F406980

General Info

Members Datasets Scaffolds Average Seq Length
323 250 646 197

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100149770|Ga0307408_1001497702
Length 220
Sequence MTAGEGRVRIDRVRTNGVFTLDGQSFDVENNIWLVGDDEEVLVIDAAHEAGPIAEGVGGRRVVAIVCTHGHNDHINAAFDLQEAVASKDRAGAPVVVHDDDRMLWDQVYADRSPDGSVKDGQAFEVGGAALTAIHTPGHSPGGVCLHLASEDVLFSGDTLFKGGPGATGRSFSDFGTIIDSIRNRLLMLPPETVVHTGHGDSTTIGDEAPDLDEWIARGH

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
108 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
112 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
114 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
132 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
133 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
134 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
135 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
136 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
137 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
164 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
178 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
228 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
236 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
239 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
242 2643221578 Streptomyces sp. Root63 Isolate Unclassified
243 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
244 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
245 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
246 2862574272 Streptomyces sp. AcE210 Isolate Nodule
247 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
248 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
249 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
250 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.9
Metatranscriptomes 0.31
Isolates 2.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.86
Nodule 0.31
Rhizoplane 5.57
Rhizosphere 86.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100149770 3300031548 Bacteria 1841
2 Ga0070676_10195889 3300005328 Bacteria 1322
3 Ga0070683_100075701 3300005329 Bacteria 3145
4 Ga0070670_100452097 3300005331 Bacteria 1138
5 Ga0070666_10140207 3300005335 Bacteria 1684
6 Ga0070682_100206829 3300005337 Bacteria 1388
7 Ga0070682_100386404 3300005337 Bacteria 1054
8 Ga0070691_10050870 3300005341 Bacteria 1977
9 Ga0070687_100187522 3300005343 Bacteria 1244
10 Ga0070671_100201762 3300005355 Bacteria 1687
11 Ga0070714_100216227 3300005435 Bacteria 1759
12 Ga0070713_100240485 3300005436 Bacteria 1648
13 Ga0070713_100458329 3300005436 Bacteria 1198
14 Ga0070701_10147651 3300005438 Bacteria 1351
15 Ga0070711_100110704 3300005439 Bacteria 2015
16 Ga0070711_100158365 3300005439 Bacteria 1714
17 Ga0070705_100056899 3300005440 Bacteria 2305
18 Ga0070705_100061119 3300005440 Bacteria 2238
19 Ga0070708_100048224 3300005445 Bacteria 3764
20 Ga0070681_10019621 3300005458 Bacteria 6770
21 Ga0070707_100064808 3300005468 Bacteria 3509
22 Ga0070684_100073966 3300005535 Bacteria 3003
23 Ga0070684_100341361 3300005535 Bacteria 1377
24 Ga0070696_100043667 3300005546 Bacteria 3102
25 Ga0070696_100814113 3300005546 Bacteria 770
26 Ga0070693_100087382 3300005547 Bacteria 1872
27 Ga0070665_100125264 3300005548 Bacteria 2571
