F406760

General Info

Members Datasets Scaffolds Average Seq Length
323 183 646 116

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_11262186|Ga0070658_112621862
Length 137
Sequence VPRRVSLPNADDLFRPTALPHQSQPHDEPDGHDQSSGERAPGAASGERRRAVAAVPEPVEDNTKGRRSSGRVRHDEKMTVYVTADELLEIEHARLMLRRDHGLAVDRGRLVRESLAIVLADLEEHGDDSELVRRLLG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
95 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
96 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
97 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
98 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
113 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
165 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
171 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
176 2643221615 Nocardioides sp. Root224 Isolate Unclassified
177 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
178 2739367898 Nocardioides sp. CF479 Isolate Unclassified
179 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
180 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
181 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
182 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
183 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.28
Metatranscriptomes 1.24
Isolates 2.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.57
Nodule 0
Rhizoplane 3.1
Rhizosphere 87.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_11262186 3300005327 Bacteria 642
2 JGI24735J21928_10079494 3300002067 Bacteria 939
3 JGI25407J50210_10038262 3300003373 Bacteria 1231
4 Ga0070658_10020360 3300005327 Bacteria 5316
5 Ga0070658_10245728 3300005327 Bacteria 1518
6 Ga0070658_10579454 3300005327 Bacteria 972
7 Ga0070683_101367248 3300005329 Bacteria 681
8 Ga0070670_101516275 3300005331 Bacteria 616
9 Ga0070682_100693523 3300005337 Bacteria 816
10 Ga0070682_101571432 3300005337 Bacteria 568
11 Ga0068868_100889576 3300005338 Bacteria 809
12 Ga0070660_100010331 3300005339 Bacteria 6593
13 Ga0070660_100316416 3300005339 Bacteria 1281
14 Ga0070660_100632269 3300005339 Bacteria 896
15 Ga0070687_100732133 3300005343 Bacteria 694
16 Ga0070687_101346019 3300005343 Bacteria 532
17 Ga0070668_101354794 3300005347 Bacteria 648
18 Ga0070669_100754050 3300005353 Bacteria 825
19 Ga0070675_101571559 3300005354 Bacteria 607
20 Ga0070674_100902095 3300005356 Bacteria 770
21 Ga0070659_100087816 3300005366 Bacteria 2490
22 Ga0070659_100292595 3300005366 Bacteria 1356
23 Ga0070659_100831965 3300005366 Bacteria 804
24 Ga0070667_101126655 3300005367 Bacteria 734
25 Ga0070667_101335397 3300005367 Bacteria 672
26 Ga0070701_10428981 3300005438 Bacteria 844
27 Ga0070700_100214682 3300005441 Bacteria 1360
28 Ga0070700_100303935 3300005441 Bacteria 1166
29 Ga0070663_100109924 3300005455 Bacteria 2070
30 Ga0070663_101550679 3300005455 Bacteria 590
31 Ga0070685_10548412 3300005466 Bacteria 825
32 Ga0070679_101664439 3300005530 Bacteria 586
33 Ga0070684_101676637 3300005535 Bacteria 600
