0265332_100021632 | 128 |
| 98 | 3300031595 | Ga0265313_10100120 | Ga0265313_101001202 | 128 |
| 99 | 3300035695 | Ga0373927_0098515 | Ga0373927_0098515_138_524 | 128 |
| 100 | 3300035724 | Ga0373933_0098389 | Ga0373933_0098389_41_427 | 128 |
| 101 | 3300037471 | Ga0395905_0000014 | Ga0395905_0000014_82073_82459 | 128 |
| 102 | 3300042876 | Ga0451577_0046809 | Ga0451577_0046809_1747_2133 | 128 |
| 103 | 3300042876 | Ga0451577_0330194 | Ga0451577_0330194_329_715 | 128 |
| 104 | 3300044712 | Ga0453684_0303243 | Ga0453684_0303243_1019_1405 | 128 |
| 105 | 3300045051 | Ga0451576_0039345 | Ga0451576_0039345_1922_2308 | 128 |
| 106 | 3300045051 | Ga0451576_2047447 | Ga0451576_2047447_56_442 | 128 |
| 107 | 3300046462 | Ga0495651_0170734 | Ga0495651_0170734_610_996 | 128 |
| 108 | 3300046472 | Ga0495580_0000541 | Ga0495580_0000541_22731_23117 | 128 |
| 109 | 3300046517 | Ga0495630_0008419 | Ga0495630_0008419_5852_6238 | 128 |
| 110 | 3300046557 | Ga0495622_0059122 | Ga0495622_0059122_223_609 | 128 |
| 111 | 3300046678 | Ga0495599_0071256 | Ga0495599_0071256_1044_1430 | 128 |
| 112 | 3300046679 | Ga0495623_0004680 | Ga0495623_0004680_6945_7331 | 128 |
| 113 | 3300046680 | Ga0495646_0021743 | Ga0495646_0021743_1625_2011 | 128 |
| 114 | 3300047317 | Ga0495604_0006971 | Ga0495604_0006971_6625_7011 | 128 |
| 115 | 3300047317 | Ga0495604_0047913 | Ga0495604_0047913_1606_1992 | 128 |
| 116 | 3300047322 | Ga0495680_0044951 | Ga0495680_0044951_128_514 | 128 |
| 117 | 3300047322 | Ga0495680_0086341 | Ga0495680_0086341_335_721 | 128 |
| 118 | 3300048088 | Ga0495602_0027609 | Ga0495602_0027609_3361_3747 | 128 |
| 119 | 3300048088 | Ga0495602_0616375 | Ga0495602_0616375_332_718 | 128 |
| 120 | 3300048916 | Ga0496113_0009554 | Ga0496113_0009554_2995_3381 | 128 |
| 121 | 3300048918 | Ga0496115_0890324 | Ga0496115_0890324_52_438 | 128 |
| 122 | 3300048929 | Ga0496126_0001519 | Ga0496126_0001519_32289_32675 | 128 |
| 123 | 3300049570 | Ga0501033_0000288 | Ga0501033_0000288_35462_35848 | 128 |
| 124 | 3300049573 | Ga0501037_0045436 | Ga0501037_0045436_1678_2064 | 128 |
| 125 | 3300049581 | Ga0501047_0031778 | Ga0501047_0031778_1880_2266 | 128 |
| 126 | 3300049823 | Ga0501044_0015429 | Ga0501044_0015429_4624_5010 | 128 |
| 127 | 3300049823 | Ga0501044_0036566 | Ga0501044_0036566_1995_2381 | 128 |
| 128 | 3300053121 | Ga0500607_074253 | Ga0500607_074253_25_411 | 128 |
| 129 | 3300053136 | Ga0500559_0015348 | Ga0500559_0015348_2136_2522 | 128 |
| 130 | 3300053177 | Ga0500636_0005880 | Ga0500636_0005880_6162_6548 | 128 |
| 131 | 3300053178 | Ga0500637_0219520 | Ga0500637_0219520_451_837 | 128 |
| 132 | 3300053729 | Ga0500625_072518 | Ga0500625_072518_187_573 | 128 |