28 Ga0070704_100322129 3300005549 Bacteria 1295
29 Ga0070664_100030699 3300005564 Bacteria 4484
30 Ga0068856_100015164 3300005614 Bacteria 7445
31 Ga0068856_100139259 3300005614 Bacteria 2433
32 Ga0068852_100545241 3300005616 Bacteria 1159
33 Ga0068861_100186312 3300005719 Bacteria 1731
34 Ga0068863_100305164 3300005841 Bacteria 1544
35 Ga0068858_100110456 3300005842 Bacteria 2567
36 Ga0068862_100727252 3300005844 Bacteria 964
37 Ga0081455_10144103 3300005937 Bacteria 1846
38 Ga0081540_1012272 3300005983 Bacteria 5659
39 Ga0081540_1220899 3300005983 Bacteria 674
40 Ga0070717_10245292 3300006028 Bacteria 1581
41 Ga0075365_10033988 3300006038 Bacteria 3290
42 Ga0075365_10405073 3300006038 Bacteria 963
43 Ga0070716_100130210 3300006173 Bacteria 1589
44 Ga0070712_100125452 3300006175 Bacteria 1938
45 Ga0075369_10030754 3300006186 Bacteria 2262
46 Ga0097621_100079171 3300006237 Bacteria 2731
47 Ga0075430_100018155 3300006846 Bacteria 5988
48 Ga0075434_100313280 3300006871 Bacteria 1590
49 Ga0075435_100223659 3300007076 Bacteria 1598
50 Ga0099795_10031871 3300007788 Bacteria 1819
51 Ga0105240_11423024 3300009093 Bacteria 728
52 Ga0105245_10203406 3300009098 Bacteria 1903
53 Ga0105245_10230716 3300009098 Bacteria 1790
54 Ga0105245_10663948 3300009098 Bacteria 1073
55 Ga0114129_10112535 3300009147 Bacteria 3754
56 Ga0105241_10128275 3300009174 Bacteria 2050
57 Ga0105237_10017401 3300009545 Bacteria 7453
58 Ga0105238_10091414 3300009551 Bacteria 3031
59 Ga0105249_10156771 3300009553 Bacteria 2196
60 Ga0105239_10008143 3300010375 Bacteria 11962
61 Ga0105246_10409849 3300011119 Bacteria 1128
62 Ga0157373_10054503 3300013100 Bacteria 2841
63 Ga0157371_10157858 3300013102 Bacteria 1619
64 Ga0157378_10486618 3300013297 Bacteria 1230
65 Ga0157372_10744915 3300013307 Bacteria 1139
66 Ga0157375_10168750 3300013308 Bacteria 2335
67 Ga0157377_10083401 3300014745 Bacteria 1873
68 Ga0157376_10265507 3300014969 Bacteria 1610
69 Ga0157376_10765967 3300014969 Bacteria 975
70 Ga0206356_11056831 3300020070 Bacteria 793
71 Ga0213876_10003411 3300021384 Bacteria 9093
72 Ga0213876_10025008 3300021384 Bacteria 3152
73 Ga0213875_10017509 3300021388 Bacteria 3460
74 Ga0213875_10100991 3300021388 Bacteria 1346
75 Ga0207656_10168226 3300025321 Bacteria 1047
76 Ga0207653_10033300 3300025885 Bacteria 1671
77 Ga0207692_10164116 3300025898 Bacteria 1282
78 Ga0207710_10028911 3300025900 Bacteria 2408
79 Ga0207688_10020625 3300025901 Bacteria 3598
80 Ga0207647_10129535 3300025904 Bacteria 1483
81 Ga0207685_10195249 3300025905 Bacteria 947
82 Ga0207699_10029015 3300025906 Bacteria 3081
83 Ga0207643_10127114 3300025908 Bacteria 1514
84 Ga0207705_10608840 3300025909 Bacteria 849
85 Ga0207684_10024535 3300025910 Bacteria 5141
86 Ga0207671_10492186 3300025914 Bacteria 978
87 Ga0207671_10684700 3300025914 Bacteria 816
88 Ga0207693_10079869 3300025915 Bacteria 2560
89 Ga0207660_10339704 3300025917 Bacteria 1202
90 Ga0207662_10037225 3300025918 Bacteria 2847
91 Ga0207657_10045950 3300025919 Bacteria 3828
92 Ga0207649_10095455 3300025920 Bacteria 1956
93 Ga0207646_10442981 3300025922 Bacteria 1172
94 Ga0207681_10607666 3300025923 Bacteria 904
95 Ga0207694_10064497 3300025924 Bacteria 2854
96 Ga0207659_10355503 3300025926 Bacteria 1216