34 Ga0070672_100349550 3300005543 Bacteria 1260
35 Ga0070672_101735900 3300005543 Bacteria 561
36 Ga0070664_100946184 3300005564 Bacteria 809
37 Ga0068857_101405439 3300005577 Bacteria 679
38 Ga0068854_102023918 3300005578 Bacteria 531
39 Ga0068852_100610657 3300005616 Bacteria 1096
40 Ga0068859_101824054 3300005617 Bacteria 672
41 Ga0068859_102031500 3300005617 Bacteria 635
42 Ga0068861_100626302 3300005719 Bacteria 991
43 Ga0068861_102013633 3300005719 Bacteria 576
44 Ga0068851_10921554 3300005834 Bacteria 548
45 Ga0081455_10007532 3300005937 Bacteria 11449
46 Ga0081538_10000387 3300005981 Bacteria 50077
47 Ga0081539_10135343 3300005985 Bacteria 1205
48 Ga0075365_10056971 3300006038 Bacteria 2599
49 Ga0075365_10241639 3300006038 Bacteria 1268
50 Ga0075365_10309706 3300006038 Bacteria 1112
51 Ga0075368_10088921 3300006042 Bacteria 1262
52 Ga0075364_10047104 3300006051 Bacteria 2807
53 Ga0075364_10187389 3300006051 Bacteria 1401
54 Ga0075367_10193819 3300006178 Bacteria 1268
55 Ga0075367_10990198 3300006178 Bacteria 537
56 Ga0097620_101824180 3300006931 Bacteria 672
57 Ga0097620_102031650 3300006931 Bacteria 635
58 Ga0111539_11529806 3300009094 Bacteria 774
59 Ga0105245_11279572 3300009098 Bacteria 782
60 Ga0105243_10190866 3300009148 Bacteria 1789
61 Ga0105243_10981280 3300009148 Bacteria 846
62 Ga0105243_11030972 3300009148 Bacteria 827
63 Ga0105241_11629525 3300009174 Bacteria 625
64 Ga0105248_10581247 3300009177 Bacteria 1264
65 Ga0105237_10148925 3300009545 Bacteria 2336
66 Ga0105239_10074228 3300010375 Bacteria 3740
67 Ga0105239_11674634 3300010375 Bacteria 736
68 Ga0105246_10211506 3300011119 Bacteria 1514
69 Ga0157317_1002889 3300012475 Bacteria 1041
70 Ga0157370_10363715 3300013104 Bacteria 1333
71 Ga0157372_10549834 3300013307 Bacteria 1346
72 Ga0157375_10073067 3300013308 Bacteria 3448
73 Ga0157375_10409888 3300013308 Bacteria 1521
74 Ga0157375_11612624 3300013308 Bacteria 767
75 Ga0157375_11616482 3300013308 Bacteria 766
76 Ga0163163_10396362 3300014325 Bacteria 1438
77 Ga0163163_10487702 3300014325 Bacteria 1294
78 Ga0163163_11963733 3300014325 Bacteria 645
79 Ga0157380_10722463 3300014326 Bacteria 1004
80 Ga0163161_10266630 3300017792 Bacteria 1339
81 Ga0206356_11336353 3300020070 Bacteria 648
82 Ga0206354_10558815 3300020081 Bacteria 805
83 Ga0206353_11774518 3300020082 Bacteria 751
84 Ga0207688_10316246 3300025901 Bacteria 957
85 Ga0207647_10019857 3300025904 Bacteria 4511
86 Ga0207643_10284044 3300025908 Bacteria 1027
87 Ga0207705_10199595 3300025909 Bacteria 1515
88 Ga0207671_10055636 3300025914 Bacteria 2931
89 Ga0207662_11076727 3300025918 Bacteria 571
90 Ga0207657_10008485 3300025919 Bacteria 10424
91 Ga0207657_10029083 3300025919 Bacteria 5034
92 Ga0207657_10175837 3300025919 Bacteria 1732
93 Ga0207649_11117513 3300025920 Bacteria 622
94 Ga0207659_10662132 3300025926 Bacteria 893
95 Ga0207690_10030068 3300025932 Bacteria 3460
96 Ga0207690_10554415 3300025932 Bacteria 935
97 Ga0207706_10247824 3300025933 Bacteria 1556
