F406641

General Info

Members Datasets Scaffolds Average Seq Length
322 201 302 168

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0034031|Ga0501033_0034031_2335_2937
Length 200
Sequence VVTGQLSGTQPQIESVDTRTGRLSHAGSAVADEKRVWALAATVCDPEVPVLTIEDLGVLRAVHVDSGSGADGAERGDAPAVTVEITPTYSGCPAVDAMRDDILSTLSRAGYRDVTVRTVLAPAWTTDWMSDEGKAKLEAFGIAPPAPRAADGRVGLGLGIRCPRCGSLHTREVSHFGSTSCKALYVCQKCSEPFDHFKAH

Samples

Sample ID Description Type Environment
1 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
2 2643221649 Leifsonia sp. Root4 Isolate Unclassified
3 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
4 2818991444 Filimonas endophytica 3197 Isolate Unclassified
5 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
6 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
7 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
8 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
9 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
10 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
11 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
12 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
13 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
14 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
15 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
16 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
17 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
18 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
19 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
20 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
24 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
54 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
55 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
95 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
96 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
97 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
98 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
186 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
189 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
190 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
191 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
192 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
193 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
194 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
195 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
196 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.55
Metatranscriptomes 1.24
Isolates 6.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.14
Nodule 4.35
Rhizoplane 1.86
Rhizosphere 80.12
Stem 0
Stem Tuber 0
Unclassified 6.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10010316 3300003203 Bacteria 4149
2 JGI25153J46596_10002250 3300003215 Bacteria 11239
3 JGI25407J50210_10044079 3300003373 Bacteria 1139
4 Ga0006562J51391_1035107 3300003578 Bacteria 9420
5 Ga0006562J51391_1035108 3300003578 Bacteria 9120
6 Ga0006562J51391_1053710 3300003578 Bacteria 3650
7 Ga0006562J51391_1053712 3300003578 Bacteria 2750
8 JGI25404J52841_10014617 3300003659 Bacteria 1704
9 JGI25404J52841_10016292 3300003659 Bacteria 1613
10 Ga0055542_1004155 3300003762 Bacteria 3634
11 Ga0065165_1010203 3300005262 Bacteria 4095
12 Ga0070658_10044576 3300005327 Bacteria 3585
13 Ga0070658_10131800 3300005327 Bacteria 2083
14 Ga0070683_100130044 3300005329 Bacteria 2383
15 Ga0070680_100215167 3300005336 Bacteria 1621
16 Ga0068868_100051666 3300005338 Bacteria 3235
17 Ga0070660_100027328 3300005339 Bacteria 4257
18 Ga0070659_100000749 3300005366 Bacteria 23637
19 Ga0070659_100107474 3300005366 Bacteria 2250
20 Ga0070667_100109359 3300005367 Bacteria 2395
21 Ga0070709_10028748 3300005434 Bacteria 3319
22 Ga0070710_10087789 3300005437 Bacteria 1828
23 Ga0070711_100141936 3300005439 Bacteria 1802
24 Ga0070679_100115818 3300005530 Bacteria 2665
25 Ga0070684_100289558 3300005535 Bacteria 1501
26 Ga0068853_100007366 3300005539 Bacteria 8806
27 Ga0068853_100022507 3300005539 Bacteria 5264
28 Ga0068855_100005961 3300005563 Bacteria 14863
29 Ga0068855_100010153 3300005563 Bacteria 11349
30 Ga0068855_100078793 3300005563 Bacteria 3822
31 Ga0068857_100013829 3300005577 Bacteria 7028
32 Ga0068856_100132918 3300005614 Bacteria 2493
33 Ga0068856_100224594 3300005614 Bacteria 1893
34 Ga0068852_100014526 3300005616 Bacteria 6067
35 Ga0068852_100188304 3300005616 Bacteria 1945
36 Ga0068852_100653962 3300005616 Bacteria 1059
