F406670

General Info

Members Datasets Scaffolds Average Seq Length
322 210 644 118

Family's Representative Sequence

Representative Sequence 3300050515|nmdc:mga0a205_40776_c1|nmdc:mga0a205_40776_c1_3536_3943
Length 135
Sequence LADFARPFSVLGRNDMLKTSRLFAAIALGLALSGCSLAVRRPSVAELKYNPGRYQDRTVAIDGVVTSSWGIPLMPFRLYKIDDGTGELTVVSQGGRVPTRGSHVRVKGRVSDVATFGGQAIGLHLQQRDIDFKRR

Samples

Sample ID Description Type Environment
1 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
149 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
150 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
151 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
152 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
153 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
156 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
157 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
158 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
159 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
160 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
161 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
177 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
178 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
191 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
192 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
193 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
194 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
195 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
205 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
206 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
207 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 1.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 0
Rhizoplane 5.28
Rhizosphere 93.48
Stem 0
Stem Tuber 0
Unclassified 34.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0a205_40776_c1 3300050515 Bacteria 4470
2 Ga0065704_10162363 3300005289 Unclassified 1345
3 Ga0065715_10036237 3300005293 Bacteria 1024
4 Ga0065715_10037469 3300005293 Bacteria 1242
5 Ga0065715_10103594 3300005293 Bacteria 3023
6 Ga0065707_10090805 3300005295 Bacteria 4064
7 Ga0070676_10007162 3300005328 Bacteria 5975
8 Ga0070676_11072507 3300005328 Unclassified 608
9 Ga0070683_100006077 3300005329 Bacteria 10122
10 Ga0070690_100043032 3300005330 Bacteria 2862
11 Ga0070670_100195548 3300005331 Bacteria 1757
12 Ga0070670_101121077 3300005331 Bacteria 718
13 Ga0070677_10326198 3300005333 Bacteria 788
14 Ga0068869_100153679 3300005334 Bacteria 1786
15 Ga0068869_101085726 3300005334 Bacteria 700
16 Ga0070666_10192187 3300005335 Unclassified 1434
17 Ga0070680_101109937 3300005336 Unclassified 684
18 Ga0068868_100121409 3300005338 Bacteria 2132
19 Ga0070660_100130200 3300005339 Bacteria 2013
20 Ga0070689_100369452 3300005340 Unclassified 1207
21 Ga0070691_10041925 3300005341 Bacteria 2165
22 Ga0070691_10413246 3300005341 Unclassified 763
23 Ga0070687_100016675 3300005343 Bacteria 3358
24 Ga0070692_10043981 3300005345 Unclassified 2299
25 Ga0070669_100004488 3300005353 Bacteria 10064
26 Ga0070669_100092626 3300005353 Bacteria 2268
27 Ga0070669_100632882 3300005353 Bacteria 899
28 Ga0070675_101918534 3300005354 Bacteria 546
29 Ga0070671_100048718 3300005355 Bacteria 3524
30 Ga0070671_100065940 3300005355 Unclassified 3017