98 Ga0207709_10611200 3300025935 Bacteria 864
99 Ga0207709_11249571 3300025935 Bacteria 613
100 Ga0207691_10236560 3300025940 Bacteria 1580
101 Ga0207691_10442822 3300025940 Bacteria 1106
102 Ga0207679_10607379 3300025945 Bacteria 986
103 Ga0207668_10670920 3300025972 Bacteria 909
104 Ga0207640_10331305 3300025981 Bacteria 1216
105 Ga0207658_10566320 3300025986 Bacteria 1018
106 Ga0207677_11379859 3300026023 Bacteria 649
107 Ga0207678_10803539 3300026067 Bacteria 830
108 Ga0207708_10033379 3300026075 Bacteria 3910
109 Ga0207708_10547640 3300026075 Bacteria 975
110 Ga0207676_11402717 3300026095 Bacteria 695
111 Ga0207675_100047159 3300026118 Bacteria 4023
112 Ga0207675_100903363 3300026118 Bacteria 900
113 Ga0207698_10038808 3300026142 Bacteria 3522
114 Ga0207698_10672469 3300026142 Bacteria 1028
115 Ga0307408_100313556 3300031548 Bacteria 1319
116 Ga0307405_10056339 3300031731 Bacteria 2465
117 Ga0307413_10561619 3300031824 Bacteria 928
118 Ga0307410_10266971 3300031852 Bacteria 1337
119 Ga0307410_10305978 3300031852 Bacteria 1256
120 Ga0307410_10679786 3300031852 Bacteria 866
121 Ga0307410_11131788 3300031852 Bacteria 680
122 Ga0307406_10116227 3300031901 Bacteria 1851
123 Ga0307412_10862101 3300031911 Bacteria 791
124 Ga0307412_11014886 3300031911 Bacteria 734
125 Ga0307412_11317465 3300031911 Bacteria 651
126 Ga0307409_100066500 3300031995 Bacteria 2843
127 Ga0307409_100081278 3300031995 Bacteria 2619
128 Ga0307409_100179821 3300031995 Bacteria 1871
129 Ga0307409_100846012 3300031995 Bacteria 925
130 Ga0307409_101816493 3300031995 Bacteria 639
131 Ga0307416_100003451 3300032002 Bacteria 9283
132 Ga0307416_100337284 3300032002 Bacteria 1518
133 Ga0307416_101214148 3300032002 Bacteria 860
134 Ga0307416_101389832 3300032002 Bacteria 808
135 Ga0307414_10138211 3300032004 Bacteria 1903
136 Ga0307414_10414621 3300032004 Bacteria 1173
137 Ga0307414_10760898 3300032004 Bacteria 881
138 Ga0307411_10367011 3300032005 Bacteria 1179
139 Ga0307415_100000763 3300032126 Bacteria 14539
140 Ga0307415_100193554 3300032126 Bacteria 1607
141 Ga0307415_100215160 3300032126 Bacteria 1536
142 Ga0307415_100687243 3300032126 Bacteria 922
143 Ga0307415_101104850 3300032126 Bacteria 742
144 Ga0373951_0238716 3300035091 Bacteria 542
145 Ga0395900_0081885 3300037418 Bacteria 3316
146 Ga0395898_0146193 3300037466 Bacteria 2262
147 Ga0395901_0027485 3300038443 Bacteria 5846
148 Ga0451833_0175276 3300041491 Bacteria 835
149 Ga0451853_0453886 3300041512 Bacteria 607
150 Ga0451853_1053612 3300041512 Bacteria 565
151 Ga0451853_1467797 3300041512 Bacteria 635
152 Ga0439434_0341608 3300042435 Bacteria 522
153 Ga0439464_0016081 3300042439 Bacteria 2022
154 Ga0466969_0025606 3300044656 Bacteria 3032
155 Ga0466969_0557201 3300044656 Bacteria 525
156 Ga0466972_0175045 3300044658 Bacteria 1007
157 Ga0466966_0008745 3300044684 Bacteria 6702
158 Ga0466966_0204633 3300044684 Bacteria 1194
159 Ga0466966_0424758 3300044684 Bacteria 799
160 Ga0466961_0023396 3300044693 Bacteria 3975