97 Ga0207700_10006479 3300025928 Bacteria 7071
98 Ga0207664_10044116 3300025929 Bacteria 3490
99 Ga0207664_10138157 3300025929 Bacteria 2058
100 Ga0207664_10223437 3300025929 Bacteria 1634
101 Ga0207664_10263992 3300025929 Bacteria 1506
102 Ga0207690_10121022 3300025932 Bacteria 1901
103 Ga0207706_10228523 3300025933 Bacteria 1628
104 Ga0207709_10029649 3300025935 Bacteria 3176
105 Ga0207670_10218494 3300025936 Bacteria 1458
106 Ga0207665_10078460 3300025939 Bacteria 2268
107 Ga0207711_10394588 3300025941 Bacteria 1285
108 Ga0207689_10210022 3300025942 Bacteria 1608
109 Ga0207661_10058672 3300025944 Bacteria 3098
110 Ga0207661_10223512 3300025944 Bacteria 1665
111 Ga0207668_10237476 3300025972 Bacteria 1473
112 Ga0207640_10770432 3300025981 Bacteria 831
113 Ga0207658_10360933 3300025986 Bacteria 1268
114 Ga0207639_10084337 3300026041 Bacteria 2524
115 Ga0207678_10157897 3300026067 Bacteria 1937
116 Ga0207708_10470434 3300026075 Bacteria 1049
117 Ga0207702_10021070 3300026078 Bacteria 5394
118 Ga0207702_10067918 3300026078 Bacteria 3061
119 Ga0207641_10034461 3300026088 Bacteria 4212
120 Ga0207648_11149357 3300026089 Bacteria 729
121 Ga0207676_10380898 3300026095 Bacteria 1313
122 Ga0207674_10240906 3300026116 Bacteria 1756
123 Ga0207675_100376451 3300026118 Bacteria 1395
124 Ga0207683_10162812 3300026121 Bacteria 2018
125 Ga0268266_10790254 3300028379 Bacteria 916
126 Ga0268264_10564861 3300028381 Bacteria 1117
127 Ga0268264_11206499 3300028381 Bacteria 766
128 Ga0307408_100493913 3300031548 Bacteria 1070
129 Ga0316579_10091580 3300031691 Bacteria 1452
130 Ga0316578_10525570 3300031728 Bacteria 696
131 Ga0307413_10272418 3300031824 Bacteria 1268
132 Ga0307411_10035624 3300032005 Bacteria 3110
133 Ga0373926_0002220 3300035083 Bacteria 6129
134 Ga0373926_0077555 3300035083 Bacteria 1226
135 Ga0373936_0004258 3300035113 Bacteria 5403
136 Ga0373945_0109975 3300035116 Bacteria 1086
137 Ga0373953_0054602 3300035117 Bacteria 1621
138 Ga0373954_0103093 3300035118 Bacteria 1377
139 Ga0373954_0151908 3300035118 Bacteria 1131
140 Ga0373960_0031673 3300035121 Bacteria 1481
141 Ga0373943_0002439 3300035170 Bacteria 8447
142 Ga0373943_0106262 3300035170 Bacteria 1475
143 Ga0373946_0022382 3300035171 Bacteria 2459
144 Ga0316574_0071911 3300035398 Bacteria 2185
145 Ga0373924_0012942 3300035410 Bacteria 3126
146 Ga0373931_0134279 3300035691 Bacteria 1427
147 Ga0373931_0211626 3300035691 Bacteria 1163
148 Ga0373935_0009802 3300035692 Bacteria 5735
149 Ga0373927_0431941 3300035695 Bacteria 869
150 Ga0373933_0061694 3300035724 Bacteria 2262
151 Ga0373947_0059732 3300035725 Bacteria 2312
152 Ga0373947_0066161 3300035725 Bacteria 2205
153 Ga0373937_0068260 3300036401 Bacteria 3277
154 Ga0373937_0201751 3300036401 Bacteria 1869
155 Ga0373925_0044171 3300037068 Bacteria 3308
156 Ga0436364_0031968 3300037853 Bacteria 1977
157 Ga0436364_0704995 3300037853 Bacteria 1138
158 Ga0436364_0865658 3300037853 Bacteria 7332
159 Ga0436364_1019189 3300037853 Bacteria 5685
160 Ga0400483_082276 3300039062 Bacteria 7391
161 Ga0436365_0232837 3300039437 Bacteria 3420
162 Ga0436365_0470798 3300039437 Bacteria 31097
163 Ga0436365_0826799 3300039437 Bacteria 3492
164 Ga0436365_1867286 3300039437 Bacteria 1492