31 Ga0070674_100208319 3300005356 Bacteria 1514
32 Ga0070674_101067554 3300005356 Unclassified 712
33 Ga0070673_100017931 3300005364 Bacteria 5046
34 Ga0070673_100899892 3300005364 Bacteria 821
35 Ga0070673_101326267 3300005364 Unclassified 676
36 Ga0070688_100035589 3300005365 Archaea 3025
37 Ga0070688_100083949 3300005365 Unclassified 2068
38 Ga0070659_101083056 3300005366 Unclassified 706
39 Ga0070667_100059205 3300005367 Bacteria 3240
40 Ga0070667_100360273 3300005367 Archaea 1318
41 Ga0070701_10190463 3300005438 Bacteria 1206
42 Ga0070701_10759960 3300005438 Unclassified 657
43 Ga0070711_100316214 3300005439 Bacteria 1246
44 Ga0070705_100342764 3300005440 Bacteria 1087
45 Ga0070700_100108889 3300005441 Bacteria 1838
46 Ga0070700_100424379 3300005441 Bacteria 1006
47 Ga0070694_100568595 3300005444 Unclassified 910
48 Ga0070694_101554851 3300005444 Unclassified 561
49 Ga0070663_100039108 3300005455 Bacteria 3313
50 Ga0070663_100203339 3300005455 Bacteria 1547
51 Ga0070663_101441399 3300005455 Bacteria 611
52 Ga0070678_100114695 3300005456 Bacteria 2114
53 Ga0070681_10474245 3300005458 Unclassified 1164
54 Ga0068867_100007269 3300005459 Bacteria 7833
55 Ga0070685_11328834 3300005466 Bacteria 550
56 Ga0070699_100072215 3300005518 Unclassified 3002
57 Ga0070684_100000247 3300005535 Bacteria 37390
58 Ga0070697_100103916 3300005536 Bacteria 2362
59 Ga0070672_100023416 3300005543 Unclassified 4552
60 Ga0070672_100504784 3300005543 Unclassified 1047
61 Ga0070686_100083162 3300005544 Bacteria 2124
62 Ga0070695_100013647 3300005545 Bacteria 4883
63 Ga0070695_100346581 3300005545 Bacteria 1112
64 Ga0070695_101690831 3300005545 Unclassified 530
65 Ga0070696_100083102 3300005546 Bacteria 2271
66 Ga0070696_100659626 3300005546 Unclassified 849
67 Ga0070693_100112541 3300005547 Unclassified 1677
68 Ga0070704_100015714 3300005549 Bacteria 4765
69 Ga0070704_100033633 3300005549 Bacteria 3468
70 Ga0068855_101581834 3300005563 Bacteria 671
71 Ga0070664_100001088 3300005564 Bacteria 21412
72 Ga0070664_100754095 3300005564 Unclassified 909
73 Ga0070664_101223559 3300005564 Unclassified 709
74 Ga0070664_101296907 3300005564 Bacteria 688
75 Ga0068857_100031455 3300005577 Bacteria 4690
76 Ga0068854_100017348 3300005578 Bacteria 4817
77 Ga0070702_100077038 3300005615 Unclassified 1986
78 Ga0070702_101766033 3300005615 Bacteria 516
79 Ga0068852_102026504 3300005616 Bacteria 598
80 Ga0068859_100214589 3300005617 Bacteria 2011
81 Ga0068864_101829505 3300005618 Unclassified 613
82 Ga0068870_10553840 3300005840 Unclassified 775
83 Ga0068863_100344088 3300005841 Unclassified 1451
84 Ga0068858_100031397 3300005842 Bacteria 4934
85 Ga0068860_100125177 3300005843 Bacteria 2463
86 Ga0068862_100138999 3300005844 Bacteria 2155
87 Ga0068862_100308014 3300005844 Bacteria 1459
88 Ga0068862_101108546 3300005844 Bacteria 787
89 Ga0081455_10334441 3300005937 Bacteria 1074
90 Ga0075427_10049852 3300006194 Bacteria 719
91 Ga0097621_100675882 3300006237 Unclassified 949
92 Ga0097621_100741121 3300006237 Unclassified 907
93 Ga0068871_100314251 3300006358 Unclassified 1378
94 Ga0068871_100403358 3300006358 Bacteria 1218
95 Ga0075428_100004987 3300006844 Bacteria 14742
96 Ga0075428_100007502 3300006844 Bacteria 12086
97 Ga0075428_101006773 3300006844 Bacteria 882
98 Ga0075428_101155738 3300006844 Unclassified 817