161 Ga0466961_0115986 3300044693 Bacteria 1683
162 Ga0466961_0151600 3300044693 Bacteria 1447
163 Ga0466961_0581798 3300044693 Bacteria 674
164 Ga0466961_0958751 3300044693 Bacteria 509
165 Ga0466963_0123828 3300044694 Bacteria 1781
166 Ga0466963_0129585 3300044694 Bacteria 1741
167 Ga0466963_0979282 3300044694 Bacteria 595
168 Ga0466964_0019654 3300044706 Bacteria 2598
169 Ga0466971_0125967 3300044719 Bacteria 1187
170 Ga0466968_0016476 3300044735 Bacteria 2944
171 Ga0466970_0003277 3300044765 Bacteria 7870
172 Ga0466970_0010133 3300044765 Bacteria 4776
173 Ga0466970_0021687 3300044765 Bacteria 3347
174 Ga0466970_0090533 3300044765 Bacteria 1660
175 Ga0466957_0005979 3300044842 Bacteria 6865
176 Ga0466957_0412959 3300044842 Bacteria 925
177 Ga0466960_0033097 3300044901 Bacteria 2400
178 Ga0466960_0104439 3300044901 Bacteria 1463
179 Ga0466960_0228467 3300044901 Bacteria 1026
180 Ga0466958_0016493 3300045836 Bacteria 4254
181 Ga0466958_0061412 3300045836 Bacteria 2289
182 Ga0466967_0030180 3300045976 Bacteria 4547
183 Ga0466967_0164787 3300045976 Bacteria 2082
184 Ga0466967_0300301 3300045976 Bacteria 1545
185 Ga0466967_1931511 3300045976 Bacteria 587
186 Ga0495629_0622349 3300046459 Bacteria 721
187 Ga0495664_0341943 3300046477 Bacteria 901
188 Ga0495620_0193385 3300046515 Bacteria 784
189 Ga0495668_0391112 3300046616 Bacteria 764
190 Ga0495635_0193283 3300046663 Bacteria 1381
191 Ga0495657_0108308 3300046675 Bacteria 1763
192 Ga0495657_0211514 3300046675 Bacteria 1179
193 Ga0495658_0928240 3300046683 Bacteria 556
194 Ga0495604_0798836 3300047317 Bacteria 594
195 Ga0495674_0183620 3300047319 Bacteria 1741
196 Ga0495593_0145028 3300047673 Bacteria 1202
197 Ga0496102_0192873 3300048905 Bacteria 1920
198 Ga0496102_0360494 3300048905 Bacteria 1369
199 Ga0496107_0177653 3300048910 Bacteria 1581
200 Ga0496108_1016892 3300048911 Bacteria 707
201 Ga0496109_0957144 3300048912 Bacteria 794
202 Ga0496109_1912380 3300048912 Bacteria 526
203 Ga0496110_0201614 3300048913 Bacteria 1808
204 Ga0496111_0217676 3300048914 Bacteria 1419
205 Ga0496113_0190453 3300048916 Bacteria 1628
206 Ga0496114_0548228 3300048917 Bacteria 1022
207 Ga0501318_013480 3300049534 Bacteria 951
208 Ga0501031_0012197 3300049568 Bacteria 5601
209 Ga0501031_0129832 3300049568 Bacteria 1646
210 Ga0501031_0531436 3300049568 Bacteria 758
211 Ga0501031_0834447 3300049568 Bacteria 591
212 Ga0501032_0109122 3300049569 Bacteria 1832
213 Ga0501032_0295058 3300049569 Bacteria 1048
214 Ga0501032_0437438 3300049569 Bacteria 838
215 Ga0501033_0076515 3300049570 Bacteria 2457
216 Ga0501034_0680934 3300049571 Bacteria 928
217 Ga0501036_0007877 3300049572 Bacteria 8714
218 Ga0501036_0011645 3300049572 Bacteria 7291
219 Ga0501036_0084617 3300049572 Bacteria 2681
220 Ga0501036_0512685 3300049572 Bacteria 997
221 Ga0501037_0023904 3300049573 Bacteria 4520
222 Ga0501037_0046541 3300049573 Bacteria 3181
223 Ga0501037_0097612 3300049573 Bacteria 2123
224 Ga0501038_0002247 3300049574 Bacteria 17944
225 Ga0501038_0013224 3300049574 Bacteria 7527
