F406777

General Info

Members Datasets Scaffolds Average Seq Length
323 165 646 304

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100007523|Ga0070689_1000075234
Length 344
Sequence MPAPEPRRSLQHMILALEQFWAERGCVIQQPYPSEVGAGTFNPATFLRSLGPEPWNVAYVEPSRRPKDGRYGENPNRFQQFFQYQVLLKPAPADVVDAYFQSLAAMGLDPLKHDLRLVEDDWESPTLGAAGLGWQVWCDGTEISQFTYFQQCGGLELPVISAELTYGLDRIGMMLQGTDRVQDLHWAPGVTWGDLWVRNEWEWSTYNFEQAPVPELSEMFKVWEAEAARLLELKLVNPGYDAVIKCSHVFNLLDARGAISVSERVGYIARVRKLARRAAQAYADLRGELGYPLIKDEAERARWLAWRDEAAGKAAGKTGXXXXPANGTPAKSSEPQSEGAEARR

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
41 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
67 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
68 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
69 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
73 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
76 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
77 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
78 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
79 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
80 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
81 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
82 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
87 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
89 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
90 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
91 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
92 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
97 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
100 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
101 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
102 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
103 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
104 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
105 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
106 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
107 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
108 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
111 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
143 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
160 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
161 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
162 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
163 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
164 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
165 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.9
Metatranscriptomes 1.86
Isolates 1.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 2.48
Rhizosphere 83.9
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100007523 3300005340 Bacteria 7625
2 Ga0065715_10037976 3300005293 Bacteria 1574
3 Ga0070690_100030669 3300005330 Bacteria 3343
4 Ga0070670_100012037 3300005331 Bacteria 7400
5 Ga0070670_100130304 3300005331 Bacteria 2172
6 Ga0068869_100071554 3300005334 Bacteria 2568
7 Ga0070689_100001004 3300005340 Bacteria 17677
8 Ga0070689_100103743 3300005340 Bacteria 2254
9 Ga0070689_100164509 3300005340 Bacteria 1795
10 Ga0070692_10043630 3300005345 Bacteria 2307
11 Ga0070688_100001468 3300005365 Bacteria 11711
12 Ga0070688_100003357 3300005365 Bacteria 8213
13 Ga0070688_100003419 3300005365 Bacteria 8156
14 Ga0070688_100014364 3300005365 Bacteria 4485
15 Ga0070688_100022587 3300005365 Bacteria 3689