165 Ga0436360_0109322 3300039438 Bacteria 1110
166 Ga0439436_0005699 3300041404 Bacteria 3816
167 Ga0439439_0089805 3300041406 Bacteria 838
168 Ga0439433_0000643 3300041999 Bacteria 6683
169 Ga0439432_087620 3300042006 Bacteria 939
170 Ga0439457_002645 3300042014 Bacteria 5058
171 Ga0439434_0029464 3300042435 Bacteria 1664
172 Ga0466966_0610296 3300044684 Bacteria 657
173 Ga0466963_0042902 3300044694 Bacteria 2971
174 Ga0466963_0230669 3300044694 Bacteria 1297
175 Ga0466971_0190693 3300044719 Bacteria 966
176 Ga0466957_0133655 3300044842 Bacteria 1592
177 Ga0466957_0340510 3300044842 Bacteria 1016
178 Ga0466960_0089985 3300044901 Bacteria 1562
179 Ga0466958_0354455 3300045836 Bacteria 945
180 Ga0466967_0016168 3300045976 Bacteria 5874
181 Ga0466967_0028997 3300045976 Bacteria 4627
182 Ga0495627_116284 3300046453 Bacteria 757
183 Ga0495592_0082644 3300046454 Bacteria 2320
184 Ga0495603_0006721 3300046455 Bacteria 6903
185 Ga0495603_0009681 3300046455 Bacteria 5829
186 Ga0495603_0048802 3300046455 Bacteria 2520
187 Ga0495629_0007579 3300046459 Bacteria 7996
188 Ga0495641_0165129 3300046461 Bacteria 990
189 Ga0495651_0135842 3300046462 Bacteria 1789
190 Ga0495651_0138677 3300046462 Bacteria 1766
191 Ga0495651_0458457 3300046462 Bacteria 822
192 Ga0495580_0567882 3300046472 Bacteria 752
193 Ga0495582_0012267 3300046473 Bacteria 4721
194 Ga0495662_0004407 3300046476 Bacteria 7069
195 Ga0495664_0103469 3300046477 Bacteria 1716
196 Ga0495584_0049294 3300046491 Bacteria 2122
197 Ga0495594_0003845 3300046499 Bacteria 7714
198 Ga0495607_0203893 3300046501 Bacteria 977
199 Ga0495618_0254278 3300046514 Bacteria 1101
200 Ga0495628_0250828 3300046516 Bacteria 1321
201 Ga0495630_0156062 3300046517 Bacteria 1737
202 Ga0495630_0302395 3300046517 Bacteria 1222
203 Ga0495666_0006318 3300046526 Bacteria 5968
204 Ga0495665_0339528 3300046531 Bacteria 766
205 Ga0495586_0070103 3300046535 Bacteria 1914
206 Ga0495587_0061435 3300046536 Bacteria 2201
207 Ga0495667_0040563 3300046559 Bacteria 3090
208 Ga0495656_0142275 3300046615 Bacteria 1152
209 Ga0495634_0034157 3300046642 Bacteria 3490
210 Ga0495634_0067385 3300046642 Bacteria 2368
211 Ga0495625_0057620 3300046660 Bacteria 2762
212 Ga0495635_0209199 3300046663 Bacteria 1321
213 Ga0495657_0016982 3300046675 Bacteria 5290
214 Ga0495599_0062177 3300046678 Bacteria 2332
215 Ga0495623_0110951 3300046679 Bacteria 1662
216 Ga0495646_0011754 3300046680 Bacteria 5566
217 Ga0495646_0317278 3300046680 Bacteria 821
218 Ga0495658_0001874 3300046683 Bacteria 10736
219 Ga0495613_0029197 3300046689 Bacteria 4101
220 Ga0495613_0086564 3300046689 Bacteria 2272
221 Ga0495624_0006924 3300046690 Bacteria 7996
222 Ga0495649_0379301 3300046694 Bacteria 712
223 Ga0495589_0011588 3300046794 Bacteria 4578
224 Ga0495600_0018796 3300046809 Bacteria 4408
225 Ga0495581_0063404 3300047315 Bacteria 2135
226 Ga0495604_0027579 3300047317 Bacteria 4515
227 Ga0495604_0058853 3300047317 Bacteria 2949
228 Ga0495674_0195375 3300047319 Bacteria 1680
229 Ga0495674_0300366 3300047319 Bacteria 1311
230 Ga0495676_0022594 3300047321 Bacteria 5470
231 Ga0495676_0127637 3300047321 Bacteria 1841
232 Ga0495676_0350086 3300047321 Bacteria 987
233 Ga0495680_0026849 3300047322 Bacteria 4740
234 Ga0495675_0033876 3300047444 Bacteria 3260