| 133 | 3300003758 | Ga0055532_1003036 | Ga0055532_10030363 | 129 |
| 134 | 3300005339 | Ga0070660_100146351 | Ga0070660_1001463512 | 129 |
| 135 | 3300005343 | Ga0070687_100166187 | Ga0070687_1001661871 | 129 |
| 136 | 3300005364 | Ga0070673_100173552 | Ga0070673_1001735522 | 129 |
| 137 | 3300005366 | Ga0070659_100338734 | Ga0070659_1003387342 | 129 |
| 138 | 3300005438 | Ga0070701_10957496 | Ga0070701_109574961 | 129 |
| 139 | 3300005441 | Ga0070700_100527597 | Ga0070700_1005275972 | 129 |
| 140 | 3300005445 | Ga0070708_100158267 | Ga0070708_1001582674 | 129 |
| 141 | 3300005456 | Ga0070678_101690204 | Ga0070678_1016902042 | 129 |
| 142 | 3300005457 | Ga0070662_100152700 | Ga0070662_1001527001 | 129 |
| 143 | 3300005457 | Ga0070662_100837666 | Ga0070662_1008376661 | 129 |
| 144 | 3300005467 | Ga0070706_100113839 | Ga0070706_1001138394 | 129 |
| 145 | 3300005467 | Ga0070706_100794931 | Ga0070706_1007949311 | 129 |
| 146 | 3300005468 | Ga0070707_100399861 | Ga0070707_1003998612 | 129 |
| 147 | 3300005471 | Ga0070698_100935847 | Ga0070698_1009358471 | 129 |
| 148 | 3300005536 | Ga0070697_100671859 | Ga0070697_1006718593 | 129 |
| 149 | 3300005614 | Ga0068856_101564875 | Ga0068856_1015648752 | 129 |
| 150 | 3300005618 | Ga0068864_101614931 | Ga0068864_1016149311 | 129 |
| 151 | 3300005840 | Ga0068870_10707639 | Ga0068870_107076391 | 129 |
| 152 | 3300006186 | Ga0075369_10037044 | Ga0075369_100370442 | 129 |
| 153 | 3300006358 | Ga0068871_100854172 | Ga0068871_1008541722 | 129 |
| 154 | 3300009093 | Ga0105240_10046484 | Ga0105240_100464843 | 129 |
| 155 | 3300009094 | Ga0111539_12673234 | Ga0111539_126732342 | 129 |
| 156 | 3300011119 | Ga0105246_11319133 | Ga0105246_113191332 | 129 |
| 157 | 3300013104 | Ga0157370_10004509 | Ga0157370_1000450911 | 129 |
| 158 | 3300014326 | Ga0157380_10266441 | Ga0157380_102664412 | 129 |
| 159 | 3300014326 | Ga0157380_11381974 | Ga0157380_113819742 | 129 |
| 160 | 3300017792 | Ga0163161_10049380 | Ga0163161_100493804 | 129 |
| 161 | 3300021361 | Ga0213872_10317371 | Ga0213872_103173711 | 129 |
| 162 | 3300025903 | Ga0207680_10187096 | Ga0207680_101870962 | 129 |
| 163 | 3300025913 | Ga0207695_10014762 | Ga0207695_100147626 | 129 |
| 164 | 3300025918 | Ga0207662_10058513 | Ga0207662_100585132 | 129 |
| 165 | 3300025919 | Ga0207657_10081868 | Ga0207657_100818684 | 129 |
| 166 | 3300025923 | Ga0207681_10448901 | Ga0207681_104489011 | 129 |
| 167 | 3300025926 | Ga0207659_10126207 | Ga0207659_101262073 | 129 |
| 168 | 3300025929 | Ga0207664_11761193 | Ga0207664_117611931 | 129 |
| 169 | 3300025931 | Ga0207644_10075600 | Ga0207644_100756002 | 129 |
| 170 | 3300025932 | Ga0207690_10416246 | Ga0207690_104162463 | 129 |