16 Ga0070714_100182756 3300005435 Bacteria 1909
17 Ga0070713_100102718 3300005436 Bacteria 2480
18 Ga0070701_10023312 3300005438 Bacteria 2980
19 Ga0070701_10026701 3300005438 Bacteria 2819
20 Ga0070705_100105092 3300005440 Bacteria 1792
21 Ga0070694_100050519 3300005444 Bacteria 2803
22 Ga0070708_100056254 3300005445 Bacteria 3499
23 Ga0070678_100007838 3300005456 Bacteria 6354
24 Ga0070678_100069952 3300005456 Bacteria 2622
25 Ga0070681_10005681 3300005458 Bacteria 12054
26 Ga0070685_10027343 3300005466 Bacteria 3151
27 Ga0070685_10031964 3300005466 Bacteria 2945
28 Ga0070698_100021661 3300005471 Bacteria 6729
29 Ga0070698_100022661 3300005471 Bacteria 6567
30 Ga0070698_100273143 3300005471 Bacteria 1622
31 Ga0070699_100053015 3300005518 Bacteria 3511
32 Ga0070697_100080101 3300005536 Bacteria 2690
33 Ga0070696_100101322 3300005546 Bacteria 2064
34 Ga0070704_100110227 3300005549 Bacteria 2093
35 Ga0070704_100337388 3300005549 Bacteria 1268
36 Ga0068855_100120035 3300005563 Bacteria 3009
37 Ga0070664_100235164 3300005564 Bacteria 1643
38 Ga0068859_100014891 3300005617 Bacteria 7808
39 Ga0068859_100026457 3300005617 Bacteria 5819
40 Ga0068859_100202471 3300005617 Bacteria 2070
41 Ga0068864_100115907 3300005618 Bacteria 2390
42 Ga0068861_100001473 3300005719 Bacteria 14924
43 Ga0068870_10026465 3300005840 Bacteria 2892
44 Ga0068863_100064949 3300005841 Bacteria 3453
45 Ga0068862_100126978 3300005844 Bacteria 2253
46 Ga0068862_100209020 3300005844 Bacteria 1763
47 Ga0070715_10134411 3300006163 Bacteria 1194
48 Ga0070712_100345867 3300006175 Bacteria 1216
49 Ga0075428_100000051 3300006844 Bacteria 93040
50 Ga0075428_100020882 3300006844 Bacteria 7252
51 Ga0075428_100046863 3300006844 Bacteria 4748
52 Ga0075428_100108746 3300006844 Bacteria 3022
53 Ga0075430_100024323 3300006846 Bacteria 5155
54 Ga0075431_100237774 3300006847 Bacteria 1854
55 Ga0075431_100246124 3300006847 Bacteria 1818
56 Ga0075433_10013263 3300006852 Bacteria 6695
57 Ga0075433_10083475 3300006852 Bacteria 2819
58 Ga0075434_100008071 3300006871 Bacteria 9762
59 Ga0075434_100070217 3300006871 Bacteria 3493
60 Ga0075434_100083123 3300006871 Bacteria 3199
61 Ga0075434_100109251 3300006871 Bacteria 2776
62 Ga0097620_100014891 3300006931 Bacteria 7808
63 Ga0097620_100026457 3300006931 Bacteria 5819
64 Ga0097620_100202474 3300006931 Bacteria 2070
65 Ga0075435_100033356 3300007076 Bacteria 4070
66 Ga0075435_100246649 3300007076 Bacteria 1520
67 Ga0099794_10001708 3300007265 Bacteria 7776
68 Ga0099795_10031971 3300007788 Bacteria 1817
69 Ga0105244_10043457 3300009036 Bacteria 2318
70 Ga0111539_10000957 3300009094 Bacteria 37861
71 Ga0111539_10003200 3300009094 Bacteria 21665
72 Ga0111539_10148367 3300009094 Bacteria 2746
73 Ga0114129_10000175 3300009147 Bacteria 70619
74 Ga0114129_10082194 3300009147 Bacteria 4477
75 Ga0114129_10425868 3300009147 Bacteria 1745
76 Ga0114129_10988111 3300009147 Bacteria 1061
77 Ga0105242_10307736 3300009176 Bacteria 1449
78 Ga0105248_10382624 3300009177 Bacteria 1584
79 Ga0105239_10479913 3300010375 Bacteria 1412
80 Ga0157378_10037757 3300013297 Bacteria 4281
81 Ga0157375_10649520 3300013308 Bacteria 1211
82 Ga0157380_10006183 3300014326 Bacteria 8399
83 Ga0157377_10021598 3300014745 Bacteria 3388
84 Ga0206356_11331869 3300020070 Bacteria 1153
85 Ga0207685_10120801 3300025905 Bacteria 1150
86 Ga0207684_10077920 3300025910 Bacteria 2819
87 Ga0207684_10173692 3300025910 Bacteria 1858