99 Ga0075430_100074139 3300006846 Bacteria 2853
100 Ga0075430_100105748 3300006846 Unclassified 2348
101 Ga0075431_100056523 3300006847 Bacteria 4047
102 Ga0075433_10031720 3300006852 Bacteria 4519
103 Ga0075433_10458334 3300006852 Bacteria 1124
104 Ga0075434_100210954 3300006871 Unclassified 1962
105 Ga0075429_100008791 3300006880 Bacteria 8781
106 Ga0075429_100091046 3300006880 Bacteria 2661
107 Ga0068865_100303566 3300006881 Bacteria 1278
108 Ga0097620_100214577 3300006931 Bacteria 2011
109 Ga0075435_100002471 3300007076 Bacteria 12289
110 Ga0075435_100008523 3300007076 Bacteria 7365
111 Ga0105240_10366473 3300009093 Archaea 1630
112 Ga0105240_11728197 3300009093 Unclassified 653
113 Ga0111539_10000230 3300009094 Bacteria 67127
114 Ga0111539_10036968 3300009094 Bacteria 5900
115 Ga0111539_10277002 3300009094 Bacteria 1952
116 Ga0105245_10047391 3300009098 Bacteria 3842
117 Ga0105245_10142113 3300009098 Bacteria 2262
118 Ga0105247_10990795 3300009101 Bacteria 656
119 Ga0114129_10009312 3300009147 Bacteria 14011
120 Ga0114129_10009448 3300009147 Bacteria 13899
121 Ga0114129_10070966 3300009147 Unclassified 4857
122 Ga0114129_12792225 3300009147 Bacteria 581
123 Ga0105242_10023704 3300009176 Bacteria 4839
124 Ga0105248_10013729 3300009177 Bacteria 8916
125 Ga0105248_10032063 3300009177 Bacteria 5872
126 Ga0105248_10206225 3300009177 Bacteria 2215
127 Ga0105248_12354596 3300009177 Bacteria 606
128 Ga0105238_10432580 3300009551 Unclassified 1312
129 Ga0105249_10000670 3300009553 Bacteria 31083
130 Ga0105249_10188066 3300009553 Bacteria 2013
131 Ga0105239_10172564 3300010375 Bacteria 2418
132 Ga0105239_10780457 3300010375 Bacteria 1094
133 Ga0105246_10572526 3300011119 Bacteria 971
134 Ga0157378_10892595 3300013297 Unclassified 919
135 Ga0163162_10461874 3300013306 Bacteria 1401
136 Ga0157375_11701156 3300013308 Unclassified 747
137 Ga0157375_12789664 3300013308 Unclassified 584
138 Ga0163163_10024996 3300014325 Bacteria 5689
139 Ga0157380_10886543 3300014326 Unclassified 917
140 Ga0157377_10079098 3300014745 Unclassified 1918
141 Ga0157377_11123969 3300014745 Unclassified 603
142 Ga0157379_10503584 3300014968 Bacteria 1123
143 Ga0157379_10572438 3300014968 Unclassified 1052
144 Ga0157379_11517982 3300014968 Bacteria 652
145 Ga0207697_10075972 3300025315 Bacteria 1412
146 Ga0207656_10029341 3300025321 Bacteria 2265
147 Ga0207682_10188162 3300025893 Bacteria 945
148 Ga0207688_10081109 3300025901 Unclassified 1853
149 Ga0207688_10087333 3300025901 Bacteria 1788
150 Ga0207680_10604867 3300025903 Unclassified 784
151 Ga0207645_10008347 3300025907 Bacteria 7231
152 Ga0207645_10258366 3300025907 Unclassified 1153
153 Ga0207645_10396431 3300025907 Bacteria 928
154 Ga0207643_10361345 3300025908 Unclassified 913
155 Ga0207684_10453192 3300025910 Bacteria 1101
156 Ga0207654_10094213 3300025911 Bacteria 1832
157 Ga0207707_11330825 3300025912 Unclassified 576
158 Ga0207660_10970162 3300025917 Unclassified 693
159 Ga0207662_10003112 3300025918 Bacteria 8469
160 Ga0207657_10805928 3300025919 Unclassified 726
161 Ga0207649_10746205 3300025920 Bacteria 761
162 Ga0207681_10051218 3300025923 Bacteria 2796
163 Ga0207681_10064348 3300025923 Bacteria 2532
164 Ga0207681_10430206 3300025923 Bacteria 1071
165 Ga0207694_11452516 3300025924 Bacteria 579
166 Ga0207650_10014685 3300025925 Bacteria 5442