37 Ga0068859_100386412 3300005617 Bacteria 1495
38 Ga0081455_10032257 3300005937 Bacteria 4723
39 Ga0081538_10006496 3300005981 Bacteria 10287
40 Ga0081538_10040819 3300005981 Bacteria 2954
41 Ga0081540_1077265 3300005983 Bacteria 1514
42 Ga0075365_10149580 3300006038 Bacteria 1624
43 Ga0070712_100074012 3300006175 Bacteria 2445
44 Ga0075433_10806350 3300006852 Bacteria 820
45 Ga0075434_100041320 3300006871 Bacteria 4569
46 Ga0097620_100386429 3300006931 Bacteria 1495
47 Ga0099825_1030158 3300006941 Bacteria 2431
48 Ga0099824_1044082 3300006942 Bacteria 975
49 Ga0099822_1064873 3300006943 Bacteria 1125
50 Ga0105240_10344676 3300009093 Bacteria 1691
51 Ga0105240_10429397 3300009093 Bacteria 1483
52 Ga0105240_10944942 3300009093 Bacteria 925
53 Ga0105240_11228978 3300009093 Bacteria 792
54 Ga0105245_10110539 3300009098 Bacteria 2555
55 Ga0105245_10711282 3300009098 Bacteria 1038
56 Ga0105241_10247497 3300009174 Bacteria 1510
57 Ga0105248_10029944 3300009177 Bacteria 6075
58 Ga0105237_10006335 3300009545 Bacteria 13154
59 Ga0105237_10037729 3300009545 Bacteria 4883
60 Ga0105237_10132272 3300009545 Bacteria 2489
61 Ga0105237_10157464 3300009545 Bacteria 2268
62 Ga0105238_10206708 3300009551 Bacteria 1939
63 Ga0105238_10521045 3300009551 Bacteria 1191
64 Ga0105239_10085743 3300010375 Bacteria 3471
65 Ga0105239_10767596 3300010375 Bacteria 1104
66 Ga0105239_11376244 3300010375 Bacteria 814
67 Ga0157342_1053513 3300012507 Bacteria 574
68 Ga0157371_10506756 3300013102 Bacteria 892
69 Ga0157370_10580659 3300013104 Bacteria 1027
70 Ga0209148_1000347 3300025254 Bacteria 60370
71 Ga0209148_1021005 3300025254 Bacteria 1067
72 Ga0209233_1004474 3300025261 Bacteria 4747
73 Ga0209455_1005515 3300025272 Bacteria 3893
74 Ga0209564_1019790 3300025295 Bacteria 2498
75 Ga0209758_1129325 3300025297 Bacteria 670
76 Ga0209256_1009928 3300025299 Bacteria 4084
77 Ga0207692_10160129 3300025898 Bacteria 1296
78 Ga0207685_10136554 3300025905 Bacteria 1095
79 Ga0207699_10022841 3300025906 Bacteria 3396
80 Ga0207654_10085803 3300025911 Bacteria 1907
81 Ga0207695_10000008 3300025913 Bacteria 1058268
82 Ga0207695_10003698 3300025913 Bacteria 21313
83 Ga0207695_10023793 3300025913 Bacteria 6914
84 Ga0207695_10475986 3300025913 Bacteria 1131
85 Ga0207671_10004779 3300025914 Bacteria 12768
86 Ga0207671_10008416 3300025914 Bacteria 8752
87 Ga0207671_10070154 3300025914 Bacteria 2612
88 Ga0207671_10135608 3300025914 Bacteria 1892
89 Ga0207671_10285785 3300025914 Bacteria 1301
90 Ga0207693_10025498 3300025915 Bacteria 4687
91 Ga0207663_10038528 3300025916 Bacteria 2890
92 Ga0207660_10062821 3300025917 Bacteria 2676
93 Ga0207657_10018714 3300025919 Bacteria 6601
94 Ga0207652_10004961 3300025921 Bacteria 10776
95 Ga0207694_10054762 3300025924 Bacteria 3095
96 Ga0207694_10087958 3300025924 Bacteria 2448
97 Ga0207694_10100084 3300025924 Bacteria 2296
98 Ga0207687_10120152 3300025927 Bacteria 1964
99 Ga0207687_10311490 3300025927 Bacteria 1271
100 Ga0207690_10041728 3300025932 Bacteria 3009
101 Ga0207690_10632437 3300025932 Bacteria 876
102 Ga0207711_10146421 3300025941 Bacteria 2128
103 Ga0207667_10001482 3300025949 Bacteria 29458
104 Ga0207667_10016171 3300025949 Bacteria 8437
105 Ga0207667_10066698 3300025949 Bacteria 3751
106 Ga0207667_10076852 3300025949 Bacteria 3464
107 Ga0207658_10338909 3300025986 Bacteria 1306
108 Ga0207658_10624820 3300025986 Bacteria 969
109 Ga0207639_10026731 3300026041 Bacteria 4195
110 Ga0207639_10104223 3300026041 Bacteria 2299
111 Ga0207639_10286598 3300026041 Bacteria 1450
112 Ga0207702_10055677 3300026078 Bacteria 3355
113 Ga0207702_10070252 3300026078 Bacteria 3012
114 Ga0207702_10153925 3300026078 Bacteria 2094
115 Ga0207702_10527962 3300026078 Bacteria 1153
116 Ga0207676_10019085 3300026095 Bacteria 4997
117 Ga0207674_10035982 3300026116 Bacteria 5164
118 Ga0207698_10000078 3300026142 Bacteria 65050
119 Ga0207698_10060282 3300026142 Bacteria 2950
120 Ga0207698_10160041 3300026142 Bacteria 1968
121 Ga0207698_10863195 3300026142 Bacteria 911
122 Ga0209389_1000014 3300027296 Bacteria 188621
123 Ga0209589_1000020 3300027357 Bacteria 188617
124 Ga0209489_100060 3300027361 Bacteria 147091
125 Ga0307512_10091797 3300030522 Bacteria 2110
126 Ga0265328_10016262 3300031239 Bacteria 2898
127 Ga0265331_10051237 3300031250 Bacteria 1976
128 Ga0265316_10150244 3300031344 Bacteria 1745
129 Ga0307509_10145683 3300031507 Bacteria 2295
130 Ga0265313_10024626 3300031595 Bacteria 3211