226 Ga0501038_0297547 3300049574 Bacteria 1267
227 Ga0501038_0445847 3300049574 Bacteria 996
228 Ga0501039_0030958 3300049575 Bacteria 4126
229 Ga0501039_0047483 3300049575 Bacteria 3319
230 Ga0501039_0298079 3300049575 Bacteria 1267
231 Ga0501039_0784685 3300049575 Bacteria 743
232 Ga0501040_0004140 3300049576 Bacteria 9436
233 Ga0501040_0007370 3300049576 Bacteria 7122
234 Ga0501040_0056186 3300049576 Bacteria 2701
235 Ga0501040_0057347 3300049576 Bacteria 2674
236 Ga0501040_0299114 3300049576 Bacteria 1150
237 Ga0501040_1154934 3300049576 Bacteria 562
238 Ga0501040_1246713 3300049576 Bacteria 540
239 Ga0501041_0058916 3300049577 Bacteria 2350
240 Ga0501042_0138091 3300049578 Bacteria 1757
241 Ga0501042_0211131 3300049578 Bacteria 1400
242 Ga0501042_0251534 3300049578 Bacteria 1275
243 Ga0501042_0262590 3300049578 Bacteria 1246
244 Ga0501042_0540075 3300049578 Bacteria 847
245 Ga0501043_0270011 3300049579 Bacteria 1306
246 Ga0501043_0359798 3300049579 Bacteria 1105
247 Ga0501043_0383297 3300049579 Bacteria 1064
248 Ga0501043_0926286 3300049579 Bacteria 624
249 Ga0501046_0010074 3300049580 Bacteria 8139
250 Ga0501046_0201661 3300049580 Bacteria 1480
251 Ga0501047_0016884 3300049581 Bacteria 6976
252 Ga0501048_0003751 3300049582 Bacteria 11593
253 Ga0501048_0140113 3300049582 Bacteria 1710
254 Ga0501048_0911023 3300049582 Bacteria 632
255 Ga0501068_0523788 3300049584 Bacteria 770
256 Ga0501069_0021407 3300049585 Bacteria 3509
257 Ga0501069_0310414 3300049585 Bacteria 926
258 Ga0501070_0030233 3300049586 Bacteria 4539
259 Ga0501070_0240928 3300049586 Bacteria 1480
260 Ga0501070_0249668 3300049586 Bacteria 1451
261 Ga0501070_1340446 3300049586 Bacteria 545
262 Ga0501071_0044139 3300049587 Bacteria 3197
263 Ga0501071_0154643 3300049587 Bacteria 1712
264 Ga0501071_0272197 3300049587 Bacteria 1280
265 Ga0501071_1069455 3300049587 Bacteria 623
266 Ga0501072_0100158 3300049588 Bacteria 2303
267 Ga0501072_0124270 3300049588 Bacteria 2056
268 Ga0501072_0146974 3300049588 Bacteria 1879
269 Ga0501074_0030452 3300049590 Bacteria 3911
270 Ga0501074_0181833 3300049590 Bacteria 1500
271 Ga0501074_0341203 3300049590 Bacteria 1063
272 Ga0501075_0048539 3300049591 Bacteria 3190
273 Ga0501075_0326582 3300049591 Bacteria 1169
274 Ga0501075_0559164 3300049591 Bacteria 873
275 Ga0501076_0066489 3300049592 Bacteria 2877
276 Ga0501076_0070973 3300049592 Bacteria 2786
277 Ga0501076_0551106 3300049592 Bacteria 951
278 Ga0501077_0130772 3300049593 Bacteria 1591
279 Ga0501214_022917 3300049659 Bacteria 807
280 Ga0501079_0007385 3300049741 Bacteria 8316
281 Ga0501080_0536171 3300049742 Bacteria 1043
282 Ga0501081_0073000 3300049743 Bacteria 2393
283 Ga0501035_0011369 3300049822 Bacteria 8251
284 Ga0501035_0242614 3300049822 Bacteria 1532
285 Ga0501035_1079752 3300049822 Bacteria 628
286 Ga0501044_0012586 3300049823 Bacteria 9163
287 Ga0501044_0480495 3300049823 Bacteria 1146
288 Ga0501044_0656841 3300049823 Bacteria 937
289 Ga0501045_0056380 3300049824 Bacteria 2873