167 Ga0207650_10363279 3300025925 Unclassified 1193
168 Ga0207659_11760983 3300025926 Unclassified 527
169 Ga0207687_10029763 3300025927 Bacteria 3675
170 Ga0207687_10114045 3300025927 Bacteria 2011
171 Ga0207644_10721934 3300025931 Unclassified 831
172 Ga0207690_10975292 3300025932 Unclassified 705
173 Ga0207706_10189388 3300025933 Bacteria 1806
174 Ga0207706_10254524 3300025933 Bacteria 1533
175 Ga0207686_10804658 3300025934 Unclassified 754
176 Ga0207670_10090178 3300025936 Bacteria 2165
177 Ga0207670_10272083 3300025936 Unclassified 1317
178 Ga0207669_10025994 3300025937 Bacteria 3176
179 Ga0207704_10943268 3300025938 Bacteria 727
180 Ga0207691_10014994 3300025940 Bacteria 7378
181 Ga0207691_10123802 3300025940 Bacteria 2289
182 Ga0207711_10007673 3300025941 Bacteria 9019
183 Ga0207711_10026733 3300025941 Bacteria 4844
184 Ga0207711_10068221 3300025941 Bacteria 3079
185 Ga0207689_10079402 3300025942 Bacteria 2697
186 Ga0207661_10031323 3300025944 Unclassified 4106
187 Ga0207679_10002590 3300025945 Bacteria 11141
188 Ga0207679_10631112 3300025945 Unclassified 968
189 Ga0207667_11755105 3300025949 Bacteria 586
190 Ga0207651_10011986 3300025960 Bacteria 4880
191 Ga0207651_10799284 3300025960 Unclassified 836
192 Ga0207712_10007182 3300025961 Bacteria 7026
193 Ga0207712_10650899 3300025961 Bacteria 916
194 Ga0207640_10041509 3300025981 Unclassified 2927
195 Ga0207658_10027034 3300025986 Bacteria 4029
196 Ga0207658_10739527 3300025986 Unclassified 890
197 Ga0207703_10664638 3300026035 Unclassified 989
198 Ga0207703_10749384 3300026035 Bacteria 930
199 Ga0207678_10004280 3300026067 Bacteria 12800
200 Ga0207678_10083297 3300026067 Archaea 2735
201 Ga0207708_10100224 3300026075 Bacteria 2241
202 Ga0207708_10183423 3300026075 Bacteria 1662
203 Ga0207641_10277803 3300026088 Unclassified 1574
204 Ga0207648_10003828 3300026089 Bacteria 15712
205 Ga0207676_10799068 3300026095 Unclassified 920
206 Ga0207674_10023007 3300026116 Bacteria 6683
207 Ga0207675_100354483 3300026118 Unclassified 1438
208 Ga0207675_100506216 3300026118 Unclassified 1203
209 Ga0207683_10013542 3300026121 Bacteria 6958
210 Ga0209999_1047027 3300027543 Unclassified 812
211 Ga0207428_10044420 3300027907 Bacteria 3585
212 Ga0207428_10049985 3300027907 Bacteria 3346
213 Ga0268265_10169924 3300028380 Bacteria 1862
214 Ga0268265_10174493 3300028380 Unclassified 1841
215 Ga0268265_10464523 3300028380 Archaea 1185
216 Ga0268265_11905582 3300028380 Bacteria 601
217 Ga0268264_10301229 3300028381 Bacteria 1509
218 Ga0307408_100027696 3300031548 Bacteria 3908
219 Ga0307405_10042587 3300031731 Bacteria 2765
220 Ga0307413_10931141 3300031824 Bacteria 740
221 Ga0307406_10126721 3300031901 Bacteria 1785
222 Ga0307406_10133548 3300031901 Unclassified 1746
223 Ga0307406_11810585 3300031901 Unclassified 543
224 Ga0307412_10752365 3300031911 Unclassified 841
225 Ga0307409_100122326 3300031995 Bacteria 2207
226 Ga0307409_100162865 3300031995 Bacteria 1953
227 Ga0307409_100674847 3300031995 Bacteria 1030
228 Ga0307416_100043485 3300032002 Bacteria 3517
229 Ga0307416_100067381 3300032002 Bacteria 2952
230 Ga0307416_100980906 3300032002 Unclassified 948
231 Ga0307416_101477717 3300032002 Bacteria 785
232 Ga0307416_102506051 3300032002 Unclassified 614
233 Ga0307414_10218513 3300032004 Bacteria 1563