131 Ga0307508_10003658 3300031616 Bacteria 15415
132 Ga0307409_100858550 3300031995 Bacteria 919
133 Ga0373955_0018896 3300035172 Bacteria 3436
134 Ga0373924_0035242 3300035410 Bacteria 2029
135 Ga0373931_0349012 3300035691 Bacteria 926
136 Ga0373935_0421865 3300035692 Bacteria 960
137 Ga0373937_0553694 3300036401 Bacteria 1092
138 Ga0373937_1468960 3300036401 Bacteria 629
139 Ga0395900_0293353 3300037418 Bacteria 1614
140 Ga0395898_0197319 3300037466 Bacteria 1922
141 Ga0395901_0271100 3300038443 Bacteria 1765
142 Ga0466972_0093058 3300044658 Bacteria 1429
143 Ga0466963_0013966 3300044694 Bacteria 4946
144 Ga0466968_0201062 3300044735 Bacteria 933
145 Ga0466957_0055018 3300044842 Bacteria 2431
146 Ga0466959_0144234 3300045049 Bacteria 1681
147 Ga0466967_0027164 3300045976 Bacteria 4758
148 Ga0466967_0087185 3300045976 Bacteria 2829
149 Ga0495592_0066877 3300046454 Bacteria 2628
150 Ga0495603_0011302 3300046455 Bacteria 5409
151 Ga0495603_0137184 3300046455 Bacteria 1424
152 Ga0495629_0002502 3300046459 Bacteria 14104
153 Ga0495629_0009638 3300046459 Bacteria 7054
154 Ga0495629_0031676 3300046459 Bacteria 3743
155 Ga0495651_0067009 3300046462 Bacteria 2739
156 Ga0495662_0392778 3300046476 Bacteria 681
157 Ga0495664_0180127 3300046477 Bacteria 1281
158 Ga0495594_0007430 3300046499 Bacteria 5637
159 Ga0495618_0025131 3300046514 Bacteria 3695
160 Ga0495628_0076413 3300046516 Bacteria 2606
161 Ga0495652_0034365 3300046529 Bacteria 4419
162 Ga0495652_0034613 3300046529 Bacteria 4402
163 Ga0495652_0297192 3300046529 Bacteria 1175
164 Ga0495640_0015376 3300046533 Bacteria 5761
165 Ga0495640_0050554 3300046533 Bacteria 2863
166 Ga0495640_0139987 3300046533 Bacteria 1560
167 Ga0495645_0107938 3300046543 Bacteria 1972
168 Ga0495622_0006010 3300046557 Bacteria 5637
169 Ga0495667_0104273 3300046559 Bacteria 1833
170 Ga0495634_0023617 3300046642 Bacteria 4319
171 Ga0495634_0037467 3300046642 Bacteria 3313
172 Ga0495634_0390591 3300046642 Bacteria 828
173 Ga0495635_0020009 3300046663 Bacteria 4664
174 Ga0495635_0095817 3300046663 Bacteria 2028
175 Ga0495661_0421661 3300046665 Bacteria 646
176 Ga0495657_0004507 3300046675 Bacteria 11139
177 Ga0495657_0039667 3300046675 Bacteria 3234
178 Ga0495657_0068033 3300046675 Bacteria 2336
179 Ga0495599_0058092 3300046678 Bacteria 2420
180 Ga0495623_0422216 3300046679 Bacteria 714
181 Ga0495646_0036208 3300046680 Bacteria 3058
182 Ga0495658_0289549 3300046683 Bacteria 1035
183 Ga0495613_0004215 3300046689 Bacteria 10766
184 Ga0495624_0011486 3300046690 Bacteria 6087
185 Ga0495624_0031529 3300046690 Bacteria 3444
186 Ga0495600_0066129 3300046809 Bacteria 2363
187 Ga0495600_0229780 3300046809 Bacteria 1184
188 Ga0495581_0030178 3300047315 Bacteria 3143
189 Ga0495581_0340801 3300047315 Bacteria 875
190 Ga0495604_0003557 3300047317 Bacteria 12433
191 Ga0495604_0022993 3300047317 Bacteria 4974
192 Ga0495604_0183884 3300047317 Bacteria 1460
193 Ga0495676_0001886 3300047321 Bacteria 18381
194 Ga0495676_0021328 3300047321 Bacteria 5661
195 Ga0495680_0111527 3300047322 Bacteria 2026
196 Ga0495675_0040381 3300047444 Bacteria 2973
197 Ga0495602_0111020 3300048088 Bacteria 2227
198 Ga0496101_0058093 3300048904 Bacteria 2800
199 Ga0496102_0201166 3300048905 Bacteria 1878
200 Ga0496105_0017252 3300048908 Bacteria 5783
201 Ga0496112_0096385 3300048915 Bacteria 2928
202 Ga0496113_0371015 3300048916 Bacteria 1149
203 Ga0496115_0103832 3300048918 Bacteria 2332
204 Ga0496120_0003177 3300048923 Bacteria 15298
205 Ga0496121_0076569 3300048924 Bacteria 2667
206 Ga0496125_0115847 3300048928 Bacteria 1926
207 Ga0501031_0017856 3300049568 Bacteria 4614
208 Ga0501031_0653762 3300049568 Bacteria 676
209 Ga0501032_0003551 3300049569 Bacteria 11896
210 Ga0501032_0025989 3300049569 Bacteria 4032
211 Ga0501032_0113647 3300049569 Bacteria 1791
212 Ga0501033_0014144 3300049570 Bacteria 6066
213 Ga0501033_0016148 3300049570 Bacteria 5653
214 Ga0501033_0034031 3300049570 Bacteria 3823
215 Ga0501033_0110655 3300049570 Bacteria 1999
216 Ga0501034_0004610 3300049571 Bacteria 15275
217 Ga0501034_0006003 3300049571 Bacteria 13134
218 Ga0501034_0070210 3300049571 Bacteria 3514
219 Ga0501034_0160462 3300049571 Bacteria 2220
220 Ga0501034_0308268 3300049571 Bacteria 1518
221 Ga0501036_0053658 3300049572 Bacteria 3413
222 Ga0501036_0089720 3300049572 Bacteria 2597
223 Ga0501036_0142827 3300049572 Bacteria 2019
224 Ga0501036_0493181 3300049572 Bacteria 1019