| 171 | 3300025933 | Ga0207706_10213289 | Ga0207706_102132891 | 129 |
| 172 | 3300025949 | Ga0207667_11956587 | Ga0207667_119565872 | 129 |
| 173 | 3300026088 | Ga0207641_10136327 | Ga0207641_101363273 | 129 |
| 174 | 3300026095 | Ga0207676_11316159 | Ga0207676_113161592 | 129 |
| 175 | 3300027907 | Ga0207428_10938364 | Ga0207428_109383641 | 129 |
| 176 | 3300031251 | Ga0265327_10000934 | Ga0265327_1000093416 | 129 |
| 177 | 3300031251 | Ga0265327_10003535 | Ga0265327_1000353511 | 129 |
| 178 | 3300031344 | Ga0265316_10000186 | Ga0265316_1000018628 | 129 |
| 179 | 3300031344 | Ga0265316_11052474 | Ga0265316_110524741 | 129 |
| 180 | 3300032133 | Ga0316583_10084032 | Ga0316583_100840322 | 129 |
| 181 | 3300035691 | Ga0373931_0945857 | Ga0373931_0945857_125_514 | 129 |
| 182 | 3300037418 | Ga0395900_1737448 | Ga0395900_1737448_86_475 | 129 |
| 183 | 3300038443 | Ga0395901_0730375 | Ga0395901_0730375_198_587 | 129 |
| 184 | 3300039447 | Ga0436361_0455484 | Ga0436361_0455484_4274_4663 | 129 |
| 185 | 3300041512 | Ga0451853_0122655 | Ga0451853_0122655_83_472 | 129 |
| 186 | 3300042876 | Ga0451577_0847555 | Ga0451577_0847555_173_562 | 129 |
| 187 | 3300048903 | Ga0496100_1377046 | Ga0496100_1377046_138_527 | 129 |
| 188 | 3300048904 | Ga0496101_0528749 | Ga0496101_0528749_435_824 | 129 |
| 189 | 3300048911 | Ga0496108_0058563 | Ga0496108_0058563_1845_2234 | 129 |
| 190 | 3300048912 | Ga0496109_0140133 | Ga0496109_0140133_247_636 | 129 |
| 191 | 3300048913 | Ga0496110_0597026 | Ga0496110_0597026_522_911 | 129 |
| 192 | 3300048917 | Ga0496114_0154106 | Ga0496114_0154106_321_710 | 129 |
| 193 | 3300048919 | Ga0496116_0361975 | Ga0496116_0361975_223_621 | 129 |
| 194 | 3300048921 | Ga0496118_0022743 | Ga0496118_0022743_461_850 | 129 |
| 195 | 3300048922 | Ga0496119_0004596 | Ga0496119_0004596_3788_4177 | 129 |
| 196 | 3300048923 | Ga0496120_0009252 | Ga0496120_0009252_2872_3261 | 129 |
| 197 | 3300048924 | Ga0496121_0000314 | Ga0496121_0000314_69739_70128 | 129 |
| 198 | 3300048924 | Ga0496121_0053762 | Ga0496121_0053762_1191_1580 | 129 |
| 199 | 3300048925 | Ga0496122_0061908 | Ga0496122_0061908_1195_1584 | 129 |
| 200 | 3300048926 | Ga0496123_0179480 | Ga0496123_0179480_204_593 | 129 |
| 201 | 3300048927 | Ga0496124_0257166 | Ga0496124_0257166_797_1186 | 129 |
| 202 | 3300048928 | Ga0496125_0000028 | Ga0496125_0000028_99151_99540 | 129 |
| 203 | 3300048928 | Ga0496125_0099269 | Ga0496125_0099269_495_884 | 129 |
| 204 | 3300048929 | Ga0496126_0216859 | Ga0496126_0216859_224_613 | 129 |
| 205 | 3300049568 | Ga0501031_0060693 | Ga0501031_0060693_429_818 | 129 |
| 206 | 3300049569 | Ga0501032_0000993 | Ga0501032_0000993_9330_9719 | 129 |