234 Ga0307414_11578680 3300032004 Unclassified 611
235 Ga0307411_10009105 3300032005 Bacteria 5196
236 Ga0307411_10454454 3300032005 Bacteria 1072
237 Ga0307411_10535975 3300032005 Bacteria 996
238 Ga0307411_10622553 3300032005 Unclassified 931
239 Ga0373932_0068370 3300035112 Unclassified 1096
240 Ga0373960_0115393 3300035121 Unclassified 886
241 Ga0373960_0240594 3300035121 Unclassified 654
242 Ga0373961_0184864 3300035241 Unclassified 728
243 Ga0373962_0108589 3300035242 Unclassified 873
244 Ga0439453_0057019 3300041408 Unclassified 801
245 Ga0439461_0104009 3300041410 Unclassified 694
246 Ga0451853_2175575 3300041512 Bacteria 1154
247 Ga0451853_3992318 3300041512 Unclassified 778
248 Ga0439433_0116202 3300041999 Unclassified 672
249 Ga0450898_080525 3300042134 Unclassified 662
250 Ga0439446_0030097 3300042156 Unclassified 1569
251 Ga0439435_0030405 3300042436 Bacteria 1464
252 Ga0439464_0000590 3300042439 Bacteria 7621
253 Ga0439460_0272690 3300042461 Unclassified 588
254 Ga0450893_0056490 3300042532 Unclassified 743
255 Ga0495603_0153367 3300046455 Unclassified 1338
256 Ga0496102_0485308 3300048905 Unclassified 1157
257 Ga0496104_0006500 3300048907 Bacteria 10280
258 Ga0496105_0135648 3300048908 Bacteria 2027
259 Ga0496106_0242277 3300048909 Unclassified 1441
260 Ga0496107_0635907 3300048910 Unclassified 787
261 Ga0496107_1232455 3300048910 Unclassified 537
262 Ga0496108_0005056 3300048911 Bacteria 10656
263 Ga0496109_0022956 3300048912 Bacteria 5531
264 Ga0496110_0007904 3300048913 Bacteria 8518
265 Ga0496111_0002125 3300048914 Bacteria 11845
266 Ga0496112_0030528 3300048915 Bacteria 5216
267 Ga0496112_0337665 3300048915 Bacteria 1450
268 Ga0496112_0826795 3300048915 Unclassified 850
269 Ga0496112_0922234 3300048915 Unclassified 795
270 Ga0496112_1418322 3300048915 Bacteria 609
271 Ga0496113_0084855 3300048916 Bacteria 2432
272 Ga0496114_0930672 3300048917 Bacteria 751
273 Ga0501306_016115 3300049127 Bacteria 1000
274 Ga0501291_008547 3300049514 Bacteria 1417
275 Ga0501299_034422 3300049522 Bacteria 992
276 Ga0501301_008731 3300049524 Bacteria 804
277 Ga0501031_0713217 3300049568 Bacteria 644
278 Ga0501034_0013386 3300049571 Bacteria 8444
279 Ga0501040_0405445 3300049576 Bacteria 979
280 Ga0501040_1131540 3300049576 Unclassified 568
281 Ga0501041_0538008 3300049577 Bacteria 744
282 Ga0501043_0131438 3300049579 Bacteria 1962
283 Ga0501071_0042272 3300049587 Unclassified 3265
284 Ga0501072_0077718 3300049588 Unclassified 2628
285 Ga0501074_0191011 3300049590 Unclassified 1460
286 Ga0501075_0995722 3300049591 Bacteria 637
287 Ga0501076_0230648 3300049592 Bacteria 1513
288 Ga0501076_0673875 3300049592 Bacteria 854
289 Ga0501076_0728477 3300049592 Unclassified 818
290 Ga0501077_0011249 3300049593 Bacteria 5584
291 Ga0501208_020384 3300049655 Bacteria 1078
292 Ga0501209_156318 3300049656 Unclassified 688
293 Ga0501217_079800 3300049661 Bacteria 904
294 Ga0501252_067621 3300049682 Unclassified 570
295 Ga0501261_065914 3300049690 Unclassified 625
296 Ga0501283_094532 3300049779 Unclassified 576
297 Ga0501045_0414533 3300049824 Bacteria 1002
298 nmdc:mga05p37_20858_c1 3300050507 Bacteria 7931
299 nmdc:mga05p37_87047_c1 3300050507 Bacteria 3851
300 nmdc:mga05p37_989_c1 3300050507 Bacteria 32388
301 nmdc:mga09592_71489_c1 3300050508 Bacteria 2945
302 nmdc:mga0qj67_66920_c1 3300050509 Bacteria 2862