88 Ga0207662_10001330 3300025918 Bacteria 11915
89 Ga0207662_10067677 3300025918 Bacteria 2154
90 Ga0207650_10029014 3300025925 Bacteria 3973
91 Ga0207670_10000087 3300025936 Bacteria 63117
92 Ga0207670_10017542 3300025936 Bacteria 4328
93 Ga0207670_10039159 3300025936 Bacteria 3102
94 Ga0207670_10087838 3300025936 Bacteria 2191
95 Ga0207704_10096561 3300025938 Bacteria 1957
96 Ga0207665_10244144 3300025939 Bacteria 1324
97 Ga0207689_10057945 3300025942 Bacteria 3186
98 Ga0207641_10342917 3300026088 Bacteria 1422
99 Ga0207648_10219628 3300026089 Bacteria 1689
100 Ga0207675_100003599 3300026118 Bacteria 15106
101 Ga0207683_10092754 3300026121 Bacteria 2691
102 Ga0207683_10181477 3300026121 Bacteria 1908
103 Ga0207428_10002554 3300027907 Bacteria 18180
104 Ga0207428_10005332 3300027907 Bacteria 11993
105 Ga0207428_10135665 3300027907 Bacteria 1881
106 Ga0268265_10137588 3300028380 Bacteria 2040
107 Ga0268265_10390734 3300028380 Bacteria 1283
108 Ga0265337_1007138 3300028556 Bacteria 4216
109 Ga0265337_1019802 3300028556 Bacteria 2116
110 Ga0265319_1000364 3300028563 Bacteria 32786
111 Ga0265334_10009671 3300028573 Bacteria 4076
112 Ga0265318_10006170 3300028577 Bacteria 5546
113 Ga0265338_10008823 3300028800 Bacteria 12163
114 Ga0265338_10011436 3300028800 Bacteria 10250
115 Ga0265338_10020181 3300028800 Bacteria 7024
116 Ga0265338_10078298 3300028800 Bacteria 2789
117 Ga0265339_10041463 3300031249 Bacteria 2555
118 Ga0316575_10000422 3300031665 Bacteria 12098
119 Ga0316575_10000454 3300031665 Bacteria 11720
120 Ga0316575_10001636 3300031665 Bacteria 7321
121 Ga0316575_10027505 3300031665 Bacteria 2213
122 Ga0316579_10000210 3300031691 Bacteria 17467
123 Ga0316579_10001727 3300031691 Bacteria 8021
124 Ga0316579_10003796 3300031691 Bacteria 5948
125 Ga0316579_10021345 3300031691 Bacteria 2885
126 Ga0316579_10085408 3300031691 Bacteria 1506
127 Ga0316579_10122282 3300031691 Bacteria 1251
128 Ga0265314_10061372 3300031711 Bacteria 2560
129 Ga0316576_10000682 3300031727 Bacteria 16622
130 Ga0316576_10001433 3300031727 Bacteria 12776
131 Ga0316576_10004136 3300031727 Bacteria 8662
132 Ga0316576_10007758 3300031727 Bacteria 6777
133 Ga0316576_10010145 3300031727 Bacteria 6108
134 Ga0316576_10045661 3300031727 Bacteria 3169
135 Ga0316576_10075847 3300031727 Bacteria 2487
136 Ga0316576_10093557 3300031727 Bacteria 2241
137 Ga0316576_10095028 3300031727 Bacteria 2223
138 Ga0316576_10125322 3300031727 Bacteria 1930
139 Ga0316576_10137197 3300031727 Bacteria 1841
140 Ga0316576_10170191 3300031727 Bacteria 1644
141 Ga0316576_10190849 3300031727 Bacteria 1544
142 Ga0316578_10003061 3300031728 Bacteria 7543
143 Ga0316578_10003159 3300031728 Bacteria 7452
144 Ga0316578_10015020 3300031728 Bacteria 4154
145 Ga0316578_10016850 3300031728 Bacteria 3964
146 Ga0316578_10043941 3300031728 Bacteria 2597
147 Ga0316578_10111813 3300031728 Bacteria 1641
148 Ga0307516_10173347 3300031730 Bacteria 1896
149 Ga0316577_10000057 3300031733 Bacteria 26563
150 Ga0316577_10004577 3300031733 Bacteria 7160
151 Ga0316577_10008857 3300031733 Bacteria 5400
152 Ga0316577_10014874 3300031733 Bacteria 4278
153 Ga0316577_10031747 3300031733 Bacteria 2951
154 Ga0316577_10042469 3300031733 Bacteria 2544
155 Ga0316577_10052370 3300031733 Bacteria 2277
156 Ga0316577_10060973 3300031733 Bacteria 2105
157 Ga0316577_10103576 3300031733 Bacteria 1596
158 Ga0316577_10111078 3300031733 Bacteria 1538
159 Ga0316577_10238477 3300031733 Bacteria 1028