| 207 | 3300049569 | Ga0501032_0001682 | Ga0501032_0001682_15741_16130 | 129 |
| 208 | 3300049569 | Ga0501032_0360403 | Ga0501032_0360403_527_916 | 129 |
| 209 | 3300049570 | Ga0501033_0003258 | Ga0501033_0003258_4339_4728 | 129 |
| 210 | 3300049572 | Ga0501036_0001944 | Ga0501036_0001944_1875_2264 | 129 |
| 211 | 3300049572 | Ga0501036_0009398 | Ga0501036_0009398_2026_2415 | 129 |
| 212 | 3300049574 | Ga0501038_0071422 | Ga0501038_0071422_674_1063 | 129 |
| 213 | 3300049574 | Ga0501038_0089678 | Ga0501038_0089678_164_553 | 129 |
| 214 | 3300049575 | Ga0501039_0023206 | Ga0501039_0023206_3755_4144 | 129 |
| 215 | 3300049579 | Ga0501043_0021786 | Ga0501043_0021786_2091_2480 | 129 |
| 216 | 3300049579 | Ga0501043_0117112 | Ga0501043_0117112_981_1370 | 129 |
| 217 | 3300049579 | Ga0501043_0873377 | Ga0501043_0873377_84_473 | 129 |
| 218 | 3300049580 | Ga0501046_0117467 | Ga0501046_0117467_1403_1792 | 129 |
| 219 | 3300049580 | Ga0501046_0759128 | Ga0501046_0759128_205_594 | 129 |
| 220 | 3300049822 | Ga0501035_0000737 | Ga0501035_0000737_26472_26861 | 129 |
| 221 | 3300049822 | Ga0501035_0022150 | Ga0501035_0022150_3146_3535 | 129 |
| 222 | 3300049822 | Ga0501035_0077894 | Ga0501035_0077894_32_421 | 129 |
| 223 | 3300049822 | Ga0501035_0862223 | Ga0501035_0862223_85_474 | 129 |
| 224 | 3300049823 | Ga0501044_0001132 | Ga0501044_0001132_29346_29735 | 129 |
| 225 | 3300049823 | Ga0501044_0034091 | Ga0501044_0034091_2395_2784 | 129 |
| 226 | 3300050511 | nmdc:mga08y16_434486_c1 | nmdc:mga08y16_434486_c1_168_557 | 129 |
| 227 | 3300050516 | nmdc:mga0sz30_79261_c1 | nmdc:mga0sz30_79261_c1_492_881 | 129 |
| 228 | 3300053125 | Ga0500618_046851 | Ga0500618_046851_504_893 | 129 |
| 229 | 3300031251 | Ga0265327_10214791 | Ga0265327_102147911 | 130 |
| 230 | 3300031852 | Ga0307410_10220097 | Ga0307410_102200973 | 130 |
| 231 | 3300032126 | Ga0307415_100306444 | Ga0307415_1003064443 | 130 |
| 232 | 3300003187 | JGI25151J46595_10000615 | JGI25151J46595_100006154 | 131 |
| 233 | 3300003322 | rootL2_10062710 | rootL2_100627103 | 131 |
| 234 | 3300005328 | Ga0070676_10135599 | Ga0070676_101355992 | 131 |
| 235 | 3300005333 | Ga0070677_10690673 | Ga0070677_106906731 | 131 |
| 236 | 3300005335 | Ga0070666_10698658 | Ga0070666_106986582 | 131 |
| 237 | 3300005338 | Ga0068868_100521603 | Ga0068868_1005216032 | 131 |
| 238 | 3300005347 | Ga0070668_100148676 | Ga0070668_1001486763 | 131 |
| 239 | 3300005353 | Ga0070669_101441533 | Ga0070669_1014415332 | 131 |
| 240 | 3300005364 | Ga0070673_100320037 | Ga0070673_1003200371 | 131 |
| 241 | 3300005457 | Ga0070662_100934071 | Ga0070662_1009340712 | 131 |