235 Ga0495685_000379 3300047447 Bacteria 14136
236 Ga0495684_0075305 3300047471 Bacteria 2564
237 Ga0495593_0032928 3300047673 Bacteria 2823
238 Ga0495602_0066843 3300048088 Bacteria 3095
239 Ga0495602_0365530 3300048088 Bacteria 1037
240 Ga0496101_0278686 3300048904 Bacteria 1306
241 Ga0496102_0222755 3300048905 Bacteria 1778
242 Ga0496102_0552155 3300048905 Bacteria 1075
243 Ga0496102_0718399 3300048905 Bacteria 922
244 Ga0496104_0253230 3300048907 Bacteria 1673
245 Ga0496105_0868884 3300048908 Bacteria 681
246 Ga0496107_0074469 3300048910 Bacteria 2470
247 Ga0496108_0093122 3300048911 Bacteria 2563
248 Ga0496109_0191192 3300048912 Bacteria 1923
249 Ga0496110_0052282 3300048913 Bacteria 3590
250 Ga0496111_0054873 3300048914 Bacteria 2881
251 Ga0496112_0240895 3300048915 Bacteria 1761
252 Ga0496112_0309229 3300048915 Bacteria 1525
253 Ga0496113_0069871 3300048916 Bacteria 2667
254 Ga0496114_0003260 3300048917 Bacteria 12459
255 Ga0496114_0076689 3300048917 Bacteria 2817
256 Ga0496114_0463086 3300048917 Bacteria 1122
257 Ga0496115_0243193 3300048918 Bacteria 1483
258 Ga0496118_0001075 3300048921 Bacteria 42667
259 Ga0496126_0012696 3300048929 Bacteria 8618
260 Ga0501032_0006046 3300049569 Bacteria 8926
261 Ga0501033_0000152 3300049570 Bacteria 66824
262 Ga0501034_0006581 3300049571 Bacteria 12464
263 Ga0501034_0131507 3300049571 Bacteria 2485
264 Ga0501034_0141382 3300049571 Bacteria 2386
265 Ga0501034_0949105 3300049571 Bacteria 746
266 Ga0501036_0011150 3300049572 Bacteria 7436
267 Ga0501036_0057697 3300049572 Bacteria 3289
268 Ga0501037_0006073 3300049573 Bacteria 8823
269 Ga0501037_0026639 3300049573 Bacteria 4272
270 Ga0501042_0674071 3300049578 Bacteria 752
271 Ga0501043_0305794 3300049579 Bacteria 1214
272 Ga0501046_0006444 3300049580 Bacteria 10393
273 Ga0501047_0022965 3300049581 Bacteria 5987
274 Ga0501047_0052985 3300049581 Bacteria 3922
275 Ga0501047_0404776 3300049581 Bacteria 1197
276 Ga0501047_0541305 3300049581 Bacteria 989
277 Ga0501048_0009602 3300049582 Bacteria 7260
278 Ga0501068_0001159 3300049584 Bacteria 13980
279 Ga0501069_0037242 3300049585 Bacteria 2684
280 Ga0501069_0083757 3300049585 Bacteria 1798
281 Ga0501070_0000545 3300049586 Bacteria 34467
282 Ga0501070_0038059 3300049586 Bacteria 4014
283 Ga0501072_0030625 3300049588 Bacteria 4209
284 Ga0501072_0037210 3300049588 Bacteria 3816
285 Ga0501073_0001517 3300049589 Bacteria 17204
286 Ga0501074_0000098 3300049590 Bacteria 42189
287 Ga0501074_0301593 3300049590 Bacteria 1138
288 Ga0501080_0021472 3300049742 Bacteria 5975
289 Ga0501080_0213867 3300049742 Bacteria 1766
290 Ga0501081_0478094 3300049743 Bacteria 927
291 Ga0501083_0012458 3300049744 Bacteria 5947
292 Ga0501282_003686 3300049778 Bacteria 1648
293 Ga0501035_0020032 3300049822 Bacteria 6144
294 Ga0501044_0008986 3300049823 Bacteria 10925
295 Ga0501044_0009423 3300049823 Bacteria 10637
296 Ga0501044_0245124 3300049823 Bacteria 1735
297 Ga0501044_0435388 3300049823 Bacteria 1220
298 nmdc:mga03n38_14349_c1 3300050490 Bacteria 3034
299 nmdc:mga0yw44_40959_c2 3300050492 Bacteria 2197
300 nmdc:mga05p37_119564_c1 3300050507 Bacteria 3237
301 nmdc:mga05p37_315211_c1 3300050507 Bacteria 1853
302 nmdc:mga09592_587075_c1 3300050508 Bacteria 955