160 Ga0316583_10000885 3300032133 Bacteria 9581
161 Ga0316583_10001024 3300032133 Bacteria 9037
162 Ga0316583_10006274 3300032133 Bacteria 4272
163 Ga0316583_10012292 3300032133 Bacteria 3089
164 Ga0316583_10028433 3300032133 Bacteria 1994
165 Ga0316583_10081407 3300032133 Bacteria 1131
166 Ga0316585_10000051 3300032137 Bacteria 18811
167 Ga0316585_10000746 3300032137 Bacteria 8187
168 Ga0316585_10000763 3300032137 Bacteria 8127
169 Ga0316580_10000412 3300032139 Bacteria 9709
170 Ga0316580_10000958 3300032139 Bacteria 7180
171 Ga0316580_10024763 3300032139 Bacteria 1854
172 Ga0316593_10000341 3300032168 Bacteria 8107
173 Ga0316592_1002521 3300033524 Bacteria 3176
174 Ga0316588_1000067 3300033528 Bacteria 8960
175 Ga0316596_1003824 3300033541 Bacteria 3331
176 Ga0316596_1062844 3300033541 Bacteria 991
177 Ga0373934_0002967 3300035086 Bacteria 6200
178 Ga0373923_0000911 3300035111 Bacteria 7888
179 Ga0373953_0015612 3300035117 Bacteria 2756
180 Ga0373954_0021585 3300035118 Bacteria 2916
181 Ga0373955_0009142 3300035172 Bacteria 4630
182 Ga0373955_0174367 3300035172 Bacteria 1274
183 Ga0316574_0000216 3300035398 Bacteria 20454
184 Ga0316574_0001553 3300035398 Bacteria 10962
185 Ga0316574_0017858 3300035398 Bacteria 4159
186 Ga0316574_0231744 3300035398 Bacteria 1182
187 Ga0373924_0003498 3300035410 Bacteria 5410
188 Ga0373931_0039363 3300035691 Bacteria 2477
189 Ga0373931_0113266 3300035691 Bacteria 1542
190 Ga0373935_0222699 3300035692 Bacteria 1311
191 Ga0373937_0058817 3300036401 Bacteria 3531
192 Ga0316582_0000132 3300036647 Bacteria 21730
193 Ga0316582_0001758 3300036647 Bacteria 9755
194 Ga0316582_0002059 3300036647 Bacteria 9269
195 Ga0316582_0003733 3300036647 Bacteria 7543
196 Ga0316582_0087652 3300036647 Bacteria 2043
197 Ga0316582_0097694 3300036647 Bacteria 1941
198 Ga0316582_0267169 3300036647 Bacteria 1173
199 Ga0316582_0294104 3300036647 Bacteria 1115
200 Ga0316582_0368584 3300036647 Bacteria 988
201 Ga0316584_0000316 3300036712 Bacteria 24730
202 Ga0316584_0001089 3300036712 Bacteria 15885
203 Ga0316584_0005138 3300036712 Bacteria 8738
204 Ga0316584_0012949 3300036712 Bacteria 5892
205 Ga0316584_0015088 3300036712 Bacteria 5521
206 Ga0316584_0021889 3300036712 Bacteria 4654
207 Ga0316584_0024742 3300036712 Bacteria 4397
208 Ga0316584_0039171 3300036712 Bacteria 3528
209 Ga0316584_0114704 3300036712 Bacteria 2015
210 Ga0395900_0624860 3300037418 Bacteria 1016
211 Ga0316581_0003683 3300037588 Bacteria 3836
212 Ga0316581_0017940 3300037588 Bacteria 2049
213 Ga0316581_0022265 3300037588 Bacteria 1868
214 Ga0400484_09039 3300038725 Bacteria 11653
215 Ga0400484_15071 3300038725 Bacteria 15084
216 Ga0400484_20439 3300038725 Bacteria 3126
217 Ga0400484_30698 3300038725 Bacteria 11709
218 Ga0400490_04711 3300038726 Bacteria 111545
219 Ga0400490_08608 3300038726 Bacteria 1400
220 Ga0400490_15484 3300038726 Bacteria 5554
221 Ga0400490_40890 3300038726 Bacteria 7837
222 Ga0400491_16990 3300038727 Bacteria 4699
223 Ga0400485_02560 3300038735 Bacteria 9879
224 Ga0400485_10082 3300038735 Bacteria 7114
225 Ga0400485_16123 3300038735 Bacteria 16791
226 Ga0400488_05118 3300038741 Bacteria 6204
227 Ga0400488_17797 3300038741 Bacteria 15082
228 Ga0400488_24496 3300038741 Bacteria 2652
229 Ga0400488_29210 3300038741 Bacteria 4804
230 Ga0400488_49919 3300038741 Bacteria 9330
231 Ga0400486_04992 3300038742 Bacteria 7802
232 Ga0400486_18892 3300038742 Bacteria 22102
233 Ga0400486_26506 3300038742 Bacteria 46054