225 Ga0501037_0017291 3300049573 Bacteria 5310
226 Ga0501037_0046673 3300049573 Bacteria 3176
227 Ga0501037_0151255 3300049573 Bacteria 1659
228 Ga0501037_0185592 3300049573 Bacteria 1474
229 Ga0501037_0200540 3300049573 Bacteria 1410
230 Ga0501038_0023554 3300049574 Bacteria 5502
231 Ga0501038_0110868 3300049574 Bacteria 2273
232 Ga0501038_0507827 3300049574 Bacteria 921
233 Ga0501039_0151081 3300049575 Bacteria 1824
234 Ga0501039_0352936 3300049575 Bacteria 1156
235 Ga0501042_0108804 3300049578 Bacteria 1995
236 Ga0501043_0009585 3300049579 Bacteria 7589
237 Ga0501043_0024382 3300049579 Bacteria 4747
238 Ga0501043_0048266 3300049579 Bacteria 3347
239 Ga0501043_0069707 3300049579 Bacteria 2762
240 Ga0501043_0215143 3300049579 Bacteria 1488
241 Ga0501046_0011229 3300049580 Bacteria 7669
242 Ga0501046_0031793 3300049580 Bacteria 4276
243 Ga0501046_0222328 3300049580 Bacteria 1397
244 Ga0501047_0027390 3300049581 Bacteria 5490
245 Ga0501047_0038755 3300049581 Bacteria 4610
246 Ga0501047_0052582 3300049581 Bacteria 3937
247 Ga0501047_0061023 3300049581 Bacteria 3638
248 Ga0501047_0077241 3300049581 Bacteria 3204
249 Ga0501047_0242273 3300049581 Bacteria 1654
250 Ga0501048_0011137 3300049582 Bacteria 6703
251 Ga0501069_0148149 3300049585 Bacteria 1348
252 Ga0501070_0000569 3300049586 Bacteria 33672
253 Ga0501070_0012631 3300049586 Bacteria 7123
254 Ga0501070_0064856 3300049586 Bacteria 3024
255 Ga0501070_0144470 3300049586 Bacteria 1964
256 Ga0501070_0454792 3300049586 Bacteria 1032
257 Ga0501070_0622160 3300049586 Bacteria 859
258 Ga0501073_0014893 3300049589 Bacteria 5643
259 Ga0501073_0077304 3300049589 Bacteria 2316
260 Ga0501073_0119074 3300049589 Bacteria 1830
261 Ga0501076_0930661 3300049592 Bacteria 716
262 Ga0501080_0000134 3300049742 Bacteria 52384
263 Ga0501080_0266351 3300049742 Bacteria 1560
264 Ga0501080_0517500 3300049742 Bacteria 1065
265 Ga0501083_0018646 3300049744 Bacteria 4835
266 Ga0501035_0015489 3300049822 Bacteria 7034
267 Ga0501035_0020195 3300049822 Bacteria 6117
268 Ga0501035_0072246 3300049822 Bacteria 3054
269 Ga0501035_0081438 3300049822 Bacteria 2857
270 Ga0501035_0110426 3300049822 Bacteria 2410
271 Ga0501035_0126546 3300049822 Bacteria 2230
272 Ga0501035_0284600 3300049822 Bacteria 1396
273 Ga0501035_0542266 3300049822 Bacteria 953
274 Ga0501044_0017479 3300049823 Bacteria 7697
275 Ga0501044_0022498 3300049823 Bacteria 6716
276 Ga0501044_0060280 3300049823 Bacteria 3885
277 Ga0501044_0127953 3300049823 Bacteria 2536
278 Ga0501044_0205265 3300049823 Bacteria 1927
279 Ga0501044_0271440 3300049823 Bacteria 1631
280 Ga0501044_0279152 3300049823 Bacteria 1604
281 Ga0501045_0013294 3300049824 Bacteria 5811
282 nmdc:mga0n895_32050_c1 3300050512 Bacteria 5040
283 nmdc:mga0rr50_109597_c1 3300050513 Bacteria 2183
284 nmdc:mga0a205_143565_c1 3300050515 Bacteria 1424
285 Ga0495601_0430951 3300053077 Bacteria 853
286 Ga0500610_0091107 3300053079 Bacteria 1584
287 Ga0500635_0021452 3300053080 Bacteria 1990
288 Ga0495619_0105005 3300053085 Bacteria 1926
289 Ga0500578_0270697 3300053086 Bacteria 1016
290 Ga0500651_0000155 3300053093 Bacteria 43944
291 Ga0500651_0173345 3300053093 Bacteria 1284
292 Ga0500569_022899 3300053109 Bacteria 1671
293 Ga0500595_002551 3300053119 Bacteria 8923
294 Ga0500597_321827 3300053120 Bacteria 611
295 Ga0500655_024254 3300053133 Bacteria 1147
296 Ga0500658_0167108 3300053134 Bacteria 998
297 Ga0500590_033670 3300053148 Bacteria 2655
298 Ga0500609_001501 3300053731 Bacteria 3412
299 Ga0501084_0638024 3300054114 Bacteria 899
300 Ga0590071_023902 3300059421 Bacteria 1447
301 Ga0590074_001200 3300059423 Bacteria 4090
302 Ga0590077_019475 3300059426 Bacteria 1438

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046455 Ga0495603_0011302 Ga0495603_0011302_2805_3350 134
2 3300046459 Ga0495629_0031676 Ga0495629_0031676_1647_2192 134
3 3300046462 Ga0495651_0067009 Ga0495651_0067009_284_829 134
4 3300046476 Ga0495662_0392778 Ga0495662_0392778_92_637 134
5 3300046499 Ga0495594_0007430 Ga0495594_0007430_1622_2167 134
6 3300046529 Ga0495652_0034613 Ga0495652_0034613_2356_2901 134
7 3300046533 Ga0495640_0015376 Ga0495640_0015376_599_1144 134
8 3300046642 Ga0495634_0037467 Ga0495634_0037467_1502_2047 134
9 3300046675 Ga0495657_0039667 Ga0495657_0039667_972_1517 134
10 3300046689 Ga0495613_0004215 Ga0495613_0004215_894_1439 134
11 3300046690 Ga0495624_0031529 Ga0495624_0031529_2773_3318 134
12 3300046809 Ga0495600_0229780 Ga0495600_0229780_108_653 134