303 nmdc:mga0qj67_49567_c1 3300050509 Bacteria 3319
304 nmdc:mga06r32_24795_c1 3300050510 Bacteria 5574
305 nmdc:mga0n895_231971_c1 3300050512 Bacteria 1873
306 Ga0495601_0081984 3300053077 Bacteria 2070
307 Ga0495612_0020983 3300053078 Bacteria 2620
308 Ga0495595_0121879 3300053084 Bacteria 1270
309 Ga0495595_0202531 3300053084 Bacteria 988
310 Ga0495619_0015359 3300053085 Bacteria 4844
311 Ga0500566_0000296 3300053094 Bacteria 26727
312 Ga0590075_012057 3300059424 Bacteria 2096
313 Ga0466962_0119590 3300061719 Bacteria 1271
314 Ga0530510_0038629 3300061734 Bacteria 3446
315 2643904672 2643221578 Bacteria 9213798
316 2644406062 2643221673 Bacteria 9196637
317 2810363885 2808606700 Bacteria 3482157
318 2812354274 2811994879 Bacteria 9313447
319 2862574973 2862574272 Bacteria 10567477
320 2873152276 2873151551 Bacteria 8625867
321 2946004295 2946003308 Bacteria 3857229
322 2946051832 2946045630 Bacteria 8527308
323 2947224853 2947224130 Bacteria 9938529
324 Ga0307408_100149770
325 Ga0070676_10195889
326 Ga0070683_100075701
327 Ga0070670_100452097
328 Ga0070666_10140207
329 Ga0070682_100206829
330 Ga0070682_100386404
331 Ga0070691_10050870
332 Ga0070687_100187522
333 Ga0070671_100201762
334 Ga0070714_100216227
335 Ga0070713_100240485
336 Ga0070713_100458329
337 Ga0070701_10147651
338 Ga0070711_100110704
339 Ga0070711_100158365
340 Ga0070705_100056899
341 Ga0070705_100061119
342 Ga0070708_100048224
343 Ga0070681_10019621
344 Ga0070707_100064808
345 Ga0070684_100073966
346 Ga0070684_100341361
347 Ga0070696_100043667
348 Ga0070696_100814113
349 Ga0070693_100087382
350 Ga0070665_100125264
351 Ga0070704_100322129
352 Ga0070664_100030699
353 Ga0068856_100015164
354 Ga0068856_100139259
355 Ga0068852_100545241
356 Ga0068861_100186312
357 Ga0068863_100305164
358 Ga0068858_100110456
359 Ga0068862_100727252
360 Ga0081455_10144103
361 Ga0081540_1012272
362 Ga0081540_1220899
363 Ga0070717_10245292
364 Ga0075365_10033988
365 Ga0075365_10405073
366 Ga0070716_100130210
367 Ga0070712_100125452
368 Ga0075369_10030754
369 Ga0097621_100079171
370 Ga0075430_100018155
371 Ga0075434_100313280
372 Ga0075435_100223659
373 Ga0099795_10031871
374 Ga0105240_11423024
375 Ga0105245_10203406
376 Ga0105245_10230716
377 Ga0105245_10663948
378 Ga0114129_10112535
379 Ga0105241_10128275
380 Ga0105237_10017401
381 Ga0105238_10091414
382 Ga0105249_10156771
383 Ga0105239_10008143
384 Ga0105246_10409849
385 Ga0157373_10054503
386 Ga0157371_10157858
387 Ga0157378_10486618
388 Ga0157372_10744915
389 Ga0157375_10168750
390 Ga0157377_10083401
391 Ga0157376_10265507
392 Ga0157376_10765967
393 Ga0206356_11056831
394 Ga0213876_10003411
395 Ga0213876_10025008
396 Ga0213875_10017509
397 Ga0213875_10100991
398 Ga0207656_10168226
399 Ga0207653_10033300
400 Ga0207692_10164116
401 Ga0207710_10028911
402 Ga0207688_10020625
403 Ga0207647_10129535
404 Ga0207685_10195249
405 Ga0207699_10029015
406 Ga0207643_10127114
407 Ga0207705_10608840
408 Ga0207684_10024535
409 Ga0207671_10492186
410 Ga0207671_10684700
411 Ga0207693_10079869
412 Ga0207660_10339704
413 Ga0207662_10037225
414 Ga0207657_10045950
415 Ga0207649_10095455
416 Ga0207646_10442981
417 Ga0207681_10607666
418 Ga0207694_10064497
419 Ga0207659_10355503
420 Ga0207700_10006479
421 Ga0207664_10044116