| 242 | 3300005536 | Ga0070697_100288559 | Ga0070697_1002885592 | 131 |
| 243 | 3300005543 | Ga0070672_100283512 | Ga0070672_1002835122 | 131 |
| 244 | 3300005548 | Ga0070665_100205712 | Ga0070665_1002057122 | 131 |
| 245 | 3300005563 | Ga0068855_100379318 | Ga0068855_1003793182 | 131 |
| 246 | 3300005564 | Ga0070664_100746811 | Ga0070664_1007468112 | 131 |
| 247 | 3300005841 | Ga0068863_100191053 | Ga0068863_1001910532 | 131 |
| 248 | 3300005844 | Ga0068862_100271470 | Ga0068862_1002714702 | 131 |
| 249 | 3300006051 | Ga0075364_10498977 | Ga0075364_104989772 | 131 |
| 250 | 3300006353 | Ga0075370_10173146 | Ga0075370_101731463 | 131 |
| 251 | 3300006358 | Ga0068871_100841563 | Ga0068871_1008415632 | 131 |
| 252 | 3300006844 | Ga0075428_101252243 | Ga0075428_1012522432 | 131 |
| 253 | 3300006871 | Ga0075434_101032061 | Ga0075434_1010320612 | 131 |
| 254 | 3300009147 | Ga0114129_12344175 | Ga0114129_123441751 | 131 |
| 255 | 3300010375 | Ga0105239_10430398 | Ga0105239_104303982 | 131 |
| 256 | 3300013104 | Ga0157370_11923579 | Ga0157370_119235791 | 131 |
| 257 | 3300013308 | Ga0157375_10616490 | Ga0157375_106164902 | 131 |
| 258 | 3300014968 | Ga0157379_11403292 | Ga0157379_114032922 | 131 |
| 259 | 3300020081 | Ga0206354_10638157 | Ga0206354_106381572 | 131 |
| 260 | 3300025228 | Ga0209672_101446 | Ga0209672_1014461 | 131 |
| 261 | 3300025272 | Ga0209455_1000398 | Ga0209455_100039823 | 131 |
| 262 | 3300025292 | Ga0209676_1034636 | Ga0209676_10346362 | 131 |
| 263 | 3300025294 | Ga0209025_1000055 | Ga0209025_1000055166 | 131 |
| 264 | 3300025298 | Ga0209050_1008665 | Ga0209050_10086653 | 131 |
| 265 | 3300025303 | Ga0209051_1041026 | Ga0209051_10410263 | 131 |
| 266 | 3300025920 | Ga0207649_11246589 | Ga0207649_112465892 | 131 |
| 267 | 3300025923 | Ga0207681_11281656 | Ga0207681_112816561 | 131 |
| 268 | 3300025931 | Ga0207644_10723925 | Ga0207644_107239252 | 131 |
| 269 | 3300025933 | Ga0207706_10861104 | Ga0207706_108611042 | 131 |
| 270 | 3300025940 | Ga0207691_10283547 | Ga0207691_102835472 | 131 |
| 271 | 3300025941 | Ga0207711_11809879 | Ga0207711_118098792 | 131 |
| 272 | 3300025972 | Ga0207668_10438405 | Ga0207668_104384051 | 131 |
| 273 | 3300025986 | Ga0207658_10130751 | Ga0207658_101307512 | 131 |
| 274 | 3300026035 | Ga0207703_10419295 | Ga0207703_104192952 | 131 |
| 275 | 3300026041 | Ga0207639_11382979 | Ga0207639_113829791 | 131 |
| 276 | 3300028573 | Ga0265334_10000034 | Ga0265334_1000003412 | 131 |
| 277 | 3300030500 | Ga0268256_1008408 | Ga0268256_10084083 | 131 |
| 278 | 3300031239 | Ga0265328_10000501 | Ga0265328_1000050116 | 131 |
| 279 | 3300031239 | Ga0265328_10046456 | Ga0265328_100464562 | 131 |