13 3300047315 Ga0495581_0030178 Ga0495581_0030178_768_1313 134
14 3300047317 Ga0495604_0183884 Ga0495604_0183884_383_928 134
15 3300047321 Ga0495676_0001886 Ga0495676_0001886_13664_14209 134
16 3300047444 Ga0495675_0040381 Ga0495675_0040381_1562_2107 134
17 3300046543 Ga0495645_0107938 Ga0495645_0107938_1538_1957 139
18 3300046679 Ga0495623_0422216 Ga0495623_0422216_15_434 139
19 3300046683 Ga0495658_0289549 Ga0495658_0289549_13_432 139
20 3300003578 Ga0006562J51391_1053710 Ga0006562J51391_10537103 142
21 3300003578 Ga0006562J51391_1053712 Ga0006562J51391_10537124 142
22 3300049822 Ga0501035_0110426 Ga0501035_0110426_1439_1981 142
23 3300053120 Ga0500597_321827 Ga0500597_321827_47_529 154
24 3300049571 Ga0501034_0070210 Ga0501034_0070210_637_1122 156
25 3300049573 Ga0501037_0200540 Ga0501037_0200540_571_1056 156
26 3300049579 Ga0501043_0215143 Ga0501043_0215143_186_671 156
27 3300049581 Ga0501047_0052582 Ga0501047_0052582_2716_3201 156
28 3300049586 Ga0501070_0000569 Ga0501070_0000569_6010_6495 156
29 3300049589 Ga0501073_0077304 Ga0501073_0077304_354_839 156
30 3300049592 Ga0501076_0930661 Ga0501076_0930661_90_575 156
31 3300049742 Ga0501080_0000134 Ga0501080_0000134_17524_18009 156
32 3300049744 Ga0501083_0018646 Ga0501083_0018646_1213_1698 156
33 3300054114 Ga0501084_0638024 Ga0501084_0638024_305_790 156
34 3300003578 Ga0006562J51391_1035107 Ga0006562J51391_10351074 158
35 3300003578 Ga0006562J51391_1035108 Ga0006562J51391_10351088 158
36 3300009093 Ga0105240_11228978 Ga0105240_112289782 158
37 iso_pu_bacteria 2818991444 2819586161 158
38 3300031616 Ga0307508_10003658 Ga0307508_1000365813 159
39 3300045976 Ga0466967_0027164 Ga0466967_0027164_2567_3082 159
40 3300049568 Ga0501031_0017856 Ga0501031_0017856_3083_3598 159
41 3300049568 Ga0501031_0653762 Ga0501031_0653762_61_540 159
42 3300049569 Ga0501032_0003551 Ga0501032_0003551_710_1225 159
43 3300049569 Ga0501032_0113647 Ga0501032_0113647_342_821 159
44 3300049570 Ga0501033_0016148 Ga0501033_0016148_974_1489 159
45 3300049570 Ga0501033_0110655 Ga0501033_0110655_1191_1670 159
46 3300049571 Ga0501034_0004610 Ga0501034_0004610_13941_14456 159
47 3300049571 Ga0501034_0160462 Ga0501034_0160462_1153_1632 159
48 3300049572 Ga0501036_0053658 Ga0501036_0053658_166_681 159
49 3300049572 Ga0501036_0493181 Ga0501036_0493181_116_595 159
50 3300049573 Ga0501037_0017291 Ga0501037_0017291_4037_4552 159
51 3300049573 Ga0501037_0185592 Ga0501037_0185592_388_867 159
52 3300049574 Ga0501038_0110868 Ga0501038_0110868_871_1386 159
53 3300049574 Ga0501038_0507827 Ga0501038_0507827_52_567 159
54 3300049575 Ga0501039_0151081 Ga0501039_0151081_425_940 159
55 3300049575 Ga0501039_0352936 Ga0501039_0352936_655_1134 159
56 3300049578 Ga0501042_0108804 Ga0501042_0108804_458_973 159
57 3300049579 Ga0501043_0009585 Ga0501043_0009585_759_1274 159
58 3300049579 Ga0501043_0024382 Ga0501043_0024382_1305_1784 159
59 3300049580 Ga0501046_0011229 Ga0501046_0011229_6320_6835 159
60 3300049581 Ga0501047_0061023 Ga0501047_0061023_1647_2126 159
61 3300049582 Ga0501048_0011137 Ga0501048_0011137_5299_5814 159
62 3300049586 Ga0501070_0012631 Ga0501070_0012631_902_1417 159
63 3300049586 Ga0501070_0622160 Ga0501070_0622160_40_519 159
64 3300049589 Ga0501073_0119074 Ga0501073_0119074_759_1274 159
65 3300049742 Ga0501080_0517500 Ga0501080_0517500_339_818 159
66 3300049822 Ga0501035_0015489 Ga0501035_0015489_6411_6926 159
67 3300049822 Ga0501035_0081438 Ga0501035_0081438_1290_1769 159
68 3300049823 Ga0501044_0017479 Ga0501044_0017479_6424_6939 159
69 3300049823 Ga0501044_0022498 Ga0501044_0022498_1490_1969 159
70 3300049824 Ga0501045_0013294 Ga0501045_0013294_1439_1954 159
71 iso_pu_bacteria 2808606359 2808842562 159
72 iso_pu_bacteria 2873151551 2873155256 160
73 3300003373 JGI25407J50210_10044079 JGI25407J50210_100440792 161
74 3300003762 Ga0055542_1004155 Ga0055542_10041552 161
75 3300005981 Ga0081538_10006496 Ga0081538_100064962 161
76 3300005981 Ga0081538_10040819 Ga0081538_100408195 161
77 3300025254 Ga0209148_1000347 Ga0209148_100034712 161
78 3300025261 Ga0209233_1004474 Ga0209233_10044742 161
79 3300025272 Ga0209455_1005515 Ga0209455_10055152 161
80 3300046459 Ga0495629_0002502 Ga0495629_0002502_8340_8846 161
81 3300049571 Ga0501034_0308268 Ga0501034_0308268_10_621 161
82 3300049572 Ga0501036_0089720 Ga0501036_0089720_604_1215 161
83 3300049574 Ga0501038_0023554 Ga0501038_0023554_1227_1823 161
84 3300049579 Ga0501043_0048266 Ga0501043_0048266_1539_2135 161