303 nmdc:mga06r32_2245_c1 3300050510 Bacteria 17284
304 nmdc:mga08y16_2239_c1 3300050511 Bacteria 19829
305 nmdc:mga08y16_264663_c1 3300050511 Unclassified 1775
306 nmdc:mga08y16_86646_c1 3300050511 Bacteria 3264
307 nmdc:mga0n895_1729959_c1 3300050512 Unclassified 587
308 nmdc:mga0n895_225547_c1 3300050512 Unclassified 1902
309 nmdc:mga0n895_351179_c1 3300050512 Bacteria 1494
310 nmdc:mga0rr50_14634_c1 3300050513 Bacteria 5152
311 nmdc:mga0rr50_214590_c1 3300050513 Bacteria 1587
312 nmdc:mga0a205_16149_c1 3300050515 Bacteria 6990
313 nmdc:mga0a205_66523_c1 3300050515 Bacteria 3482
314 Ga0500628_008810 3300053129 Bacteria 1763
315 Ga0500628_008821 3300053129 Bacteria 1762
316 Ga0590071_005969 3300059421 Bacteria 2915
317 Ga0590071_052049 3300059421 Bacteria 994
318 Ga0590074_044432 3300059423 Bacteria 804
319 Ga0587073_0129670 3300059492 Unclassified 691
320 Ga0587083_0136099 3300059505 Unclassified 650
321 Ga0587085_080460 3300059506 Unclassified 655
322 Ga0587128_049317 3300059630 Unclassified 764
323 nmdc:mga0a205_40776_c1
324 Ga0065704_10162363
325 Ga0065715_10036237
326 Ga0065715_10037469
327 Ga0065715_10103594
328 Ga0065707_10090805
329 Ga0070676_10007162
330 Ga0070676_11072507
331 Ga0070683_100006077
332 Ga0070690_100043032
333 Ga0070670_100195548
334 Ga0070670_101121077
335 Ga0070677_10326198
336 Ga0068869_100153679
337 Ga0068869_101085726
338 Ga0070666_10192187
339 Ga0070680_101109937
340 Ga0068868_100121409
341 Ga0070660_100130200
342 Ga0070689_100369452
343 Ga0070691_10041925
344 Ga0070691_10413246
345 Ga0070687_100016675
346 Ga0070692_10043981
347 Ga0070669_100004488
348 Ga0070669_100092626
349 Ga0070669_100632882
350 Ga0070675_101918534
351 Ga0070671_100048718
352 Ga0070671_100065940
353 Ga0070674_100208319
354 Ga0070674_101067554
355 Ga0070673_100017931
356 Ga0070673_100899892
357 Ga0070673_101326267
358 Ga0070688_100035589
359 Ga0070688_100083949
360 Ga0070659_101083056
361 Ga0070667_100059205
362 Ga0070667_100360273
363 Ga0070701_10190463
364 Ga0070701_10759960
365 Ga0070711_100316214
366 Ga0070705_100342764
367 Ga0070700_100108889
368 Ga0070700_100424379
369 Ga0070694_100568595
370 Ga0070694_101554851
371 Ga0070663_100039108
372 Ga0070663_100203339
373 Ga0070663_101441399
374 Ga0070678_100114695
375 Ga0070681_10474245
376 Ga0068867_100007269
377 Ga0070685_11328834
378 Ga0070699_100072215
379 Ga0070684_100000247
380 Ga0070697_100103916
381 Ga0070672_100023416
382 Ga0070672_100504784
383 Ga0070686_100083162
384 Ga0070695_100013647
385 Ga0070695_100346581
386 Ga0070695_101690831
387 Ga0070696_100083102
388 Ga0070696_100659626
389 Ga0070693_100112541
390 Ga0070704_100015714
391 Ga0070704_100033633
392 Ga0068855_101581834
393 Ga0070664_100001088
394 Ga0070664_100754095
395 Ga0070664_101223559
396 Ga0070664_101296907
397 Ga0068857_100031455
398 Ga0068854_100017348
399 Ga0070702_100077038
400 Ga0070702_101766033
401 Ga0068852_102026504
402 Ga0068859_100214589
403 Ga0068864_101829505
404 Ga0068870_10553840
405 Ga0068863_100344088
406 Ga0068858_100031397
407 Ga0068860_100125177
408 Ga0068862_100138999
409 Ga0068862_100308014
410 Ga0068862_101108546
411 Ga0081455_10334441
412 Ga0075427_10049852
413 Ga0097621_100675882
414 Ga0097621_100741121
415 Ga0068871_100314251
416 Ga0068871_100403358
417 Ga0075428_100004987
418 Ga0075428_100007502