| 280 | 3300031250 | Ga0265331_10000121 | Ga0265331_100001213 | 131 |
| 281 | 3300031250 | Ga0265331_10008717 | Ga0265331_100087172 | 131 |
| 282 | 3300031250 | Ga0265331_10029420 | Ga0265331_100294202 | 131 |
| 283 | 3300031250 | Ga0265331_10214285 | Ga0265331_102142852 | 131 |
| 284 | 3300031251 | Ga0265327_10000269 | Ga0265327_100002693 | 131 |
| 285 | 3300031251 | Ga0265327_10000706 | Ga0265327_1000070660 | 131 |
| 286 | 3300031251 | Ga0265327_10020068 | Ga0265327_100200682 | 131 |
| 287 | 3300031251 | Ga0265327_10032676 | Ga0265327_100326761 | 131 |
| 288 | 3300031251 | Ga0265327_10089878 | Ga0265327_100898783 | 131 |
| 289 | 3300037418 | Ga0395900_0016999 | Ga0395900_0016999_6938_7333 | 131 |
| 290 | 3300037418 | Ga0395900_0038297 | Ga0395900_0038297_4141_4536 | 131 |
| 291 | 3300037471 | Ga0395905_0391559 | Ga0395905_0391559_157_552 | 131 |
| 292 | 3300038443 | Ga0395901_0031209 | Ga0395901_0031209_4106_4501 | 131 |
| 293 | 3300038443 | Ga0395901_0309907 | Ga0395901_0309907_606_1001 | 131 |
| 294 | 3300048927 | Ga0496124_0110024 | Ga0496124_0110024_571_966 | 131 |
| 295 | 3300049569 | Ga0501032_0001947 | Ga0501032_0001947_4940_5386 | 131 |
| 296 | 3300049569 | Ga0501032_0097657 | Ga0501032_0097657_562_1038 | 131 |
| 297 | 3300049570 | Ga0501033_0001731 | Ga0501033_0001731_16341_16787 | 131 |
| 298 | 3300049570 | Ga0501033_0010351 | Ga0501033_0010351_5857_6333 | 131 |
| 299 | 3300049571 | Ga0501034_0026091 | Ga0501034_0026091_5090_5536 | 131 |
| 300 | 3300049571 | Ga0501034_0026221 | Ga0501034_0026221_1009_1485 | 131 |
| 301 | 3300049571 | Ga0501034_0656729 | Ga0501034_0656729_492_887 | 131 |
| 302 | 3300049572 | Ga0501036_0000142 | Ga0501036_0000142_9012_9458 | 131 |
| 303 | 3300049573 | Ga0501037_0000670 | Ga0501037_0000670_11639_12085 | 131 |
| 304 | 3300049573 | Ga0501037_0071264 | Ga0501037_0071264_51_446 | 131 |
| 305 | 3300049574 | Ga0501038_0001606 | Ga0501038_0001606_8175_8621 | 131 |
| 306 | 3300049574 | Ga0501038_0367426 | Ga0501038_0367426_299_694 | 131 |
| 307 | 3300049578 | Ga0501042_0600571 | Ga0501042_0600571_248_694 | 131 |
| 308 | 3300049579 | Ga0501043_0001095 | Ga0501043_0001095_10962_11408 | 131 |
| 309 | 3300049580 | Ga0501046_0003542 | Ga0501046_0003542_2255_2701 | 131 |
| 310 | 3300049581 | Ga0501047_0002544 | Ga0501047_0002544_7280_7726 | 131 |
| 311 | 3300049581 | Ga0501047_0010522 | Ga0501047_0010522_7107_7583 | 131 |
| 312 | 3300049776 | Ga0501280_000920 | Ga0501280_000920_5290_5688 | 131 |
| 313 | 3300049822 | Ga0501035_0004300 | Ga0501035_0004300_2295_2741 | 131 |
| 314 | 3300049822 | Ga0501035_0011764 | Ga0501035_0011764_5917_6393 | 131 |
| 315 | 3300049822 | Ga0501035_0017152 | Ga0501035_0017152_657_1052 | 131 |