234 Ga0400483_013842 3300039062 Bacteria 1805
235 Ga0400483_025710 3300039062 Bacteria 1309
236 Ga0400483_139799 3300039062 Bacteria 3197
237 Ga0400483_154560 3300039062 Bacteria 53157
238 Ga0400483_197763 3300039062 Bacteria 13424
239 Ga0400483_235229 3300039062 Bacteria 6926
240 Ga0400483_251877 3300039062 Bacteria 4450
241 Ga0400489_09400 3300039093 Bacteria 19299
242 Ga0400489_43195 3300039093 Bacteria 1325
243 Ga0400489_63755 3300039093 Bacteria 11021
244 Ga0400489_74021 3300039093 Bacteria 99222
245 Ga0400487_00656 3300039110 Bacteria 8864
246 Ga0400487_43234 3300039110 Bacteria 4294
247 Ga0400487_51409 3300039110 Bacteria 25991
248 Ga0436363_0945786 3300039450 Bacteria 3128
249 Ga0451577_0003123 3300042876 Bacteria 18690
250 Ga0451577_0159256 3300042876 Bacteria 2032
251 Ga0453683_0008948 3300044673 Bacteria 6695
252 Ga0466963_0017129 3300044694 Bacteria 4513
253 Ga0466964_0032572 3300044706 Bacteria 2072
254 Ga0453684_0005766 3300044712 Bacteria 24183
255 Ga0466971_0056399 3300044719 Bacteria 1772
256 Ga0466957_0031422 3300044842 Bacteria 3173
257 Ga0451576_0065054 3300045051 Bacteria 3797
258 Ga0451576_0363262 3300045051 Bacteria 1516
259 Ga0451576_0722434 3300045051 Bacteria 1046
260 Ga0466967_0056562 3300045976 Bacteria 3459
261 Ga0466967_0176851 3300045976 Bacteria 2011
262 Ga0466967_0223665 3300045976 Bacteria 1790
263 Ga0495592_0001783 3300046454 Bacteria 15155
264 Ga0495592_0131764 3300046454 Bacteria 1748
265 Ga0495580_0239890 3300046472 Bacteria 1243
266 Ga0495608_0001619 3300046511 Bacteria 16139
267 Ga0495618_0001293 3300046514 Bacteria 16882
268 Ga0495628_0045178 3300046516 Bacteria 3504
269 Ga0495652_0297167 3300046529 Bacteria 1176
270 Ga0495587_0040248 3300046536 Bacteria 2794
271 Ga0495625_0140907 3300046660 Bacteria 1627
272 Ga0495657_0042851 3300046675 Bacteria 3087
273 Ga0495658_0266597 3300046683 Bacteria 1079
274 Ga0495613_0140129 3300046689 Bacteria 1728
275 Ga0495604_0094549 3300047317 Bacteria 2209
276 Ga0495636_0002062 3300047318 Bacteria 7713
277 Ga0495674_0206401 3300047319 Bacteria 1629
278 Ga0495680_0038921 3300047322 Bacteria 3797
279 Ga0495680_0172664 3300047322 Bacteria 1564
280 Ga0495614_0041902 3300048089 Bacteria 1964
281 Ga0496101_0001655 3300048904 Bacteria 13367
282 Ga0496101_0006901 3300048904 Bacteria 7330
283 Ga0496102_0065228 3300048905 Bacteria 3337
284 Ga0496103_0042545 3300048906 Bacteria 2796
285 Ga0496106_0017730 3300048909 Bacteria 5266
286 Ga0496107_0014261 3300048910 Bacteria 5564
287 Ga0496112_0013317 3300048915 Bacteria 7592
288 Ga0496113_0132194 3300048916 Bacteria 1959
289 Ga0496116_0000089 3300048919 Bacteria 213129
290 Ga0496117_0016276 3300048920 Bacteria 6283
291 Ga0496124_0092676 3300048927 Bacteria 2461
292 Ga0501033_0055837 3300049570 Bacteria 2919
293 Ga0501038_0478011 3300049574 Bacteria 955
294 Ga0501040_0254277 3300049576 Bacteria 1253
295 Ga0501048_0086815 3300049582 Bacteria 2207
296 Ga0501073_0229682 3300049589 Bacteria 1282
297 Ga0501077_0177136 3300049593 Bacteria 1355
298 Ga0501257_005960 3300049686 Bacteria 2699
299 Ga0501080_0310554 3300049742 Bacteria 1429
300 nmdc:mga05p37_268771_c1 3300050507 Bacteria 2038
301 nmdc:mga05p37_393987_c1 3300050507 Bacteria 1619
302 nmdc:mga05p37_398_c1 3300050507 Bacteria 47211
303 nmdc:mga05p37_524909_c1 3300050507 Bacteria 1353
304 nmdc:mga06r32_24127_c1 3300050510 Bacteria 5640
305 nmdc:mga08y16_61607_c1 3300050511 Bacteria 3918
306 nmdc:mga08y16_65959_c1 3300050511 Bacteria 3778