85 3300049581 Ga0501047_0077241 Ga0501047_0077241_669_1265 161
86 3300049822 Ga0501035_0072246 Ga0501035_0072246_2501_3043 161
87 3300049822 Ga0501035_0542266 Ga0501035_0542266_310_906 161
88 3300049823 Ga0501044_0060280 Ga0501044_0060280_1346_1942 161
89 3300049823 Ga0501044_0127953 Ga0501044_0127953_40_582 161
90 3300059421 Ga0590071_023902 Ga0590071_023902_122_625 161
91 3300059423 Ga0590074_001200 Ga0590074_001200_2771_3274 161
92 3300059426 Ga0590077_019475 Ga0590077_019475_241_744 161
93 3300009093 Ga0105240_10944942 Ga0105240_109449421 162
94 3300005539 Ga0068853_100007366 Ga0068853_1000073668 163
95 3300005614 Ga0068856_100132918 Ga0068856_1001329183 163
96 3300005616 Ga0068852_100188304 Ga0068852_1001883042 163
97 3300009098 Ga0105245_10110539 Ga0105245_101105393 163
98 3300025927 Ga0207687_10120152 Ga0207687_101201523 163
99 3300026041 Ga0207639_10026731 Ga0207639_100267314 163
100 3300026078 Ga0207702_10055677 Ga0207702_100556774 163
101 3300026142 Ga0207698_10000078 Ga0207698_1000007857 163
102 3300031507 Ga0307509_10145683 Ga0307509_101456833 163
103 3300038443 Ga0395901_0271100 Ga0395901_0271100_574_1077 163
104 3300045049 Ga0466959_0144234 Ga0466959_0144234_359_850 163
105 3300049570 Ga0501033_0014144 Ga0501033_0014144_2980_3492 163
106 3300049573 Ga0501037_0151255 Ga0501037_0151255_266_778 163
107 3300049579 Ga0501043_0069707 Ga0501043_0069707_1286_1798 163
108 3300049581 Ga0501047_0027390 Ga0501047_0027390_2977_3489 163
109 3300049586 Ga0501070_0144470 Ga0501070_0144470_835_1347 163
110 3300049822 Ga0501035_0126546 Ga0501035_0126546_472_984 163
111 3300049823 Ga0501044_0205265 Ga0501044_0205265_1198_1710 163
112 3300053093 Ga0500651_0000155 Ga0500651_0000155_2442_2942 163
113 iso_pu_bacteria 2513237102 2513701522 163
114 iso_pu_bacteria 2842038055 2842040705 163
115 iso_pu_bacteria 2842045827 2842046349 163
116 iso_pu_bacteria 2844315083 2844320083 163
117 iso_pu_bacteria 2857509624 2857512721 163
118 iso_pu_bacteria 2874612657 2874614516 163
119 iso_pu_bacteria 2874620515 2874628133 163
120 iso_pu_bacteria 2881364244 2881371408 163
121 iso_pu_bacteria 2903727486 2903730243 163
122 iso_pu_bacteria 2904666416 2904674249 163
123 iso_pu_bacteria 2906602504 2906609908 163
124 iso_pu_bacteria 2906626472 2906627649 163
125 iso_pu_bacteria 2922361189 2922361897 163
126 iso_pu_bacteria 3005594810 3005600369 163
127 iso_pu_bacteria 3005718088 3005723218 163
128 iso_pu_bacteria 8016583857 8016594411 163
129 3300005327 Ga0070658_10131800 Ga0070658_101318003 164
130 3300005329 Ga0070683_100130044 Ga0070683_1001300442 164
131 3300005338 Ga0068868_100051666 Ga0068868_1000516662 164
132 3300005339 Ga0070660_100027328 Ga0070660_1000273285 164
133 3300005366 Ga0070659_100000749 Ga0070659_1000007495 164
134 3300005367 Ga0070667_100109359 Ga0070667_1001093593 164
135 3300005563 Ga0068855_100078793 Ga0068855_1000787934 164
136 3300005614 Ga0068856_100224594 Ga0068856_1002245943 164
137 3300005616 Ga0068852_100653962 Ga0068852_1006539621 164
138 3300005617 Ga0068859_100386412 Ga0068859_1003864122 164
139 3300006931 Ga0097620_100386429 Ga0097620_1003864292 164
140 3300009093 Ga0105240_10344676 Ga0105240_103446761 164
141 3300009098 Ga0105245_10711282 Ga0105245_107112822 164
142 3300009177 Ga0105248_10029944 Ga0105248_100299446 164
143 3300009545 Ga0105237_10132272 Ga0105237_101322723 164
144 3300009545 Ga0105237_10157464 Ga0105237_101574642 164
145 3300010375 Ga0105239_11376244 Ga0105239_113762442 164
146 3300025913 Ga0207695_10003698 Ga0207695_100036986 164
147 3300025913 Ga0207695_10023793 Ga0207695_100237939 164
148 3300025914 Ga0207671_10070154 Ga0207671_100701543 164
149 3300025914 Ga0207671_10135608 Ga0207671_101356082 164
150 3300025914 Ga0207671_10285785 Ga0207671_102857852 164
151 3300025924 Ga0207694_10087958 Ga0207694_100879582 164
152 3300025927 Ga0207687_10311490 Ga0207687_103114902 164
153 3300025932 Ga0207690_10041728 Ga0207690_100417284 164
154 3300025941 Ga0207711_10146421 Ga0207711_101464212 164
155 3300025949 Ga0207667_10001482 Ga0207667_1000148228 164
156 3300025949 Ga0207667_10076852 Ga0207667_100768523 164
157 3300025986 Ga0207658_10338909 Ga0207658_103389092 164
158 3300025986 Ga0207658_10624820 Ga0207658_106248201 164
159 3300026078 Ga0207702_10153925 Ga0207702_101539252 164
160 3300026078 Ga0207702_10527962 Ga0207702_105279622 164
161 3300026095 Ga0207676_10019085 Ga0207676_100190852 164
162 3300026116 Ga0207674_10035982 Ga0207674_100359826 164