290 Ga0501045_0105275 3300049824 Bacteria 2090
291 Ga0501045_0180020 3300049824 Bacteria 1575
292 Ga0501045_0460426 3300049824 Bacteria 945
293 nmdc:mga00v17_98134_c1 3300050491 Bacteria 1847
294 nmdc:mga0yw44_14178_c1 3300050492 Bacteria 4221
295 nmdc:mga0yw44_187766_c1 3300050492 Bacteria 1362
296 nmdc:mga0yw44_19119_c1 3300050492 Bacteria 3771
297 nmdc:mga0yw44_47613_c1 3300050492 Bacteria 2582
298 nmdc:mga06z11_17387_c1 3300050494 Bacteria 3262
299 nmdc:mga04h51_57968_c1 3300050495 Bacteria 1319
300 nmdc:mga07m45_725505_c1 3300050496 Bacteria 571
301 nmdc:mga08y16_1320066_c1 3300050511 Bacteria 687
302 Ga0495601_0175648 3300053077 Bacteria 1400
303 Ga0495601_0312790 3300053077 Bacteria 1023
304 Ga0495612_0139479 3300053078 Bacteria 1051
305 Ga0495619_0023713 3300053085 Bacteria 3934
306 Ga0500628_168439 3300053129 Bacteria 621
307 Ga0500573_0017278 3300053140 Bacteria 4106
308 Ga0501084_0047698 3300054114 Bacteria 3587
309 Ga0501084_0202767 3300054114 Bacteria 1674
310 Ga0501082_0472687 3300060353 Bacteria 1095
311 Ga0501082_0871955 3300060353 Bacteria 787
312 Ga0466962_0007658 3300061719 Bacteria 5173
313 Ga0466962_0028514 3300061719 Bacteria 2674
314 Ga0530510_0604828 3300061734 Bacteria 834
315 Ga0530510_0671044 3300061734 Bacteria 789
316 2644090352 2643221615 Bacteria 5487866
317 2644320198 2643221657 Bacteria 5490246
318 2740168843 2739367898 Bacteria 4367674
319 2774392807 2773857762 Bacteria 5971770
320 2809196629 2808606439 Bacteria 5952208
321 2812351235 2811994878 Bacteria 5992952
322 2855391010 2855386786 Bacteria 4752232
323 2891971147 2891968417 Bacteria 5821697
324 Ga0070658_11262186
325 JGI24735J21928_10079494
326 JGI25407J50210_10038262
327 Ga0070658_10020360
328 Ga0070658_10245728
329 Ga0070658_10579454
330 Ga0070683_101367248
331 Ga0070670_101516275
332 Ga0070682_100693523
333 Ga0070682_101571432
334 Ga0068868_100889576
335 Ga0070660_100010331
336 Ga0070660_100316416
337 Ga0070660_100632269
338 Ga0070687_100732133
339 Ga0070687_101346019
340 Ga0070668_101354794
341 Ga0070669_100754050
342 Ga0070675_101571559
343 Ga0070674_100902095
344 Ga0070659_100087816
345 Ga0070659_100292595
346 Ga0070659_100831965
347 Ga0070667_101126655
348 Ga0070667_101335397
349 Ga0070701_10428981
350 Ga0070700_100214682
351 Ga0070700_100303935
352 Ga0070663_100109924
353 Ga0070663_101550679
354 Ga0070685_10548412
355 Ga0070679_101664439
356 Ga0070684_101676637
357 Ga0070672_100349550
358 Ga0070672_101735900
359 Ga0070664_100946184
360 Ga0068857_101405439
361 Ga0068854_102023918
362 Ga0068852_100610657
363 Ga0068859_101824054
364 Ga0068859_102031500
365 Ga0068861_100626302
366 Ga0068861_102013633
367 Ga0068851_10921554
368 Ga0081455_10007532
369 Ga0081538_10000387
370 Ga0081539_10135343
371 Ga0075365_10056971
372 Ga0075365_10241639
373 Ga0075365_10309706
374 Ga0075368_10088921
375 Ga0075364_10047104
376 Ga0075364_10187389
377 Ga0075367_10193819
378 Ga0075367_10990198
379 Ga0097620_101824180
380 Ga0097620_102031650