307 nmdc:mga08y16_827_c1 3300050511 Bacteria 29690
308 nmdc:mga0n895_119158_c1 3300050512 Bacteria 2660
309 nmdc:mga0n895_133371_c1 3300050512 Bacteria 2510
310 nmdc:mga0n895_213330_c1 3300050512 Bacteria 1960
311 nmdc:mga0n895_48073_c1 3300050512 Bacteria 4174
312 nmdc:mga0n895_75947_c1 3300050512 Bacteria 3341
313 nmdc:mga0rr50_75161_c1 3300050513 Bacteria 2589
314 nmdc:mga0a205_231007_c1 3300050515 Bacteria 1733
315 nmdc:mga0a205_26942_c1 3300050515 Bacteria 5487
316 nmdc:mga0a205_42490_c1 3300050515 Bacteria 4380
317 Ga0495612_0045199 3300053078 Bacteria 1803
318 Ga0495655_0031443 3300053083 Bacteria 1291
319 Ga0500643_000003 3300053087 Bacteria 876659
320 2740990327 2740891818 Bacteria 6711283
321 2909402798 2909399089 Bacteria 3922598
322 641336284 641228493 Bacteria 3999591
323 643390107 643348555 Bacteria 3914947
324 Ga0070689_100007523
325 Ga0065715_10037976
326 Ga0070690_100030669
327 Ga0070670_100012037
328 Ga0070670_100130304
329 Ga0068869_100071554
330 Ga0070689_100001004
331 Ga0070689_100103743
332 Ga0070689_100164509
333 Ga0070692_10043630
334 Ga0070688_100001468
335 Ga0070688_100003357
336 Ga0070688_100003419
337 Ga0070688_100014364
338 Ga0070688_100022587
339 Ga0070714_100182756
340 Ga0070713_100102718
341 Ga0070701_10023312
342 Ga0070701_10026701
343 Ga0070705_100105092
344 Ga0070694_100050519
345 Ga0070708_100056254
346 Ga0070678_100007838
347 Ga0070678_100069952
348 Ga0070681_10005681
349 Ga0070685_10027343
350 Ga0070685_10031964
351 Ga0070698_100021661
352 Ga0070698_100022661
353 Ga0070698_100273143
354 Ga0070699_100053015
355 Ga0070697_100080101
356 Ga0070696_100101322
357 Ga0070704_100110227
358 Ga0070704_100337388
359 Ga0068855_100120035
360 Ga0070664_100235164
361 Ga0068859_100014891
362 Ga0068859_100026457
363 Ga0068859_100202471
364 Ga0068864_100115907
365 Ga0068861_100001473
366 Ga0068870_10026465
367 Ga0068863_100064949
368 Ga0068862_100126978
369 Ga0068862_100209020
370 Ga0070715_10134411
371 Ga0070712_100345867
372 Ga0075428_100000051
373 Ga0075428_100020882
374 Ga0075428_100046863
375 Ga0075428_100108746
376 Ga0075430_100024323
377 Ga0075431_100237774
378 Ga0075431_100246124
379 Ga0075433_10013263
380 Ga0075433_10083475
381 Ga0075434_100008071
382 Ga0075434_100070217
383 Ga0075434_100083123
384 Ga0075434_100109251
385 Ga0097620_100014891
386 Ga0097620_100026457
387 Ga0097620_100202474
388 Ga0075435_100033356
389 Ga0075435_100246649
390 Ga0099794_10001708
391 Ga0099795_10031971
392 Ga0105244_10043457
393 Ga0111539_10000957
394 Ga0111539_10003200
395 Ga0111539_10148367
396 Ga0114129_10000175
397 Ga0114129_10082194
398 Ga0114129_10425868
399 Ga0114129_10988111
400 Ga0105242_10307736
401 Ga0105248_10382624
402 Ga0105239_10479913
403 Ga0157378_10037757
404 Ga0157375_10649520
405 Ga0157380_10006183
406 Ga0157377_10021598
407 Ga0206356_11331869
408 Ga0207685_10120801
409 Ga0207684_10077920
410 Ga0207684_10173692
411 Ga0207662_10001330
412 Ga0207662_10067677
413 Ga0207650_10029014
414 Ga0207670_10000087
415 Ga0207670_10017542
416 Ga0207670_10039159
417 Ga0207670_10087838
418 Ga0207704_10096561
419 Ga0207665_10244144
420 Ga0207689_10057945
421 Ga0207641_10342917
422 Ga0207648_10219628
423 Ga0207675_100003599
424 Ga0207683_10092754
425 Ga0207683_10181477
426 Ga0207428_10002554
427 Ga0207428_10005332
428 Ga0207428_10135665
429 Ga0268265_10137588
430 Ga0268265_10390734
431 Ga0265337_1007138
432 Ga0265337_1019802
433 Ga0265319_1000364
434 Ga0265334_10009671
435 Ga0265318_10006170