422 Ga0207664_10138157
423 Ga0207664_10223437
424 Ga0207664_10263992
425 Ga0207690_10121022
426 Ga0207706_10228523
427 Ga0207709_10029649
428 Ga0207670_10218494
429 Ga0207665_10078460
430 Ga0207711_10394588
431 Ga0207689_10210022
432 Ga0207661_10058672
433 Ga0207661_10223512
434 Ga0207668_10237476
435 Ga0207640_10770432
436 Ga0207658_10360933
437 Ga0207639_10084337
438 Ga0207678_10157897
439 Ga0207708_10470434
440 Ga0207702_10021070
441 Ga0207702_10067918
442 Ga0207641_10034461
443 Ga0207648_11149357
444 Ga0207676_10380898
445 Ga0207674_10240906
446 Ga0207675_100376451
447 Ga0207683_10162812
448 Ga0268266_10790254
449 Ga0268264_10564861
450 Ga0268264_11206499
451 Ga0307408_100493913
452 Ga0316579_10091580
453 Ga0316578_10525570
454 Ga0307413_10272418
455 Ga0307411_10035624
456 Ga0373926_0002220
457 Ga0373926_0077555
458 Ga0373936_0004258
459 Ga0373945_0109975
460 Ga0373953_0054602
461 Ga0373954_0103093
462 Ga0373954_0151908
463 Ga0373960_0031673
464 Ga0373943_0002439
465 Ga0373943_0106262
466 Ga0373946_0022382
467 Ga0316574_0071911
468 Ga0373924_0012942
469 Ga0373931_0134279
470 Ga0373931_0211626
471 Ga0373935_0009802
472 Ga0373927_0431941
473 Ga0373933_0061694
474 Ga0373947_0059732
475 Ga0373947_0066161
476 Ga0373937_0068260
477 Ga0373937_0201751
478 Ga0373925_0044171
479 Ga0436364_0031968
480 Ga0436364_0704995
481 Ga0436364_0865658
482 Ga0436364_1019189
483 Ga0400483_082276
484 Ga0436365_0232837
485 Ga0436365_0470798
486 Ga0436365_0826799
487 Ga0436365_1867286
488 Ga0436360_0109322
489 Ga0439436_0005699
490 Ga0439439_0089805
491 Ga0439433_0000643
492 Ga0439432_087620
493 Ga0439457_002645
494 Ga0439434_0029464
495 Ga0466966_0610296
496 Ga0466963_0042902
497 Ga0466963_0230669
498 Ga0466971_0190693
499 Ga0466957_0133655
500 Ga0466957_0340510
501 Ga0466960_0089985
502 Ga0466958_0354455
503 Ga0466967_0016168
504 Ga0466967_0028997
505 Ga0495627_116284
506 Ga0495592_0082644
507 Ga0495603_0006721
508 Ga0495603_0009681
509 Ga0495603_0048802
510 Ga0495629_0007579
511 Ga0495641_0165129
512 Ga0495651_0135842
513 Ga0495651_0138677
514 Ga0495651_0458457
515 Ga0495580_0567882
516 Ga0495582_0012267
517 Ga0495662_0004407
518 Ga0495664_0103469
519 Ga0495584_0049294
520 Ga0495594_0003845
521 Ga0495607_0203893
522 Ga0495618_0254278
523 Ga0495628_0250828
524 Ga0495630_0156062
525 Ga0495630_0302395
526 Ga0495666_0006318
527 Ga0495665_0339528
528 Ga0495586_0070103
529 Ga0495587_0061435
530 Ga0495667_0040563
531 Ga0495656_0142275
532 Ga0495634_0034157
533 Ga0495634_0067385
534 Ga0495625_0057620
535 Ga0495635_0209199
536 Ga0495657_0016982
537 Ga0495599_0062177
538 Ga0495623_0110951
539 Ga0495646_0011754
540 Ga0495646_0317278
541 Ga0495658_0001874
542 Ga0495613_0029197
543 Ga0495613_0086564
544 Ga0495624_0006924
545 Ga0495649_0379301
546 Ga0495589_0011588
547 Ga0495600_0018796
548 Ga0495581_0063404
549 Ga0495604_0027579
550 Ga0495604_0058853
551 Ga0495674_0195375
552 Ga0495674_0300366
553 Ga0495676_0022594
554 Ga0495676_0127637
555 Ga0495676_0350086
556 Ga0495680_0026849
557 Ga0495675_0033876
558 Ga0495685_000379
559 Ga0495684_0075305
560 Ga0495593_0032928
561 Ga0495602_0066843
562 Ga0495602_0365530
563 Ga0496101_0278686
564 Ga0496102_0222755
565 Ga0496102_0552155
566 Ga0496102_0718399
567 Ga0496104_0253230