163 3300026142 Ga0207698_10863195 Ga0207698_108631951 164
164 3300048923 Ga0496120_0003177 Ga0496120_0003177_13861_14370 164
165 3300049569 Ga0501032_0025989 Ga0501032_0025989_1828_2406 164
166 3300049570 Ga0501033_0034031 Ga0501033_0034031_2335_2937 164
167 3300049571 Ga0501034_0006003 Ga0501034_0006003_9033_9611 164
168 3300049572 Ga0501036_0142827 Ga0501036_0142827_677_1279 164
169 3300049573 Ga0501037_0046673 Ga0501037_0046673_2150_2728 164
170 3300049580 Ga0501046_0031793 Ga0501046_0031793_1808_2410 164
171 3300049580 Ga0501046_0222328 Ga0501046_0222328_342_920 164
172 3300049581 Ga0501047_0038755 Ga0501047_0038755_2937_3515 164
173 3300049581 Ga0501047_0242273 Ga0501047_0242273_637_1239 164
174 3300049585 Ga0501069_0148149 Ga0501069_0148149_677_1279 164
175 3300049586 Ga0501070_0064856 Ga0501070_0064856_654_1232 164
176 3300049586 Ga0501070_0454792 Ga0501070_0454792_415_1017 164
177 3300049589 Ga0501073_0014893 Ga0501073_0014893_496_1074 164
178 3300049742 Ga0501080_0266351 Ga0501080_0266351_187_789 164
179 3300049822 Ga0501035_0020195 Ga0501035_0020195_4844_5422 164
180 3300049822 Ga0501035_0284600 Ga0501035_0284600_47_649 164
181 3300049823 Ga0501044_0271440 Ga0501044_0271440_520_1122 164
182 3300049823 Ga0501044_0279152 Ga0501044_0279152_397_975 164
183 3300053080 Ga0500635_0021452 Ga0500635_0021452_1069_1572 164
184 3300053148 Ga0500590_033670 Ga0500590_033670_1669_2172 164
185 iso_pu_bacteria 2643221649 2644279678 164
186 3300005434 Ga0070709_10028748 Ga0070709_100287484 165
187 3300005437 Ga0070710_10087789 Ga0070710_100877893 165
188 3300005439 Ga0070711_100141936 Ga0070711_1001419362 165
189 3300006175 Ga0070712_100074012 Ga0070712_1000740122 165
190 3300025898 Ga0207692_10160129 Ga0207692_101601292 165
191 3300025905 Ga0207685_10136554 Ga0207685_101365542 165
192 3300025906 Ga0207699_10022841 Ga0207699_100228414 165
193 3300025915 Ga0207693_10025498 Ga0207693_100254985 165
194 3300025916 Ga0207663_10038528 Ga0207663_100385282 165
195 3300025924 Ga0207694_10100084 Ga0207694_101000844 165
196 3300026078 Ga0207702_10070252 Ga0207702_100702524 165
197 3300046455 Ga0495603_0137184 Ga0495603_0137184_338_835 165
198 3300005327 Ga0070658_10044576 Ga0070658_100445762 166
199 3300005563 Ga0068855_100005961 Ga0068855_10000596114 166
200 3300006852 Ga0075433_10806350 Ga0075433_108063501 166
201 3300009093 Ga0105240_10429397 Ga0105240_104293972 166
202 3300013102 Ga0157371_10506756 Ga0157371_105067562 166
203 3300025913 Ga0207695_10475986 Ga0207695_104759862 166
204 3300025949 Ga0207667_10066698 Ga0207667_100666984 166
205 3300003203 JGI25406J46586_10010316 JGI25406J46586_100103163 167
206 3300003215 JGI25153J46596_10002250 JGI25153J46596_100022506 167
207 3300003659 JGI25404J52841_10014617 JGI25404J52841_100146172 167
208 3300003659 JGI25404J52841_10016292 JGI25404J52841_100162922 167
209 3300005262 Ga0065165_1010203 Ga0065165_10102032 167
210 3300005336 Ga0070680_100215167 Ga0070680_1002151673 167
211 3300005366 Ga0070659_100107474 Ga0070659_1001074744 167
212 3300005530 Ga0070679_100115818 Ga0070679_1001158182 167
213 3300005535 Ga0070684_100289558 Ga0070684_1002895583 167
214 3300005539 Ga0068853_100022507 Ga0068853_1000225072 167
215 3300005563 Ga0068855_100010153 Ga0068855_1000101534 167
216 3300005577 Ga0068857_100013829 Ga0068857_1000138295 167
217 3300005616 Ga0068852_100014526 Ga0068852_1000145266 167
218 3300005937 Ga0081455_10032257 Ga0081455_100322574 167
219 3300005983 Ga0081540_1077265 Ga0081540_10772652 167
220 3300006038 Ga0075365_10149580 Ga0075365_101495802 167
221 3300006871 Ga0075434_100041320 Ga0075434_1000413204 167
222 3300006941 Ga0099825_1030158 Ga0099825_10301582 167
223 3300006942 Ga0099824_1044082 Ga0099824_10440822 167
224 3300006943 Ga0099822_1064873 Ga0099822_10648732 167
225 3300009174 Ga0105241_10247497 Ga0105241_102474973 167
226 3300009545 Ga0105237_10006335 Ga0105237_100063357 167
227 3300009545 Ga0105237_10037729 Ga0105237_100377297 167
228 3300009551 Ga0105238_10206708 Ga0105238_102067084 167
229 3300009551 Ga0105238_10521045 Ga0105238_105210452 167
230 3300010375 Ga0105239_10085743 Ga0105239_100857433 167
231 3300010375 Ga0105239_10767596 Ga0105239_107675962 167
232 3300012507 Ga0157342_1053513 Ga0157342_10535131 167
233 3300013104 Ga0157370_10580659 Ga0157370_105806592 167
234 3300025254 Ga0209148_1021005 Ga0209148_10210052 167
235 3300025295 Ga0209564_1019790 Ga0209564_10197902 167
236 3300025297 Ga0209758_1129325 Ga0209758_11293252 167