381 Ga0111539_11529806
382 Ga0105245_11279572
383 Ga0105243_10190866
384 Ga0105243_10981280
385 Ga0105243_11030972
386 Ga0105241_11629525
387 Ga0105248_10581247
388 Ga0105237_10148925
389 Ga0105239_10074228
390 Ga0105239_11674634
391 Ga0105246_10211506
392 Ga0157317_1002889
393 Ga0157370_10363715
394 Ga0157372_10549834
395 Ga0157375_10073067
396 Ga0157375_10409888
397 Ga0157375_11612624
398 Ga0157375_11616482
399 Ga0163163_10396362
400 Ga0163163_10487702
401 Ga0163163_11963733
402 Ga0157380_10722463
403 Ga0163161_10266630
404 Ga0206356_11336353
405 Ga0206354_10558815
406 Ga0206353_11774518
407 Ga0207688_10316246
408 Ga0207647_10019857
409 Ga0207643_10284044
410 Ga0207705_10199595
411 Ga0207671_10055636
412 Ga0207662_11076727
413 Ga0207657_10008485
414 Ga0207657_10029083
415 Ga0207657_10175837
416 Ga0207649_11117513
417 Ga0207659_10662132
418 Ga0207690_10030068
419 Ga0207690_10554415
420 Ga0207706_10247824
421 Ga0207709_10611200
422 Ga0207709_11249571
423 Ga0207691_10236560
424 Ga0207691_10442822
425 Ga0207679_10607379
426 Ga0207668_10670920
427 Ga0207640_10331305
428 Ga0207658_10566320
429 Ga0207677_11379859
430 Ga0207678_10803539
431 Ga0207708_10033379
432 Ga0207708_10547640
433 Ga0207676_11402717
434 Ga0207675_100047159
435 Ga0207675_100903363
436 Ga0207698_10038808
437 Ga0207698_10672469
438 Ga0307408_100313556
439 Ga0307405_10056339
440 Ga0307413_10561619
441 Ga0307410_10266971
442 Ga0307410_10305978
443 Ga0307410_10679786
444 Ga0307410_11131788
445 Ga0307406_10116227
446 Ga0307412_10862101
447 Ga0307412_11014886
448 Ga0307412_11317465
449 Ga0307409_100066500
450 Ga0307409_100081278
451 Ga0307409_100179821
452 Ga0307409_100846012
453 Ga0307409_101816493
454 Ga0307416_100003451
455 Ga0307416_100337284
456 Ga0307416_101214148
457 Ga0307416_101389832
458 Ga0307414_10138211
459 Ga0307414_10414621
460 Ga0307414_10760898
461 Ga0307411_10367011
462 Ga0307415_100000763
463 Ga0307415_100193554
464 Ga0307415_100215160
465 Ga0307415_100687243
466 Ga0307415_101104850
467 Ga0373951_0238716
468 Ga0395900_0081885
469 Ga0395898_0146193
470 Ga0395901_0027485
471 Ga0451833_0175276
472 Ga0451853_0453886
473 Ga0451853_1053612
474 Ga0451853_1467797
475 Ga0439434_0341608
476 Ga0439464_0016081
477 Ga0466969_0025606
478 Ga0466969_0557201
479 Ga0466972_0175045
480 Ga0466966_0008745
481 Ga0466966_0204633
482 Ga0466966_0424758
483 Ga0466961_0023396
484 Ga0466961_0115986
485 Ga0466961_0151600
486 Ga0466961_0581798
487 Ga0466961_0958751
488 Ga0466963_0123828
489 Ga0466963_0129585
490 Ga0466963_0979282
491 Ga0466964_0019654
492 Ga0466971_0125967
493 Ga0466968_0016476
494 Ga0466970_0003277
495 Ga0466970_0010133
496 Ga0466970_0021687
497 Ga0466970_0090533
498 Ga0466957_0005979
499 Ga0466957_0412959
500 Ga0466960_0033097
501 Ga0466960_0104439
502 Ga0466960_0228467
503 Ga0466958_0016493
504 Ga0466958_0061412
505 Ga0466967_0030180
506 Ga0466967_0164787
507 Ga0466967_0300301
508 Ga0466967_1931511
509 Ga0495629_0622349
510 Ga0495664_0341943
511 Ga0495620_0193385
512 Ga0495668_0391112