| 316 | 3300049822 | Ga0501035_0039883 | Ga0501035_0039883_3397_3792 | 131 |
| 317 | 3300049823 | Ga0501044_0000022 | Ga0501044_0000022_56072_56467 | 131 |
| 318 | 3300049823 | Ga0501044_0000825 | Ga0501044_0000825_7827_8273 | 131 |
| 319 | 3300049823 | Ga0501044_0002899 | Ga0501044_0002899_2145_2621 | 131 |
| 320 | 3300049823 | Ga0501044_0309918 | Ga0501044_0309918_514_909 | 131 |
| 321 | 3300050491 | nmdc:mga00v17_406308_c1 | nmdc:mga00v17_406308_c1_253_648 | 131 |
| 322 | 3300050507 | nmdc:mga05p37_1490804_c1 | nmdc:mga05p37_1490804_c1_66_461 | 131 |
| 323 | 3300050511 | nmdc:mga08y16_2167395_c1 | nmdc:mga08y16_2167395_c1_22_417 | 131 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6bnz-assembly1.cif.gz_A | crystal structure of e144q-glyoxalase i mutant from zea mays in space group p4(1)2(1)2 | 0.9866 | 2 | 126 |
| 6bnx-assembly1.cif.gz_A | crystal structure of v278e-glyoxalase i mutant from zea mays in space group p6(3) | 0.9792 | 2 | 126 |
| 5d7z-assembly1.cif.gz_A | crystal structure of glyoxalase i from zea mays | 0.978 | 2 | 126 |
| 4mtr-assembly1.cif.gz_B | zn-bound gloa2 | 0.9766 | 1 | 127 |
| 4mtr-assembly1.cif.gz_A | zn-bound gloa2 | 0.9765 | 1 | 127 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1X7YDR8_31_97_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9872 | 1 | 59 | 3.10.180.10 |
| af_Q948T6_1_150_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9807 | 1 | 127 | 3.10.180.10 |
| 4mtrB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9766 | 1 | 127 | 3.10.180.10 |
| 4mtrB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9685 | 1 | 127 | 3.10.180.10 |
| af_A0A0R0LFH0_212_347_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9572 | 1 | 126 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-E5AL41-F1-model_v4 | lactoylglutathione lyase (EC 4.4.1.5) (Aldoketomutase) (Glyoxalase I) (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) | 1.002 | 1 | 126 |
GO:0004462
GO:0005737 GO:0019243 GO:0046872 |
| AF-A0A653VI79-F1-model_v4 | Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) | 1.002 | 1 | 62 |
GO:0004462
GO:0005737 GO:0019243 GO:0046872 |
| AF-W0SMA4-F1-model_v4 | Lactoylglutathione lyase (EC 4.4.1.5) (Glyoxalase I) | 1.001 | 1 | 127 |
GO:0004462
GO:0005737 GO:0019243 GO:0046872 |
| AF-Q2SDH5-F1-model_v4 | lactoylglutathione lyase (EC 4.4.1.5) (Aldoketomutase) (Glyoxalase I) (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) | 1.001 | 1 | 126 |
GO:0004462
GO:0005737 GO:0019243 GO:0046872 |
| AF-A0A6S6XWX3-F1-model_v4 | Lactoylglutathione lyase (EC 4.4.1.5) (Glyoxalase I) | 1.001 | 1 | 126 |
GO:0004462
GO:0005737 GO:0019243 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar