F407096

General Info

Members Datasets Scaffolds Average Seq Length
323 225 306 131

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0097657|Ga0501032_0097657_562_1038
Length 158
Sequence MGDAPSRTLCRRGIPRPVTIRQLKEIIMRLLHTMLRVGNLDRSIDFYTNVLGMRLLRRKDYPDGKFTLAFVGYQDESEGAVLELTHNWDTDRYELGNAFGHIAVDVPDAYEACDRVRERGGKVTREAGPMKHGTTVIAFVEDPDGYKIEFIQKGTQKD

Samples

Sample ID Description Type Environment
1 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
2 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
3 2643221569 Achromobacter sp. Root565 Isolate Unclassified
4 2643221594 Achromobacter sp. Root170 Isolate Unclassified
5 2643221621 Achromobacter sp. Root83 Isolate Unclassified
6 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
7 2855730933 Achromobacter sp. HZ28 Isolate Nodule
8 2855767633 Achromobacter sp. HZ34 Isolate Nodule
9 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
10 2858950400 Achromobacter sp. K91 Isolate Unclassified
11 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
12 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
13 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
14 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
15 2904504865 Serratia marcescens 1822 Isolate Unclassified
16 2941479691
17 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
164 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
165 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
219 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
220 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
221 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
222 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
223 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
224 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
225 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.12
Metatranscriptomes 0.62
Isolates 5.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.29
Nodule 0.93
Rhizoplane 2.79
Rhizosphere 78.33
Stem 0
Stem Tuber 0
Unclassified 8.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000615 3300003187 Bacteria 31195
2 rootL2_10062710 3300003322 Bacteria 5008
3 Ga0055532_1003036 3300003758 Bacteria 3106
4 Ga0055529_1000561 3300003763 Bacteria 30975
5 Ga0055528_1002578 3300003790 Bacteria 9599
6 Ga0058692_1002896 3300003856 Bacteria 5553
7 Ga0070676_10043699 3300005328 Bacteria 2605
8 Ga0070676_10135599 3300005328 Bacteria 1561
9 Ga0070690_100020852 3300005330 Bacteria 3996
10 Ga0070677_10690673 3300005333 Bacteria 574
11 Ga0068869_100000049 3300005334 Bacteria 50658
12 Ga0070666_10698658 3300005335 Bacteria 744
13 Ga0068868_100025761 3300005338 Bacteria 4477
14 Ga0068868_100521603 3300005338 Bacteria 1043
15 Ga0070660_100146351 3300005339 Bacteria 1898
16 Ga0070689_100058612 3300005340 Bacteria 2990
17 Ga0070687_100115956 3300005343 Bacteria 1524
18 Ga0070687_100166187 3300005343 Bacteria 1309
19 Ga0070692_10125740 3300005345 Bacteria 1435
20 Ga0070668_100148676 3300005347 Bacteria 1893
21 Ga0070669_101441533 3300005353 Bacteria 598
22 Ga0070674_100198143 3300005356 Bacteria 1549
23 Ga0070674_100617240 3300005356 Bacteria 918
24 Ga0070673_100173552 3300005364 Bacteria 1841
25 Ga0070673_100320037 3300005364 Bacteria 1370
26 Ga0070688_100242777 3300005365 Bacteria 1279
27 Ga0070659_100338734 3300005366 Bacteria 1260
28 Ga0070701_10006693 3300005438 Bacteria 4866
29 Ga0070701_10957496 3300005438 Bacteria 594
30 Ga0070705_100007749 3300005440 Bacteria 5301
31 Ga0070700_100000172 3300005441 Bacteria 36746
32 Ga0070700_100527597 3300005441 Bacteria 913
33 Ga0070694_100177095 3300005444 Bacteria 1575
34 Ga0070708_100158267 3300005445 Bacteria 2110
35 Ga0070678_101616064 3300005456 Bacteria 609
36 Ga0070678_101690204 3300005456 Bacteria 595
37 Ga0070662_100152700 3300005457 Bacteria 1799
38 Ga0070662_100837666 3300005457 Bacteria 783
39 Ga0070662_100934071 3300005457 Bacteria 741
40 Ga0068867_100027676 3300005459 Bacteria 4077
41 Ga0070685_10261826 3300005466 Bacteria 1150
42 Ga0070706_100113839 3300005467 Bacteria 2519
43 Ga0070706_100794931 3300005467 Bacteria 876
44 Ga0070707_100399861 3300005468 Bacteria 1334
45 Ga0070698_100935847 3300005471 Bacteria 813
46 Ga0070697_100288559 3300005536 Bacteria 1409
47 Ga0070697_100671859 3300005536 Bacteria 913
48 Ga0068853_100468292 3300005539 Bacteria 1187
49 Ga0070672_100283512 3300005543 Bacteria 1401
50 Ga0070686_100000603 3300005544 Bacteria 21221
51 Ga0070695_100007775 3300005545 Bacteria 6351
52 Ga0070696_100004853 3300005546 Bacteria 8985
53 Ga0070693_100040479 3300005547 Bacteria 2616
54 Ga0070665_100205712 3300005548 Bacteria 1969
55 Ga0068855_100379318 3300005563 Bacteria 1553
56 Ga0070664_100746811 3300005564 Bacteria 913
57 Ga0068856_101046613 3300005614 Bacteria 834
58 Ga0068856_101564875 3300005614 Bacteria 673
59 Ga0070702_100069419 3300005615 Bacteria 2076
60 Ga0068864_101614931 3300005618 Bacteria 652
61 Ga0068866_10003682 3300005718 Bacteria 6279
62 Ga0068861_100022421 3300005719 Bacteria 4549
63 Ga0068870_10014318 3300005840 Bacteria 3745
64 Ga0068870_10707639 3300005840 Bacteria 695
65 Ga0068863_100191053 3300005841 Bacteria 1968
66 Ga0068858_100000973 3300005842 Bacteria 29642
67 Ga0068860_100009793 3300005843 Bacteria 9512
68 Ga0068862_100011372 3300005844 Bacteria 7349
69 Ga0068862_100271470 3300005844 Bacteria 1551
70 Ga0075364_10498977 3300006051 Bacteria 832
71 Ga0075369_10037044 3300006186 Bacteria 2077
72 Ga0097621_100000366 3300006237 Bacteria 31321
73 Ga0075370_10173146 3300006353 Bacteria 1269
74 Ga0068871_100841563 3300006358 Bacteria 848
75 Ga0068871_100854172 3300006358 Bacteria 841
76 Ga0075428_101252243 3300006844 Bacteria 781
77 Ga0075430_101421854 3300006846 Bacteria 570
78 Ga0075434_101032061 3300006871 Bacteria 836
79 Ga0068865_100000303 3300006881 Bacteria 27172
80 Ga0105240_10046484 3300009093 Bacteria 5500
81 Ga0111539_12673234 3300009094 Bacteria 579
82 Ga0114129_12344175 3300009147 Bacteria 640
83 Ga0105239_10430398 3300010375 Bacteria 1496
84 Ga0105246_11319133 3300011119 Bacteria 670
85 Ga0157370_10004509 3300013104 Bacteria 15960
86 Ga0157370_11923579 3300013104 Bacteria 531
87 Ga0157375_10616490 3300013308 Bacteria 1243
88 Ga0157380_10266441 3300014326 Bacteria 1559
89 Ga0157380_11381974 3300014326 Bacteria 754
90 Ga0157379_11403292 3300014968 Bacteria 677
91 Ga0182007_10071247 3300015262 Bacteria 1139
92 Ga0163161_10049380 3300017792 Bacteria 3041
93 Ga0206354_10638157 3300020081 Bacteria 822
94 Ga0206353_11743754 3300020082 Bacteria 1621
95 Ga0213872_10317371 3300021361 Bacteria 644
96 Ga0209672_100046 3300025228 Bacteria 264244
97 Ga0209672_101446 3300025228 Bacteria 8496
98 Ga0209147_100043 3300025229 Bacteria 300460
99 Ga0209258_100023 3300025242 Bacteria 547286
100 Ga0209148_1000029 3300025254 Bacteria 579199
101 Ga0209148_1000353 3300025254 Bacteria 59341
102 Ga0209565_1022149 3300025263 Bacteria 1319
103 Ga0209455_1000064 3300025272 Bacteria 332404
104 Ga0209455_1000398 3300025272 Bacteria 37150
105 Ga0209673_1000115 3300025273 Bacteria 176939
106 Ga0209675_1039522 3300025291 Bacteria 1044
107 Ga0209676_1034636 3300025292 Bacteria 1491
108 Ga0209025_1000055 3300025294 Bacteria 316748
109 Ga0209050_1008665 3300025298 Bacteria 5370
110 Ga0209051_1041026 3300025303 Bacteria 1652
111 Ga0207642_10002519 3300025899 Bacteria 5707
112 Ga0207680_10187096 3300025903 Bacteria 1403
113 Ga0207680_10543041 3300025903 Bacteria 830
114 Ga0207643_10002271 3300025908 Bacteria 10467
115 Ga0207695_10014762 3300025913 Bacteria 9231
116 Ga0207662_10058513 3300025918 Bacteria 2307
117 Ga0207657_10081868 3300025919 Bacteria 2710
118 Ga0207649_11246589 3300025920 Bacteria 588
119 Ga0207652_11350385 3300025921 Bacteria 616
120 Ga0207681_10448901 3300025923 Bacteria 1049
121 Ga0207681_11281656 3300025923 Bacteria 615
122 Ga0207659_10126207 3300025926 Bacteria 1968
123 Ga0207664_11761193 3300025929 Bacteria 542
124 Ga0207644_10075600 3300025931 Bacteria 2475
125 Ga0207644_10723925 3300025931 Bacteria 830
126 Ga0207690_10416246 3300025932 Bacteria 1074
127 Ga0207706_10213289 3300025933 Bacteria 1692
128 Ga0207706_10861104 3300025933 Bacteria 767
129 Ga0207686_10001851 3300025934 Bacteria 11747
130 Ga0207709_10005925 3300025935 Bacteria 6896
131 Ga0207670_10017311 3300025936 Bacteria 4356
132 Ga0207669_10910181 3300025937 Bacteria 735
133 Ga0207704_10001040 3300025938 Bacteria 12321
134 Ga0207691_10283547 3300025940 Bacteria 1425
135 Ga0207711_10305771 3300025941 Bacteria 1467
136 Ga0207711_11809879 3300025941 Bacteria 554
137 Ga0207689_10000156 3300025942 Bacteria 59034
138 Ga0207667_11956587 3300025949 Bacteria 547
139 Ga0207668_10438405 3300025972 Bacteria 1112
140 Ga0207658_10130751 3300025986 Bacteria 2017
141 Ga0207677_10510835 3300026023 Bacteria 1041
142 Ga0207703_10251798 3300026035 Bacteria 1592
143 Ga0207703_10419295 3300026035 Bacteria 1245
144 Ga0207639_11382979 3300026041 Bacteria 661
145 Ga0207708_10000176 3300026075 Bacteria 50684
146 Ga0207641_10136327 3300026088 Bacteria 2209
147 Ga0207648_10155359 3300026089 Bacteria 2020
148 Ga0207648_10393099 3300026089 Bacteria 1255
149 Ga0207676_11316159 3300026095 Bacteria 717
150 Ga0207675_100000084 3300026118 Bacteria 74312
151 Ga0207683_10071005 3300026121 Bacteria 3077
152 Ga0209371_1000065 3300027312 Bacteria 214464
153 Ga0207428_10938364 3300027907 Bacteria 610
154 Ga0268265_10070983 3300028380 Bacteria 2710
155 Ga0268264_10009264 3300028381 Bacteria 8152
156 Ga0265334_10000034 3300028573 Bacteria 105710
157 Ga0268256_1000118 3300030500 Bacteria 115175
158 Ga0268256_1008408 3300030500 Bacteria 3538
159 Ga0265332_10002163 3300031238 Bacteria 10131
160 Ga0265328_10000501 3300031239 Bacteria 18180
161 Ga0265328_10046456 3300031239 Bacteria 1596
162 Ga0265331_10000121 3300031250 Bacteria 102519
163 Ga0265331_10008717 3300031250 Bacteria 5747
164 Ga0265331_10029420 3300031250 Bacteria 2742
165 Ga0265331_10214285 3300031250 Bacteria 866
166 Ga0265327_10000269 3300031251 Bacteria 102772
167 Ga0265327_10000706 3300031251 Bacteria 52819
168 Ga0265327_10000934 3300031251 Bacteria 42807
169 Ga0265327_10003535 3300031251 Bacteria 14809
170 Ga0265327_10020068 3300031251 Bacteria 4086
171 Ga0265327_10032676 3300031251 Bacteria 2909
172 Ga0265327_10089878 3300031251 Bacteria 1499
173 Ga0265327_10214791 3300031251 Bacteria 867
174 Ga0265316_10000186 3300031344 Bacteria 71372
175 Ga0265316_11052474 3300031344 Bacteria 565
176 Ga0265313_10100120 3300031595 Bacteria 1287
177 Ga0316578_10357971 3300031728 Bacteria 868
178 Ga0307410_10220097 3300031852 Bacteria 1460
179 Ga0307415_100306444 3300032126 Bacteria 1318
180 Ga0316583_10084032 3300032133 Bacteria 1112
181 Ga0373955_0972770 3300035172 Bacteria 523
182 Ga0373931_0945857 3300035691 Bacteria 581
183 Ga0373927_0098515 3300035695 Bacteria 1901
184 Ga0373933_0098389 3300035724 Bacteria 1813
185 Ga0395900_0016999 3300037418 Bacteria 7424
186 Ga0395900_0038297 3300037418 Bacteria 4942
187 Ga0395900_1737448 3300037418 Bacteria 535
188 Ga0395905_0000014 3300037471 Bacteria 394209
189 Ga0395905_0391559 3300037471 Bacteria 1284
190 Ga0395901_0031209 3300038443 Bacteria 5494
191 Ga0395901_0309907 3300038443 Bacteria 1635
192 Ga0395901_0730375 3300038443 Bacteria 985
193 Ga0400484_26491 3300038725 Bacteria 6602
194 Ga0436361_0455484 3300039447 Bacteria 12588
195 Ga0436361_0970448 3300039447 Bacteria 1085
196 Ga0451853_0122655 3300041512 Bacteria 912
197 Ga0451577_0046809 3300042876 Bacteria 3868
198 Ga0451577_0330194 3300042876 Bacteria 1383
199 Ga0451577_0847555 3300042876 Bacteria 824
200 Ga0466961_0152293 3300044693 Bacteria 1443
201 Ga0453684_0303243 3300044712 Bacteria 1815
202 Ga0466957_0913847 3300044842 Bacteria 628
203 Ga0451576_0039345 3300045051 Bacteria 5005
204 Ga0451576_2047447 3300045051 Bacteria 589
205 Ga0495651_0170734 3300046462 Bacteria 1549
206 Ga0495580_0000541 3300046472 Bacteria 31897
207 Ga0495630_0008419 3300046517 Bacteria 7396
208 Ga0495622_0059122 3300046557 Bacteria 1775
209 Ga0495599_0071256 3300046678 Bacteria 2169
210 Ga0495623_0004680 3300046679 Bacteria 8992
211 Ga0495646_0021743 3300046680 Bacteria 4053
212 Ga0495647_0368540 3300046681 Bacteria 656
213 Ga0495604_0006971 3300047317 Bacteria 8957
214 Ga0495604_0047913 3300047317 Bacteria 3326
215 Ga0495680_0044951 3300047322 Bacteria 3489
216 Ga0495680_0086341 3300047322 Bacteria 2361
217 Ga0495602_0027609 3300048088 Bacteria 5452
218 Ga0495602_0616375 3300048088 Bacteria 744
219 Ga0496100_1377046 3300048903 Bacteria 557
220 Ga0496101_0528749 3300048904 Bacteria 932
221 Ga0496108_0058563 3300048911 Bacteria 3238
222 Ga0496109_0140133 3300048912 Bacteria 2261
223 Ga0496110_0597026 3300048913 Bacteria 1002
224 Ga0496113_0009554 3300048916 Bacteria 6362
225 Ga0496114_0154106 3300048917 Bacteria 1994
226 Ga0496115_0890324 3300048918 Bacteria 687
227 Ga0496116_0361975 3300048919 Bacteria 659
228 Ga0496118_0022743 3300048921 Bacteria 5467
229 Ga0496119_0004596 3300048922 Bacteria 13625
230 Ga0496120_0009252 3300048923 Bacteria 7014
231 Ga0496121_0000314 3300048924 Bacteria 100909
232 Ga0496121_0053762 3300048924 Bacteria 3371
233 Ga0496121_0204025 3300048924 Bacteria 1406
234 Ga0496122_0061908 3300048925 Bacteria 2742
235 Ga0496123_0179480 3300048926 Bacteria 1107
236 Ga0496124_0110024 3300048927 Bacteria 2219
237 Ga0496124_0257166 3300048927 Bacteria 1287
238 Ga0496125_0000028 3300048928 Bacteria 387222
239 Ga0496125_0099269 3300048928 Bacteria 2151
240 Ga0496126_0001519 3300048929 Bacteria 35767
241 Ga0496126_0216859 3300048929 Bacteria 1609
242 Ga0501031_0060693 3300049568 Bacteria 2464
243 Ga0501032_0000993 3300049569 Bacteria 22838
244 Ga0501032_0001682 3300049569 Bacteria 17543
245 Ga0501032_0001947 3300049569 Bacteria 16245
246 Ga0501032_0097657 3300049569 Bacteria 1947
247 Ga0501032_0360403 3300049569 Bacteria 936
248 Ga0501033_0000288 3300049570 Bacteria 48339
249 Ga0501033_0001731 3300049570 Bacteria 19081
250 Ga0501033_0003258 3300049570 Bacteria 13438
251 Ga0501033_0010351 3300049570 Bacteria 7160
252 Ga0501034_0026091 3300049571 Bacteria 5950
253 Ga0501034_0026221 3300049571 Bacteria 5936
254 Ga0501034_0656729 3300049571 Bacteria 950
255 Ga0501036_0000142 3300049572 Bacteria 46404
256 Ga0501036_0001944 3300049572 Bacteria 16036
257 Ga0501036_0009398 3300049572 Bacteria 8043
258 Ga0501037_0000670 3300049573 Bacteria 26232
259 Ga0501037_0045436 3300049573 Bacteria 3225
260 Ga0501037_0071264 3300049573 Bacteria 2528
261 Ga0501038_0001606 3300049574 Bacteria 20982
262 Ga0501038_0071422 3300049574 Bacteria 2944
263 Ga0501038_0089678 3300049574 Bacteria 2578
264 Ga0501038_0367426 3300049574 Bacteria 1118
265 Ga0501039_0023206 3300049575 Bacteria 4761
266 Ga0501042_0600571 3300049578 Bacteria 800
267 Ga0501043_0001095 3300049579 Bacteria 23800
268 Ga0501043_0021786 3300049579 Bacteria 5025
269 Ga0501043_0117112 3300049579 Bacteria 2090
270 Ga0501043_0873377 3300049579 Bacteria 646
271 Ga0501046_0003542 3300049580 Bacteria 14302
272 Ga0501046_0117467 3300049580 Bacteria 2026
273 Ga0501046_0759128 3300049580 Bacteria 681
274 Ga0501047_0002544 3300049581 Bacteria 17375
275 Ga0501047_0010522 3300049581 Bacteria 8750
276 Ga0501047_0031778 3300049581 Bacteria 5093
277 Ga0501047_0445382 3300049581 Bacteria 1125
278 Ga0501280_000920 3300049776 Bacteria 6213
279 Ga0501035_0000737 3300049822 Bacteria 35342
280 Ga0501035_0004300 3300049822 Bacteria 13526
281 Ga0501035_0011764 3300049822 Bacteria 8102
282 Ga0501035_0017152 3300049822 Bacteria 6673
283 Ga0501035_0022150 3300049822 Bacteria 5836
284 Ga0501035_0039883 3300049822 Bacteria 4247
285 Ga0501035_0077894 3300049822 Bacteria 2929
286 Ga0501035_0862223 3300049822 Bacteria 720
287 Ga0501044_0000022 3300049823 Bacteria 201689
288 Ga0501044_0000825 3300049823 Bacteria 37302
289 Ga0501044_0001132 3300049823 Bacteria 31684
290 Ga0501044_0002899 3300049823 Bacteria 19530
291 Ga0501044_0015429 3300049823 Bacteria 8229
292 Ga0501044_0034091 3300049823 Bacteria 5343
293 Ga0501044_0036566 3300049823 Bacteria 5137
294 Ga0501044_0309918 3300049823 Bacteria 1505
295 Ga0501044_0610775 3300049823 Bacteria 983
296 nmdc:mga00v17_406308_c1 3300050491 Bacteria 885
297 nmdc:mga05p37_1490804_c1 3300050507 Bacteria 674
298 nmdc:mga08y16_2167395_c1 3300050511 Bacteria 502
299 nmdc:mga08y16_434486_c1 3300050511 Bacteria 1341
300 nmdc:mga0sz30_79261_c1 3300050516 Bacteria 1420
301 Ga0500607_074253 3300053121 Bacteria 1748
302 Ga0500618_046851 3300053125 Bacteria 984
303 Ga0500559_0015348 3300053136 Bacteria 3235
304 Ga0500636_0005880 3300053177 Bacteria 7030
305 Ga0500637_0219520 3300053178 Bacteria 1075
306 Ga0500625_072518 3300053729 Bacteria 1527

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003763 Ga0055529_1000561 Ga0055529_100056111 127
2 3300003790 Ga0055528_1002578 Ga0055528_10025782 127
3 3300003856 Ga0058692_1002896 Ga0058692_10028962 127
4 3300005356 Ga0070674_100198143 Ga0070674_1001981433 127
5 3300006846 Ga0075430_101421854 Ga0075430_1014218541 127
6 3300015262 Ga0182007_10071247 Ga0182007_100712471 127
7 3300020082 Ga0206353_11743754 Ga0206353_117437541 127
8 3300025228 Ga0209672_100046 Ga0209672_100046180 127
9 3300025229 Ga0209147_100043 Ga0209147_10004384 127
10 3300025242 Ga0209258_100023 Ga0209258_100023284 127
11 3300025254 Ga0209148_1000029 Ga0209148_1000029350 127
12 3300025254 Ga0209148_1000353 Ga0209148_100035339 127
13 3300025263 Ga0209565_1022149 Ga0209565_10221491 127
14 3300025272 Ga0209455_1000064 Ga0209455_100006479 127
15 3300025273 Ga0209673_1000115 Ga0209673_1000115102 127
16 3300025291 Ga0209675_1039522 Ga0209675_10395221 127
17 3300025921 Ga0207652_11350385 Ga0207652_113503852 127
18 3300026089 Ga0207648_10393099 Ga0207648_103930992 127
19 3300027312 Ga0209371_1000065 Ga0209371_100006554 127
20 3300030500 Ga0268256_1000118 Ga0268256_100011854 127
21 3300031728 Ga0316578_10357971 Ga0316578_103579712 127
22 3300035172 Ga0373955_0972770 Ga0373955_0972770_47_430 127
23 3300038725 Ga0400484_26491 Ga0400484_26491_6074_6457 127
24 3300039447 Ga0436361_0970448 Ga0436361_0970448_394_777 127
25 3300044693 Ga0466961_0152293 Ga0466961_0152293_430_813 127
26 3300044842 Ga0466957_0913847 Ga0466957_0913847_97_534 127
27 3300046681 Ga0495647_0368540 Ga0495647_0368540_97_480 127
28 3300048924 Ga0496121_0204025 Ga0496121_0204025_714_1097 127
29 3300049581 Ga0501047_0445382 Ga0501047_0445382_68_451 127
30 3300049823 Ga0501044_0610775 Ga0501044_0610775_127_510 127
31 iso_pu_bacteria 2515154122 2515679480 127
32 iso_pu_bacteria 2599185292 2599905505 127
33 iso_pu_bacteria 2643221569 2643862723 127
34 iso_pu_bacteria 2643221594 2643980268 127
35 iso_pu_bacteria 2643221621 2644124749 127
36 iso_pu_bacteria 2808606395 2809032419 127
37 iso_pu_bacteria 2855730933 2855736292 127
38 iso_pu_bacteria 2855767633 2855773229 127
39 iso_pu_bacteria 2857537821 2857542445 127
40 iso_pu_bacteria 2858950400 2858952796 127
41 iso_pu_bacteria 2881412998 2881417321 127
42 iso_pu_bacteria 2881927736 2881929649 127
43 iso_pu_bacteria 2887375801 2887379843 127
44 iso_pu_bacteria 2902682994 2902689239 127
45 iso_pu_bacteria 2904504865 2904504966 127
46 iso_pu_bacteria 2941479691 2941485170 127
47 iso_pu_bacteria 8002392321 8002393144 127
48 3300005328 Ga0070676_10043699 Ga0070676_100436991 128
49 3300005330 Ga0070690_100020852 Ga0070690_1000208526 128
50 3300005334 Ga0068869_100000049 Ga0068869_1000000496 128
51 3300005338 Ga0068868_100025761 Ga0068868_1000257616 128
52 3300005340 Ga0070689_100058612 Ga0070689_1000586123 128
53 3300005343 Ga0070687_100115956 Ga0070687_1001159563 128
54 3300005345 Ga0070692_10125740 Ga0070692_101257403 128
55 3300005356 Ga0070674_100617240 Ga0070674_1006172403 128
56 3300005365 Ga0070688_100242777 Ga0070688_1002427771 128
57 3300005438 Ga0070701_10006693 Ga0070701_100066931 128
58 3300005440 Ga0070705_100007749 Ga0070705_1000077498 128
59 3300005441 Ga0070700_100000172 Ga0070700_1000001728 128
60 3300005444 Ga0070694_100177095 Ga0070694_1001770951 128
61 3300005456 Ga0070678_101616064 Ga0070678_1016160641 128
62 3300005459 Ga0068867_100027676 Ga0068867_1000276765 128
63 3300005466 Ga0070685_10261826 Ga0070685_102618263 128
64 3300005539 Ga0068853_100468292 Ga0068853_1004682921 128
65 3300005544 Ga0070686_100000603 Ga0070686_1000006038 128
66 3300005545 Ga0070695_100007775 Ga0070695_1000077752 128
67 3300005546 Ga0070696_100004853 Ga0070696_10000485310 128
68 3300005547 Ga0070693_100040479 Ga0070693_1000404794 128
69 3300005614 Ga0068856_101046613 Ga0068856_1010466131 128
70 3300005615 Ga0070702_100069419 Ga0070702_1000694193 128
71 3300005718 Ga0068866_10003682 Ga0068866_100036826 128
72 3300005719 Ga0068861_100022421 Ga0068861_1000224217 128
73 3300005840 Ga0068870_10014318 Ga0068870_100143186 128
74 3300005842 Ga0068858_100000973 Ga0068858_10000097324 128
75 3300005843 Ga0068860_100009793 Ga0068860_1000097931 128
76 3300005844 Ga0068862_100011372 Ga0068862_10001137210 128
77 3300006237 Ga0097621_100000366 Ga0097621_10000036621 128
78 3300006881 Ga0068865_100000303 Ga0068865_10000030324 128
79 3300025899 Ga0207642_10002519 Ga0207642_100025191 128
80 3300025903 Ga0207680_10543041 Ga0207680_105430412 128
81 3300025908 Ga0207643_10002271 Ga0207643_100022719 128
82 3300025934 Ga0207686_10001851 Ga0207686_100018515 128
83 3300025935 Ga0207709_10005925 Ga0207709_100059256 128
84 3300025936 Ga0207670_10017311 Ga0207670_100173115 128
85 3300025937 Ga0207669_10910181 Ga0207669_109101812 128
86 3300025938 Ga0207704_10001040 Ga0207704_1000104015 128
87 3300025941 Ga0207711_10305771 Ga0207711_103057712 128
88 3300025942 Ga0207689_10000156 Ga0207689_1000015639 128
89 3300026023 Ga0207677_10510835 Ga0207677_105108351 128
90 3300026035 Ga0207703_10251798 Ga0207703_102517981 128
91 3300026075 Ga0207708_10000176 Ga0207708_1000017639 128
92 3300026089 Ga0207648_10155359 Ga0207648_101553593 128
93 3300026118 Ga0207675_100000084 Ga0207675_10000008420 128
94 3300026121 Ga0207683_10071005 Ga0207683_100710054 128
95 3300028380 Ga0268265_10070983 Ga0268265_100709835 128
96 3300028381 Ga0268264_10009264 Ga0268264_100092644 128
97 3300031238 Ga0265332_10002163 Ga0265332_100021632 128
98 3300031595 Ga0265313_10100120 Ga0265313_101001202 128
99 3300035695 Ga0373927_0098515 Ga0373927_0098515_138_524 128
100 3300035724 Ga0373933_0098389 Ga0373933_0098389_41_427 128
101 3300037471 Ga0395905_0000014 Ga0395905_0000014_82073_82459 128
102 3300042876 Ga0451577_0046809 Ga0451577_0046809_1747_2133 128
103 3300042876 Ga0451577_0330194 Ga0451577_0330194_329_715 128
104 3300044712 Ga0453684_0303243 Ga0453684_0303243_1019_1405 128
105 3300045051 Ga0451576_0039345 Ga0451576_0039345_1922_2308 128
106 3300045051 Ga0451576_2047447 Ga0451576_2047447_56_442 128
107 3300046462 Ga0495651_0170734 Ga0495651_0170734_610_996 128
108 3300046472 Ga0495580_0000541 Ga0495580_0000541_22731_23117 128
109 3300046517 Ga0495630_0008419 Ga0495630_0008419_5852_6238 128
110 3300046557 Ga0495622_0059122 Ga0495622_0059122_223_609 128
111 3300046678 Ga0495599_0071256 Ga0495599_0071256_1044_1430 128
112 3300046679 Ga0495623_0004680 Ga0495623_0004680_6945_7331 128
113 3300046680 Ga0495646_0021743 Ga0495646_0021743_1625_2011 128
114 3300047317 Ga0495604_0006971 Ga0495604_0006971_6625_7011 128
115 3300047317 Ga0495604_0047913 Ga0495604_0047913_1606_1992 128
116 3300047322 Ga0495680_0044951 Ga0495680_0044951_128_514 128
117 3300047322 Ga0495680_0086341 Ga0495680_0086341_335_721 128
118 3300048088 Ga0495602_0027609 Ga0495602_0027609_3361_3747 128
119 3300048088 Ga0495602_0616375 Ga0495602_0616375_332_718 128
120 3300048916 Ga0496113_0009554 Ga0496113_0009554_2995_3381 128
121 3300048918 Ga0496115_0890324 Ga0496115_0890324_52_438 128
122 3300048929 Ga0496126_0001519 Ga0496126_0001519_32289_32675 128
123 3300049570 Ga0501033_0000288 Ga0501033_0000288_35462_35848 128
124 3300049573 Ga0501037_0045436 Ga0501037_0045436_1678_2064 128
125 3300049581 Ga0501047_0031778 Ga0501047_0031778_1880_2266 128
126 3300049823 Ga0501044_0015429 Ga0501044_0015429_4624_5010 128
127 3300049823 Ga0501044_0036566 Ga0501044_0036566_1995_2381 128
128 3300053121 Ga0500607_074253 Ga0500607_074253_25_411 128
129 3300053136 Ga0500559_0015348 Ga0500559_0015348_2136_2522 128
130 3300053177 Ga0500636_0005880 Ga0500636_0005880_6162_6548 128
131 3300053178 Ga0500637_0219520 Ga0500637_0219520_451_837 128
132 3300053729 Ga0500625_072518 Ga0500625_072518_187_573 128
133 3300003758 Ga0055532_1003036 Ga0055532_10030363 129
134 3300005339 Ga0070660_100146351 Ga0070660_1001463512 129
135 3300005343 Ga0070687_100166187 Ga0070687_1001661871 129
136 3300005364 Ga0070673_100173552 Ga0070673_1001735522 129
137 3300005366 Ga0070659_100338734 Ga0070659_1003387342 129
138 3300005438 Ga0070701_10957496 Ga0070701_109574961 129
139 3300005441 Ga0070700_100527597 Ga0070700_1005275972 129
140 3300005445 Ga0070708_100158267 Ga0070708_1001582674 129
141 3300005456 Ga0070678_101690204 Ga0070678_1016902042 129
142 3300005457 Ga0070662_100152700 Ga0070662_1001527001 129
143 3300005457 Ga0070662_100837666 Ga0070662_1008376661 129
144 3300005467 Ga0070706_100113839 Ga0070706_1001138394 129
145 3300005467 Ga0070706_100794931 Ga0070706_1007949311 129
146 3300005468 Ga0070707_100399861 Ga0070707_1003998612 129
147 3300005471 Ga0070698_100935847 Ga0070698_1009358471 129
148 3300005536 Ga0070697_100671859 Ga0070697_1006718593 129
149 3300005614 Ga0068856_101564875 Ga0068856_1015648752 129
150 3300005618 Ga0068864_101614931 Ga0068864_1016149311 129
151 3300005840 Ga0068870_10707639 Ga0068870_107076391 129
152 3300006186 Ga0075369_10037044 Ga0075369_100370442 129
153 3300006358 Ga0068871_100854172 Ga0068871_1008541722 129
154 3300009093 Ga0105240_10046484 Ga0105240_100464843 129
155 3300009094 Ga0111539_12673234 Ga0111539_126732342 129
156 3300011119 Ga0105246_11319133 Ga0105246_113191332 129
157 3300013104 Ga0157370_10004509 Ga0157370_1000450911 129
158 3300014326 Ga0157380_10266441 Ga0157380_102664412 129
159 3300014326 Ga0157380_11381974 Ga0157380_113819742 129
160 3300017792 Ga0163161_10049380 Ga0163161_100493804 129
161 3300021361 Ga0213872_10317371 Ga0213872_103173711 129
162 3300025903 Ga0207680_10187096 Ga0207680_101870962 129
163 3300025913 Ga0207695_10014762 Ga0207695_100147626 129
164 3300025918 Ga0207662_10058513 Ga0207662_100585132 129
165 3300025919 Ga0207657_10081868 Ga0207657_100818684 129
166 3300025923 Ga0207681_10448901 Ga0207681_104489011 129
167 3300025926 Ga0207659_10126207 Ga0207659_101262073 129
168 3300025929 Ga0207664_11761193 Ga0207664_117611931 129
169 3300025931 Ga0207644_10075600 Ga0207644_100756002 129
170 3300025932 Ga0207690_10416246 Ga0207690_104162463 129
171 3300025933 Ga0207706_10213289 Ga0207706_102132891 129
172 3300025949 Ga0207667_11956587 Ga0207667_119565872 129
173 3300026088 Ga0207641_10136327 Ga0207641_101363273 129
174 3300026095 Ga0207676_11316159 Ga0207676_113161592 129
175 3300027907 Ga0207428_10938364 Ga0207428_109383641 129
176 3300031251 Ga0265327_10000934 Ga0265327_1000093416 129
177 3300031251 Ga0265327_10003535 Ga0265327_1000353511 129
178 3300031344 Ga0265316_10000186 Ga0265316_1000018628 129
179 3300031344 Ga0265316_11052474 Ga0265316_110524741 129
180 3300032133 Ga0316583_10084032 Ga0316583_100840322 129
181 3300035691 Ga0373931_0945857 Ga0373931_0945857_125_514 129
182 3300037418 Ga0395900_1737448 Ga0395900_1737448_86_475 129
183 3300038443 Ga0395901_0730375 Ga0395901_0730375_198_587 129
184 3300039447 Ga0436361_0455484 Ga0436361_0455484_4274_4663 129
185 3300041512 Ga0451853_0122655 Ga0451853_0122655_83_472 129
186 3300042876 Ga0451577_0847555 Ga0451577_0847555_173_562 129
187 3300048903 Ga0496100_1377046 Ga0496100_1377046_138_527 129
188 3300048904 Ga0496101_0528749 Ga0496101_0528749_435_824 129
189 3300048911 Ga0496108_0058563 Ga0496108_0058563_1845_2234 129
190 3300048912 Ga0496109_0140133 Ga0496109_0140133_247_636 129
191 3300048913 Ga0496110_0597026 Ga0496110_0597026_522_911 129
192 3300048917 Ga0496114_0154106 Ga0496114_0154106_321_710 129
193 3300048919 Ga0496116_0361975 Ga0496116_0361975_223_621 129
194 3300048921 Ga0496118_0022743 Ga0496118_0022743_461_850 129
195 3300048922 Ga0496119_0004596 Ga0496119_0004596_3788_4177 129
196 3300048923 Ga0496120_0009252 Ga0496120_0009252_2872_3261 129
197 3300048924 Ga0496121_0000314 Ga0496121_0000314_69739_70128 129
198 3300048924 Ga0496121_0053762 Ga0496121_0053762_1191_1580 129
199 3300048925 Ga0496122_0061908 Ga0496122_0061908_1195_1584 129
200 3300048926 Ga0496123_0179480 Ga0496123_0179480_204_593 129
201 3300048927 Ga0496124_0257166 Ga0496124_0257166_797_1186 129
202 3300048928 Ga0496125_0000028 Ga0496125_0000028_99151_99540 129
203 3300048928 Ga0496125_0099269 Ga0496125_0099269_495_884 129
204 3300048929 Ga0496126_0216859 Ga0496126_0216859_224_613 129
205 3300049568 Ga0501031_0060693 Ga0501031_0060693_429_818 129
206 3300049569 Ga0501032_0000993 Ga0501032_0000993_9330_9719 129
207 3300049569 Ga0501032_0001682 Ga0501032_0001682_15741_16130 129
208 3300049569 Ga0501032_0360403 Ga0501032_0360403_527_916 129
209 3300049570 Ga0501033_0003258 Ga0501033_0003258_4339_4728 129
210 3300049572 Ga0501036_0001944 Ga0501036_0001944_1875_2264 129
211 3300049572 Ga0501036_0009398 Ga0501036_0009398_2026_2415 129
212 3300049574 Ga0501038_0071422 Ga0501038_0071422_674_1063 129
213 3300049574 Ga0501038_0089678 Ga0501038_0089678_164_553 129
214 3300049575 Ga0501039_0023206 Ga0501039_0023206_3755_4144 129
215 3300049579 Ga0501043_0021786 Ga0501043_0021786_2091_2480 129
216 3300049579 Ga0501043_0117112 Ga0501043_0117112_981_1370 129
217 3300049579 Ga0501043_0873377 Ga0501043_0873377_84_473 129
218 3300049580 Ga0501046_0117467 Ga0501046_0117467_1403_1792 129
219 3300049580 Ga0501046_0759128 Ga0501046_0759128_205_594 129
220 3300049822 Ga0501035_0000737 Ga0501035_0000737_26472_26861 129
221 3300049822 Ga0501035_0022150 Ga0501035_0022150_3146_3535 129
222 3300049822 Ga0501035_0077894 Ga0501035_0077894_32_421 129
223 3300049822 Ga0501035_0862223 Ga0501035_0862223_85_474 129
224 3300049823 Ga0501044_0001132 Ga0501044_0001132_29346_29735 129
225 3300049823 Ga0501044_0034091 Ga0501044_0034091_2395_2784 129
226 3300050511 nmdc:mga08y16_434486_c1 nmdc:mga08y16_434486_c1_168_557 129
227 3300050516 nmdc:mga0sz30_79261_c1 nmdc:mga0sz30_79261_c1_492_881 129
228 3300053125 Ga0500618_046851 Ga0500618_046851_504_893 129
229 3300031251 Ga0265327_10214791 Ga0265327_102147911 130
230 3300031852 Ga0307410_10220097 Ga0307410_102200973 130
231 3300032126 Ga0307415_100306444 Ga0307415_1003064443 130
232 3300003187 JGI25151J46595_10000615 JGI25151J46595_100006154 131
233 3300003322 rootL2_10062710 rootL2_100627103 131
234 3300005328 Ga0070676_10135599 Ga0070676_101355992 131
235 3300005333 Ga0070677_10690673 Ga0070677_106906731 131
236 3300005335 Ga0070666_10698658 Ga0070666_106986582 131
237 3300005338 Ga0068868_100521603 Ga0068868_1005216032 131
238 3300005347 Ga0070668_100148676 Ga0070668_1001486763 131
239 3300005353 Ga0070669_101441533 Ga0070669_1014415332 131
240 3300005364 Ga0070673_100320037 Ga0070673_1003200371 131
241 3300005457 Ga0070662_100934071 Ga0070662_1009340712 131
242 3300005536 Ga0070697_100288559 Ga0070697_1002885592 131
243 3300005543 Ga0070672_100283512 Ga0070672_1002835122 131
244 3300005548 Ga0070665_100205712 Ga0070665_1002057122 131
245 3300005563 Ga0068855_100379318 Ga0068855_1003793182 131
246 3300005564 Ga0070664_100746811 Ga0070664_1007468112 131
247 3300005841 Ga0068863_100191053 Ga0068863_1001910532 131
248 3300005844 Ga0068862_100271470 Ga0068862_1002714702 131
249 3300006051 Ga0075364_10498977 Ga0075364_104989772 131
250 3300006353 Ga0075370_10173146 Ga0075370_101731463 131
251 3300006358 Ga0068871_100841563 Ga0068871_1008415632 131
252 3300006844 Ga0075428_101252243 Ga0075428_1012522432 131
253 3300006871 Ga0075434_101032061 Ga0075434_1010320612 131
254 3300009147 Ga0114129_12344175 Ga0114129_123441751 131
255 3300010375 Ga0105239_10430398 Ga0105239_104303982 131
256 3300013104 Ga0157370_11923579 Ga0157370_119235791 131
257 3300013308 Ga0157375_10616490 Ga0157375_106164902 131
258 3300014968 Ga0157379_11403292 Ga0157379_114032922 131
259 3300020081 Ga0206354_10638157 Ga0206354_106381572 131
260 3300025228 Ga0209672_101446 Ga0209672_1014461 131
261 3300025272 Ga0209455_1000398 Ga0209455_100039823 131
262 3300025292 Ga0209676_1034636 Ga0209676_10346362 131
263 3300025294 Ga0209025_1000055 Ga0209025_1000055166 131
264 3300025298 Ga0209050_1008665 Ga0209050_10086653 131
265 3300025303 Ga0209051_1041026 Ga0209051_10410263 131
266 3300025920 Ga0207649_11246589 Ga0207649_112465892 131
267 3300025923 Ga0207681_11281656 Ga0207681_112816561 131
268 3300025931 Ga0207644_10723925 Ga0207644_107239252 131
269 3300025933 Ga0207706_10861104 Ga0207706_108611042 131
270 3300025940 Ga0207691_10283547 Ga0207691_102835472 131
271 3300025941 Ga0207711_11809879 Ga0207711_118098792 131
272 3300025972 Ga0207668_10438405 Ga0207668_104384051 131
273 3300025986 Ga0207658_10130751 Ga0207658_101307512 131
274 3300026035 Ga0207703_10419295 Ga0207703_104192952 131
275 3300026041 Ga0207639_11382979 Ga0207639_113829791 131
276 3300028573 Ga0265334_10000034 Ga0265334_1000003412 131
277 3300030500 Ga0268256_1008408 Ga0268256_10084083 131
278 3300031239 Ga0265328_10000501 Ga0265328_1000050116 131
279 3300031239 Ga0265328_10046456 Ga0265328_100464562 131
280 3300031250 Ga0265331_10000121 Ga0265331_100001213 131