513 Ga0495635_0193283
514 Ga0495657_0108308
515 Ga0495657_0211514
516 Ga0495658_0928240
517 Ga0495604_0798836
518 Ga0495674_0183620
519 Ga0495593_0145028
520 Ga0496102_0192873
521 Ga0496102_0360494
522 Ga0496107_0177653
523 Ga0496108_1016892
524 Ga0496109_0957144
525 Ga0496109_1912380
526 Ga0496110_0201614
527 Ga0496111_0217676
528 Ga0496113_0190453
529 Ga0496114_0548228
530 Ga0501318_013480
531 Ga0501031_0012197
532 Ga0501031_0129832
533 Ga0501031_0531436
534 Ga0501031_0834447
535 Ga0501032_0109122
536 Ga0501032_0295058
537 Ga0501032_0437438
538 Ga0501033_0076515
539 Ga0501034_0680934
540 Ga0501036_0007877
541 Ga0501036_0011645
542 Ga0501036_0084617
543 Ga0501036_0512685
544 Ga0501037_0023904
545 Ga0501037_0046541
546 Ga0501037_0097612
547 Ga0501038_0002247
548 Ga0501038_0013224
549 Ga0501038_0297547
550 Ga0501038_0445847
551 Ga0501039_0030958
552 Ga0501039_0047483
553 Ga0501039_0298079
554 Ga0501039_0784685
555 Ga0501040_0004140
556 Ga0501040_0007370
557 Ga0501040_0056186
558 Ga0501040_0057347
559 Ga0501040_0299114
560 Ga0501040_1154934
561 Ga0501040_1246713
562 Ga0501041_0058916
563 Ga0501042_0138091
564 Ga0501042_0211131
565 Ga0501042_0251534
566 Ga0501042_0262590
567 Ga0501042_0540075
568 Ga0501043_0270011
569 Ga0501043_0359798
570 Ga0501043_0383297
571 Ga0501043_0926286
572 Ga0501046_0010074
573 Ga0501046_0201661
574 Ga0501047_0016884
575 Ga0501048_0003751
576 Ga0501048_0140113
577 Ga0501048_0911023
578 Ga0501068_0523788
579 Ga0501069_0021407
580 Ga0501069_0310414
581 Ga0501070_0030233
582 Ga0501070_0240928
583 Ga0501070_0249668
584 Ga0501070_1340446
585 Ga0501071_0044139
586 Ga0501071_0154643
587 Ga0501071_0272197
588 Ga0501071_1069455
589 Ga0501072_0100158
590 Ga0501072_0124270
591 Ga0501072_0146974
592 Ga0501074_0030452
593 Ga0501074_0181833
594 Ga0501074_0341203
595 Ga0501075_0048539
596 Ga0501075_0326582
597 Ga0501075_0559164
598 Ga0501076_0066489
599 Ga0501076_0070973
600 Ga0501076_0551106
601 Ga0501077_0130772
602 Ga0501214_022917
603 Ga0501079_0007385
604 Ga0501080_0536171
605 Ga0501081_0073000
606 Ga0501035_0011369
607 Ga0501035_0242614
608 Ga0501035_1079752
609 Ga0501044_0012586
610 Ga0501044_0480495
611 Ga0501044_0656841
612 Ga0501045_0056380
613 Ga0501045_0105275
614 Ga0501045_0180020
615 Ga0501045_0460426
616 nmdc:mga00v17_98134_c1
617 nmdc:mga0yw44_14178_c1
618 nmdc:mga0yw44_187766_c1
619 nmdc:mga0yw44_19119_c1
620 nmdc:mga0yw44_47613_c1
621 nmdc:mga06z11_17387_c1
622 nmdc:mga04h51_57968_c1
623 nmdc:mga07m45_725505_c1
624 nmdc:mga08y16_1320066_c1
625 Ga0495601_0175648
626 Ga0495601_0312790
627 Ga0495612_0139479
628 Ga0495619_0023713
629 Ga0500628_168439
630 Ga0500573_0017278
631 Ga0501084_0047698
632 Ga0501084_0202767
633 Ga0501082_0472687
634 Ga0501082_0871955
635 Ga0466962_0007658
636 Ga0466962_0028514
637 Ga0530510_0604828
638 Ga0530510_0671044
639 2644090352
640 2644320198
641 2740168843
642 2774392807
643 2809196629
644 2812351235
645 2855391010
646 2891971147

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map