419 Ga0075428_101006773
420 Ga0075428_101155738
421 Ga0075430_100074139
422 Ga0075430_100105748
423 Ga0075431_100056523
424 Ga0075433_10031720
425 Ga0075433_10458334
426 Ga0075434_100210954
427 Ga0075429_100008791
428 Ga0075429_100091046
429 Ga0068865_100303566
430 Ga0097620_100214577
431 Ga0075435_100002471
432 Ga0075435_100008523
433 Ga0105240_10366473
434 Ga0105240_11728197
435 Ga0111539_10000230
436 Ga0111539_10036968
437 Ga0111539_10277002
438 Ga0105245_10047391
439 Ga0105245_10142113
440 Ga0105247_10990795
441 Ga0114129_10009312
442 Ga0114129_10009448
443 Ga0114129_10070966
444 Ga0114129_12792225
445 Ga0105242_10023704
446 Ga0105248_10013729
447 Ga0105248_10032063
448 Ga0105248_10206225
449 Ga0105248_12354596
450 Ga0105238_10432580
451 Ga0105249_10000670
452 Ga0105249_10188066
453 Ga0105239_10172564
454 Ga0105239_10780457
455 Ga0105246_10572526
456 Ga0157378_10892595
457 Ga0163162_10461874
458 Ga0157375_11701156
459 Ga0157375_12789664
460 Ga0163163_10024996
461 Ga0157380_10886543
462 Ga0157377_10079098
463 Ga0157377_11123969
464 Ga0157379_10503584
465 Ga0157379_10572438
466 Ga0157379_11517982
467 Ga0207697_10075972
468 Ga0207656_10029341
469 Ga0207682_10188162
470 Ga0207688_10081109
471 Ga0207688_10087333
472 Ga0207680_10604867
473 Ga0207645_10008347
474 Ga0207645_10258366
475 Ga0207645_10396431
476 Ga0207643_10361345
477 Ga0207684_10453192
478 Ga0207654_10094213
479 Ga0207707_11330825
480 Ga0207660_10970162
481 Ga0207662_10003112
482 Ga0207657_10805928
483 Ga0207649_10746205
484 Ga0207681_10051218
485 Ga0207681_10064348
486 Ga0207681_10430206
487 Ga0207694_11452516
488 Ga0207650_10014685
489 Ga0207650_10363279
490 Ga0207659_11760983
491 Ga0207687_10029763
492 Ga0207687_10114045
493 Ga0207644_10721934
494 Ga0207690_10975292
495 Ga0207706_10189388
496 Ga0207706_10254524
497 Ga0207686_10804658
498 Ga0207670_10090178
499 Ga0207670_10272083
500 Ga0207669_10025994
501 Ga0207704_10943268
502 Ga0207691_10014994
503 Ga0207691_10123802
504 Ga0207711_10007673
505 Ga0207711_10026733
506 Ga0207711_10068221
507 Ga0207689_10079402
508 Ga0207661_10031323
509 Ga0207679_10002590
510 Ga0207679_10631112
511 Ga0207667_11755105
512 Ga0207651_10011986
513 Ga0207651_10799284
514 Ga0207712_10007182
515 Ga0207712_10650899
516 Ga0207640_10041509
517 Ga0207658_10027034
518 Ga0207658_10739527
519 Ga0207703_10664638
520 Ga0207703_10749384
521 Ga0207678_10004280
522 Ga0207678_10083297
523 Ga0207708_10100224
524 Ga0207708_10183423
525 Ga0207641_10277803
526 Ga0207648_10003828
527 Ga0207676_10799068
528 Ga0207674_10023007
529 Ga0207675_100354483
530 Ga0207675_100506216
531 Ga0207683_10013542
532 Ga0209999_1047027
533 Ga0207428_10044420
534 Ga0207428_10049985
535 Ga0268265_10169924
536 Ga0268265_10174493
537 Ga0268265_10464523
538 Ga0268265_11905582
539 Ga0268264_10301229
540 Ga0307408_100027696
541 Ga0307405_10042587
542 Ga0307413_10931141
543 Ga0307406_10126721
544 Ga0307406_10133548
545 Ga0307406_11810585
546 Ga0307412_10752365
547 Ga0307409_100122326
548 Ga0307409_100162865
549 Ga0307409_100674847
550 Ga0307416_100043485
551 Ga0307416_100067381
552 Ga0307416_100980906
553 Ga0307416_101477717
554 Ga0307416_102506051
555 Ga0307414_10218513
556 Ga0307414_11578680
557 Ga0307411_10009105
558 Ga0307411_10454454
559 Ga0307411_10535975
560 Ga0307411_10622553
561 Ga0373932_0068370
562 Ga0373960_0115393