436 Ga0265338_10008823
437 Ga0265338_10011436
438 Ga0265338_10020181
439 Ga0265338_10078298
440 Ga0265339_10041463
441 Ga0316575_10000422
442 Ga0316575_10000454
443 Ga0316575_10001636
444 Ga0316575_10027505
445 Ga0316579_10000210
446 Ga0316579_10001727
447 Ga0316579_10003796
448 Ga0316579_10021345
449 Ga0316579_10085408
450 Ga0316579_10122282
451 Ga0265314_10061372
452 Ga0316576_10000682
453 Ga0316576_10001433
454 Ga0316576_10004136
455 Ga0316576_10007758
456 Ga0316576_10010145
457 Ga0316576_10045661
458 Ga0316576_10075847
459 Ga0316576_10093557
460 Ga0316576_10095028
461 Ga0316576_10125322
462 Ga0316576_10137197
463 Ga0316576_10170191
464 Ga0316576_10190849
465 Ga0316578_10003061
466 Ga0316578_10003159
467 Ga0316578_10015020
468 Ga0316578_10016850
469 Ga0316578_10043941
470 Ga0316578_10111813
471 Ga0307516_10173347
472 Ga0316577_10000057
473 Ga0316577_10004577
474 Ga0316577_10008857
475 Ga0316577_10014874
476 Ga0316577_10031747
477 Ga0316577_10042469
478 Ga0316577_10052370
479 Ga0316577_10060973
480 Ga0316577_10103576
481 Ga0316577_10111078
482 Ga0316577_10238477
483 Ga0316583_10000885
484 Ga0316583_10001024
485 Ga0316583_10006274
486 Ga0316583_10012292
487 Ga0316583_10028433
488 Ga0316583_10081407
489 Ga0316585_10000051
490 Ga0316585_10000746
491 Ga0316585_10000763
492 Ga0316580_10000412
493 Ga0316580_10000958
494 Ga0316580_10024763
495 Ga0316593_10000341
496 Ga0316592_1002521
497 Ga0316588_1000067
498 Ga0316596_1003824
499 Ga0316596_1062844
500 Ga0373934_0002967
501 Ga0373923_0000911
502 Ga0373953_0015612
503 Ga0373954_0021585
504 Ga0373955_0009142
505 Ga0373955_0174367
506 Ga0316574_0000216
507 Ga0316574_0001553
508 Ga0316574_0017858
509 Ga0316574_0231744
510 Ga0373924_0003498
511 Ga0373931_0039363
512 Ga0373931_0113266
513 Ga0373935_0222699
514 Ga0373937_0058817
515 Ga0316582_0000132
516 Ga0316582_0001758
517 Ga0316582_0002059
518 Ga0316582_0003733
519 Ga0316582_0087652
520 Ga0316582_0097694
521 Ga0316582_0267169
522 Ga0316582_0294104
523 Ga0316582_0368584
524 Ga0316584_0000316
525 Ga0316584_0001089
526 Ga0316584_0005138
527 Ga0316584_0012949
528 Ga0316584_0015088
529 Ga0316584_0021889
530 Ga0316584_0024742
531 Ga0316584_0039171
532 Ga0316584_0114704
533 Ga0395900_0624860
534 Ga0316581_0003683
535 Ga0316581_0017940
536 Ga0316581_0022265
537 Ga0400484_09039
538 Ga0400484_15071
539 Ga0400484_20439
540 Ga0400484_30698
541 Ga0400490_04711
542 Ga0400490_08608
543 Ga0400490_15484
544 Ga0400490_40890
545 Ga0400491_16990
546 Ga0400485_02560
547 Ga0400485_10082
548 Ga0400485_16123
549 Ga0400488_05118
550 Ga0400488_17797
551 Ga0400488_24496
552 Ga0400488_29210
553 Ga0400488_49919
554 Ga0400486_04992
555 Ga0400486_18892
556 Ga0400486_26506
557 Ga0400483_013842
558 Ga0400483_025710
559 Ga0400483_139799
560 Ga0400483_154560
561 Ga0400483_197763
562 Ga0400483_235229
563 Ga0400483_251877
564 Ga0400489_09400
565 Ga0400489_43195
566 Ga0400489_63755
567 Ga0400489_74021
568 Ga0400487_00656
569 Ga0400487_43234
570 Ga0400487_51409
571 Ga0436363_0945786
572 Ga0451577_0003123
573 Ga0451577_0159256
574 Ga0453683_0008948
575 Ga0466963_0017129
576 Ga0466964_0032572
577 Ga0453684_0005766
578 Ga0466971_0056399
579 Ga0466957_0031422
580 Ga0451576_0065054
581 Ga0451576_0363262
582 Ga0451576_0722434
583 Ga0466967_0056562
584 Ga0466967_0176851
585 Ga0466967_0223665
586 Ga0495592_0001783
587 Ga0495592_0131764
588 Ga0495580_0239890
589 Ga0495608_0001619
590 Ga0495618_0001293
591 Ga0495628_0045178
592 Ga0495652_0297167