568 Ga0496105_0868884
569 Ga0496107_0074469
570 Ga0496108_0093122
571 Ga0496109_0191192
572 Ga0496110_0052282
573 Ga0496111_0054873
574 Ga0496112_0240895
575 Ga0496112_0309229
576 Ga0496113_0069871
577 Ga0496114_0003260
578 Ga0496114_0076689
579 Ga0496114_0463086
580 Ga0496115_0243193
581 Ga0496118_0001075
582 Ga0496126_0012696
583 Ga0501032_0006046
584 Ga0501033_0000152
585 Ga0501034_0006581
586 Ga0501034_0131507
587 Ga0501034_0141382
588 Ga0501034_0949105
589 Ga0501036_0011150
590 Ga0501036_0057697
591 Ga0501037_0006073
592 Ga0501037_0026639
593 Ga0501042_0674071
594 Ga0501043_0305794
595 Ga0501046_0006444
596 Ga0501047_0022965
597 Ga0501047_0052985
598 Ga0501047_0404776
599 Ga0501047_0541305
600 Ga0501048_0009602
601 Ga0501068_0001159
602 Ga0501069_0037242
603 Ga0501069_0083757
604 Ga0501070_0000545
605 Ga0501070_0038059
606 Ga0501072_0030625
607 Ga0501072_0037210
608 Ga0501073_0001517
609 Ga0501074_0000098
610 Ga0501074_0301593
611 Ga0501080_0021472
612 Ga0501080_0213867
613 Ga0501081_0478094
614 Ga0501083_0012458
615 Ga0501282_003686
616 Ga0501035_0020032
617 Ga0501044_0008986
618 Ga0501044_0009423
619 Ga0501044_0245124
620 Ga0501044_0435388
621 nmdc:mga03n38_14349_c1
622 nmdc:mga0yw44_40959_c2
623 nmdc:mga05p37_119564_c1
624 nmdc:mga05p37_315211_c1
625 nmdc:mga09592_587075_c1
626 nmdc:mga0qj67_49567_c1
627 nmdc:mga06r32_24795_c1
628 nmdc:mga0n895_231971_c1
629 Ga0495601_0081984
630 Ga0495612_0020983
631 Ga0495595_0121879
632 Ga0495595_0202531
633 Ga0495619_0015359
634 Ga0500566_0000296
635 Ga0590075_012057
636 Ga0466962_0119590
637 Ga0530510_0038629
638 2643904672
639 2644406062
640 2810363885
641 2812354274
642 2862574973
643 2873152276
644 2946004295
645 2946051832
646 2947224853

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

26

199

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7l0b-assembly4.cif.gz_D crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme 0.8944 2 183
2xf4-assembly1.cif.gz_A-2 crystal structure of salmonella enterica serovar typhimurium ycbl 0.8807 1 186
7ev5-assembly1.cif.gz_A crystal structure of bleg-1 b3 metallo-beta-lactamase 0.8751 1 189
5ve4-assembly2.cif.gz_B crystal structure of persulfide dioxygenase-rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans 0.8648 1 183
4chl-assembly1.cif.gz_A human ethylmalonic encephalopathy protein 1 (hethe1) 0.8603 1 187
ID Description Score Start End Superfamily
af_O53534_19_208_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9549 5 190 3.60.15.10
af_O53534_19_208_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9302 5 190 3.60.15.10
2xf4A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8807 1 186 3.60.15.10
af_I6Y4A5_15_234_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8807 12 191 3.60.15.10
af_O06154_65_262_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8734 1 192 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A2N8TY71-F1-model_v4 Zn-dependent hydrolase 0.9919 42 194 GO:0016787
AF-A0A7K3CM45-F1-model_v4 deleted 0.9867 1 194
AF-A0A4R1FS32-F1-model_v4 Glyoxylase-like metal-dependent hydrolase (Beta-lactamase superfamily II) 0.9855 12 194 GO:0016787
AF-A0A2N8TY71-F1-model_v4 Zn-dependent hydrolase 0.9855 42 194 GO:0016787
AF-A0A5E8P4S9-F1-model_v4 deleted 0.9853 12 194

Map