563 Ga0373960_0240594
564 Ga0373961_0184864
565 Ga0373962_0108589
566 Ga0439453_0057019
567 Ga0439461_0104009
568 Ga0451853_2175575
569 Ga0451853_3992318
570 Ga0439433_0116202
571 Ga0450898_080525
572 Ga0439446_0030097
573 Ga0439435_0030405
574 Ga0439464_0000590
575 Ga0439460_0272690
576 Ga0450893_0056490
577 Ga0495603_0153367
578 Ga0496102_0485308
579 Ga0496104_0006500
580 Ga0496105_0135648
581 Ga0496106_0242277
582 Ga0496107_0635907
583 Ga0496107_1232455
584 Ga0496108_0005056
585 Ga0496109_0022956
586 Ga0496110_0007904
587 Ga0496111_0002125
588 Ga0496112_0030528
589 Ga0496112_0337665
590 Ga0496112_0826795
591 Ga0496112_0922234
592 Ga0496112_1418322
593 Ga0496113_0084855
594 Ga0496114_0930672
595 Ga0501306_016115
596 Ga0501291_008547
597 Ga0501299_034422
598 Ga0501301_008731
599 Ga0501031_0713217
600 Ga0501034_0013386
601 Ga0501040_0405445
602 Ga0501040_1131540
603 Ga0501041_0538008
604 Ga0501043_0131438
605 Ga0501071_0042272
606 Ga0501072_0077718
607 Ga0501074_0191011
608 Ga0501075_0995722
609 Ga0501076_0230648
610 Ga0501076_0673875
611 Ga0501076_0728477
612 Ga0501077_0011249
613 Ga0501208_020384
614 Ga0501209_156318
615 Ga0501217_079800
616 Ga0501252_067621
617 Ga0501261_065914
618 Ga0501283_094532
619 Ga0501045_0414533
620 nmdc:mga05p37_20858_c1
621 nmdc:mga05p37_87047_c1
622 nmdc:mga05p37_989_c1
623 nmdc:mga09592_71489_c1
624 nmdc:mga0qj67_66920_c1
625 nmdc:mga06r32_2245_c1
626 nmdc:mga08y16_2239_c1
627 nmdc:mga08y16_264663_c1
628 nmdc:mga08y16_86646_c1
629 nmdc:mga0n895_1729959_c1
630 nmdc:mga0n895_225547_c1
631 nmdc:mga0n895_351179_c1
632 nmdc:mga0rr50_14634_c1
633 nmdc:mga0rr50_214590_c1
634 nmdc:mga0a205_16149_c1
635 nmdc:mga0a205_66523_c1
636 Ga0500628_008810
637 Ga0500628_008821
638 Ga0590071_005969
639 Ga0590071_052049
640 Ga0590074_044432
641 Ga0587073_0129670
642 Ga0587083_0136099
643 Ga0587085_080460
644 Ga0587128_049317

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kfu-assembly1.cif.gz_D crystal structure of the transamidosome 0.8791 26 116
3kfu-assembly1.cif.gz_B crystal structure of the transamidosome 0.8791 26 116
3kfu-assembly1.cif.gz_C crystal structure of the transamidosome 0.8785 26 116
3kfu-assembly1.cif.gz_A crystal structure of the transamidosome 0.878 26 116
1n9w-assembly1.cif.gz_B crystal structure of the non-discriminating and archaeal-type aspartyl-trna synthetase from thermus thermophilus 0.8738 28 116
ID Description Score Start End Superfamily
3f8tA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9109 39 118 2.40.50.140
3kfuA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.878 26 116 2.40.50.140
1q1eB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8574 47 87 2.40.50.140
4o2dB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8501 39 116 2.40.50.140
4gopY00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.847 44 118 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A842Y8U2-F1-model_v4 DNA-binding protein 0.9492 27 115
AF-A0A2V3JGR5-F1-model_v4 OB domain-containing protein 0.9432 26 118
AF-A0A2V8GXM1-F1-model_v4 Uncharacterized protein 0.9407 49 118
AF-A0A7J4EJD3-F1-model_v4 Cytochrome c assembly protein domain-containing protein 0.9262 26 116 GO:0015232
GO:0016020
GO:0017004
GO:0020037
AF-A0A0M0BRV3-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9201 28 118 GO:0016020
GO:0016787

Map