593 Ga0495587_0040248
594 Ga0495625_0140907
595 Ga0495657_0042851
596 Ga0495658_0266597
597 Ga0495613_0140129
598 Ga0495604_0094549
599 Ga0495636_0002062
600 Ga0495674_0206401
601 Ga0495680_0038921
602 Ga0495680_0172664
603 Ga0495614_0041902
604 Ga0496101_0001655
605 Ga0496101_0006901
606 Ga0496102_0065228
607 Ga0496103_0042545
608 Ga0496106_0017730
609 Ga0496107_0014261
610 Ga0496112_0013317
611 Ga0496113_0132194
612 Ga0496116_0000089
613 Ga0496117_0016276
614 Ga0496124_0092676
615 Ga0501033_0055837
616 Ga0501038_0478011
617 Ga0501040_0254277
618 Ga0501048_0086815
619 Ga0501073_0229682
620 Ga0501077_0177136
621 Ga0501257_005960
622 Ga0501080_0310554
623 nmdc:mga05p37_268771_c1
624 nmdc:mga05p37_393987_c1
625 nmdc:mga05p37_398_c1
626 nmdc:mga05p37_524909_c1
627 nmdc:mga06r32_24127_c1
628 nmdc:mga08y16_61607_c1
629 nmdc:mga08y16_65959_c1
630 nmdc:mga08y16_827_c1
631 nmdc:mga0n895_119158_c1
632 nmdc:mga0n895_133371_c1
633 nmdc:mga0n895_213330_c1
634 nmdc:mga0n895_48073_c1
635 nmdc:mga0n895_75947_c1
636 nmdc:mga0rr50_75161_c1
637 nmdc:mga0a205_231007_c1
638 nmdc:mga0a205_26942_c1
639 nmdc:mga0a205_42490_c1
640 Ga0495612_0045199
641 Ga0495655_0031443
642 Ga0500643_000003
643 2740990327
644 2909402798
645 641336284
646 643390107

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02091

tRNA-synt_2e

Glycyl-tRNA synthetase alpha subunit

10

287

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lu4-assembly1.cif.gz_B crystal structure of bacterial glycyl trna synthetase in complex with glycine 0.9918 17 302
1j5w-assembly1.cif.gz_B crystal structure of glycyl-trna synthetase alpha chain (tm0216) from thermotoga maritima at 1.95 a resolution 0.9917 17 295
7xof-assembly1.cif.gz_B crystal structure of oryza sativa plastid glycyl-trna synthetase 0.9912 15 302
8ie2-assembly2.cif.gz_C crystal structure of lactiplantibacillus plantarum glyrs 0.99 14 302
7xof-assembly1.cif.gz_A crystal structure of oryza sativa plastid glycyl-trna synthetase 0.9865 15 302
ID Description Score Start End Superfamily
af_Q8L785_275_354_1.20.58.180 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Class II aaRS and biotin synthetases; domain 2 0.994 221 299 1.20.58.180
af_A0A1D6NXM7_295_374_1.20.58.180 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Class II aaRS and biotin synthetases; domain 2 0.9939 221 299 1.20.58.180
af_Q5VRH2_276_355_1.20.58.180 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Class II aaRS and biotin synthetases; domain 2 0.9937 221 299 1.20.58.180
af_A0A368UIE1_307_387_1.20.58.180 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Class II aaRS and biotin synthetases; domain 2 0.9935 221 301 1.20.58.180
1j5wB02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Class II aaRS and biotin synthetases; domain 2 0.9921 221 295 1.20.58.180
ID Description Score Start End GO Terms
AF-A0A2N2LMV4-F1-model_v4 glycine--tRNA ligase (EC 6.1.1.14) 0.9993 20 125 GO:0004820
GO:0005524
GO:0005829
GO:0006426
AF-A0A356UNJ2-F1-model_v4 deleted 0.9993 20 116
AF-A0A355C3J5-F1-model_v4 Glycine--tRNA ligase alpha subunit (EC 6.1.1.14) (Glycyl-tRNA synthetase alpha subunit) 0.9984 16 109 GO:0004820
GO:0005524
GO:0005829
GO:0006426
AF-A0A3M1BJR2-F1-model_v4 glycine--tRNA ligase (EC 6.1.1.14) 0.9983 20 125 GO:0004820
GO:0005524
GO:0005829
GO:0006426
AF-A0A523KAS1-F1-model_v4 Glycine--tRNA ligase alpha subunit (EC 6.1.1.14) (Glycyl-tRNA synthetase alpha subunit) 0.9982 20 125 GO:0004820
GO:0005524
GO:0005829
GO:0006426

Map