281 3300031250 Ga0265331_10008717 Ga0265331_100087172 131
282 3300031250 Ga0265331_10029420 Ga0265331_100294202 131
283 3300031250 Ga0265331_10214285 Ga0265331_102142852 131
284 3300031251 Ga0265327_10000269 Ga0265327_100002693 131
285 3300031251 Ga0265327_10000706 Ga0265327_1000070660 131
286 3300031251 Ga0265327_10020068 Ga0265327_100200682 131
287 3300031251 Ga0265327_10032676 Ga0265327_100326761 131
288 3300031251 Ga0265327_10089878 Ga0265327_100898783 131
289 3300037418 Ga0395900_0016999 Ga0395900_0016999_6938_7333 131
290 3300037418 Ga0395900_0038297 Ga0395900_0038297_4141_4536 131
291 3300037471 Ga0395905_0391559 Ga0395905_0391559_157_552 131
292 3300038443 Ga0395901_0031209 Ga0395901_0031209_4106_4501 131
293 3300038443 Ga0395901_0309907 Ga0395901_0309907_606_1001 131
294 3300048927 Ga0496124_0110024 Ga0496124_0110024_571_966 131
295 3300049569 Ga0501032_0001947 Ga0501032_0001947_4940_5386 131
296 3300049569 Ga0501032_0097657 Ga0501032_0097657_562_1038 131
297 3300049570 Ga0501033_0001731 Ga0501033_0001731_16341_16787 131
298 3300049570 Ga0501033_0010351 Ga0501033_0010351_5857_6333 131
299 3300049571 Ga0501034_0026091 Ga0501034_0026091_5090_5536 131
300 3300049571 Ga0501034_0026221 Ga0501034_0026221_1009_1485 131
301 3300049571 Ga0501034_0656729 Ga0501034_0656729_492_887 131
302 3300049572 Ga0501036_0000142 Ga0501036_0000142_9012_9458 131
303 3300049573 Ga0501037_0000670 Ga0501037_0000670_11639_12085 131
304 3300049573 Ga0501037_0071264 Ga0501037_0071264_51_446 131
305 3300049574 Ga0501038_0001606 Ga0501038_0001606_8175_8621 131
306 3300049574 Ga0501038_0367426 Ga0501038_0367426_299_694 131
307 3300049578 Ga0501042_0600571 Ga0501042_0600571_248_694 131
308 3300049579 Ga0501043_0001095 Ga0501043_0001095_10962_11408 131
309 3300049580 Ga0501046_0003542 Ga0501046_0003542_2255_2701 131
310 3300049581 Ga0501047_0002544 Ga0501047_0002544_7280_7726 131
311 3300049581 Ga0501047_0010522 Ga0501047_0010522_7107_7583 131
312 3300049776 Ga0501280_000920 Ga0501280_000920_5290_5688 131
313 3300049822 Ga0501035_0004300 Ga0501035_0004300_2295_2741 131
314 3300049822 Ga0501035_0011764 Ga0501035_0011764_5917_6393 131
315 3300049822 Ga0501035_0017152 Ga0501035_0017152_657_1052 131
316 3300049822 Ga0501035_0039883 Ga0501035_0039883_3397_3792 131
317 3300049823 Ga0501044_0000022 Ga0501044_0000022_56072_56467 131
318 3300049823 Ga0501044_0000825 Ga0501044_0000825_7827_8273 131
319 3300049823 Ga0501044_0002899 Ga0501044_0002899_2145_2621 131
320 3300049823 Ga0501044_0309918 Ga0501044_0309918_514_909 131
321 3300050491 nmdc:mga00v17_406308_c1 nmdc:mga00v17_406308_c1_253_648 131
322 3300050507 nmdc:mga05p37_1490804_c1 nmdc:mga05p37_1490804_c1_66_461 131
323 3300050511 nmdc:mga08y16_2167395_c1 nmdc:mga08y16_2167395_c1_22_417 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

29

150

0.91

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

31

139

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bnz-assembly1.cif.gz_A crystal structure of e144q-glyoxalase i mutant from zea mays in space group p4(1)2(1)2 0.9866 2 126
6bnx-assembly1.cif.gz_A crystal structure of v278e-glyoxalase i mutant from zea mays in space group p6(3) 0.9792 2 126
5d7z-assembly1.cif.gz_A crystal structure of glyoxalase i from zea mays 0.978 2 126
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.9766 1 127
4mtr-assembly1.cif.gz_A zn-bound gloa2 0.9765 1 127
ID Description Score Start End Superfamily
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9872 1 59 3.10.180.10
af_Q948T6_1_150_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9807 1 127 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9766 1 127 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9685 1 127 3.10.180.10
af_A0A0R0LFH0_212_347_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9572 1 126 3.10.180.10
ID Description Score Start End GO Terms
AF-E5AL41-F1-model_v4 lactoylglutathione lyase (EC 4.4.1.5) (Aldoketomutase) (Glyoxalase I) (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 1.002 1 126 GO:0004462
GO:0005737
GO:0019243
GO:0046872
AF-A0A653VI79-F1-model_v4 Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 1.002 1 62 GO:0004462
GO:0005737
GO:0019243
GO:0046872
AF-W0SMA4-F1-model_v4 Lactoylglutathione lyase (EC 4.4.1.5) (Glyoxalase I) 1.001 1 127 GO:0004462
GO:0005737
GO:0019243
GO:0046872
AF-Q2SDH5-F1-model_v4 lactoylglutathione lyase (EC 4.4.1.5) (Aldoketomutase) (Glyoxalase I) (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 1.001 1 126 GO:0004462
GO:0005737
GO:0019243
GO:0046872
AF-A0A6S6XWX3-F1-model_v4 Lactoylglutathione lyase (EC 4.4.1.5) (Glyoxalase I) 1.001 1 126 GO:0004462
GO:0005737
GO:0019243
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.86 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map