237 3300025299 Ga0209256_1009928 Ga0209256_10099284 167
238 3300025911 Ga0207654_10085803 Ga0207654_100858032 167
239 3300025913 Ga0207695_10000008 Ga0207695_10000008857 167
240 3300025914 Ga0207671_10004779 Ga0207671_1000477910 167
241 3300025914 Ga0207671_10008416 Ga0207671_1000841610 167
242 3300025917 Ga0207660_10062821 Ga0207660_100628213 167
243 3300025919 Ga0207657_10018714 Ga0207657_100187146 167
244 3300025921 Ga0207652_10004961 Ga0207652_1000496111 167
245 3300025924 Ga0207694_10054762 Ga0207694_100547622 167
246 3300025932 Ga0207690_10632437 Ga0207690_106324372 167
247 3300025949 Ga0207667_10016171 Ga0207667_100161716 167
248 3300026041 Ga0207639_10104223 Ga0207639_101042232 167
249 3300026041 Ga0207639_10286598 Ga0207639_102865982 167
250 3300026142 Ga0207698_10060282 Ga0207698_100602823 167
251 3300026142 Ga0207698_10160041 Ga0207698_101600412 167
252 3300027296 Ga0209389_1000014 Ga0209389_1000014124 167
253 3300027357 Ga0209589_1000020 Ga0209589_1000020124 167
254 3300027361 Ga0209489_100060 Ga0209489_10006083 167
255 3300030522 Ga0307512_10091797 Ga0307512_100917972 167
256 3300031239 Ga0265328_10016262 Ga0265328_100162623 167
257 3300031250 Ga0265331_10051237 Ga0265331_100512371 167
258 3300031344 Ga0265316_10150244 Ga0265316_101502442 167
259 3300031595 Ga0265313_10024626 Ga0265313_100246263 167
260 3300031995 Ga0307409_100858550 Ga0307409_1008585502 167
261 3300035172 Ga0373955_0018896 Ga0373955_0018896_2831_3334 167
262 3300035410 Ga0373924_0035242 Ga0373924_0035242_278_781 167
263 3300035691 Ga0373931_0349012 Ga0373931_0349012_55_558 167
264 3300035692 Ga0373935_0421865 Ga0373935_0421865_428_931 167
265 3300036401 Ga0373937_0553694 Ga0373937_0553694_429_932 167
266 3300036401 Ga0373937_1468960 Ga0373937_1468960_56_559 167
267 3300037418 Ga0395900_0293353 Ga0395900_0293353_726_1229 167
268 3300037466 Ga0395898_0197319 Ga0395898_0197319_247_750 167
269 3300044658 Ga0466972_0093058 Ga0466972_0093058_216_719 167
270 3300044694 Ga0466963_0013966 Ga0466963_0013966_1214_1717 167
271 3300044735 Ga0466968_0201062 Ga0466968_0201062_331_834 167
272 3300044842 Ga0466957_0055018 Ga0466957_0055018_1433_1936 167
273 3300045976 Ga0466967_0087185 Ga0466967_0087185_1218_1721 167
274 3300046454 Ga0495592_0066877 Ga0495592_0066877_170_673 167
275 3300046459 Ga0495629_0009638 Ga0495629_0009638_509_1012 167
276 3300046477 Ga0495664_0180127 Ga0495664_0180127_487_990 167
277 3300046514 Ga0495618_0025131 Ga0495618_0025131_2646_3149 167
278 3300046516 Ga0495628_0076413 Ga0495628_0076413_1986_2489 167
279 3300046529 Ga0495652_0034365 Ga0495652_0034365_3256_3759 167
280 3300046529 Ga0495652_0297192 Ga0495652_0297192_247_750 167
281 3300046533 Ga0495640_0050554 Ga0495640_0050554_1876_2379 167
282 3300046533 Ga0495640_0139987 Ga0495640_0139987_673_1176 167
283 3300046557 Ga0495622_0006010 Ga0495622_0006010_3720_4223 167
284 3300046559 Ga0495667_0104273 Ga0495667_0104273_422_925 167
285 3300046642 Ga0495634_0023617 Ga0495634_0023617_3330_3833 167
286 3300046642 Ga0495634_0390591 Ga0495634_0390591_275_778 167
287 3300046663 Ga0495635_0020009 Ga0495635_0020009_487_990 167
288 3300046663 Ga0495635_0095817 Ga0495635_0095817_1353_1856 167
289 3300046665 Ga0495661_0421661 Ga0495661_0421661_19_522 167
290 3300046675 Ga0495657_0004507 Ga0495657_0004507_7785_8288 167
291 3300046675 Ga0495657_0068033 Ga0495657_0068033_97_600 167
292 3300046678 Ga0495599_0058092 Ga0495599_0058092_1381_1884 167
293 3300046680 Ga0495646_0036208 Ga0495646_0036208_2269_2772 167
294 3300046690 Ga0495624_0011486 Ga0495624_0011486_359_862 167
295 3300046809 Ga0495600_0066129 Ga0495600_0066129_1849_2352 167
296 3300047315 Ga0495581_0340801 Ga0495581_0340801_293_796 167
297 3300047317 Ga0495604_0003557 Ga0495604_0003557_10802_11305 167
298 3300047317 Ga0495604_0022993 Ga0495604_0022993_3195_3698 167
299 3300047321 Ga0495676_0021328 Ga0495676_0021328_2142_2645 167
300 3300047322 Ga0495680_0111527 Ga0495680_0111527_1354_1857 167
301 3300048088 Ga0495602_0111020 Ga0495602_0111020_1294_1797 167
302 3300048904 Ga0496101_0058093 Ga0496101_0058093_1249_1752 167
303 3300048905 Ga0496102_0201166 Ga0496102_0201166_984_1487 167
304 3300048908 Ga0496105_0017252 Ga0496105_0017252_2089_2592 167
305 3300048915 Ga0496112_0096385 Ga0496112_0096385_391_894 167
306 3300048916 Ga0496113_0371015 Ga0496113_0371015_382_885 167
307 3300048918 Ga0496115_0103832 Ga0496115_0103832_1465_1968 167
308 3300048924 Ga0496121_0076569 Ga0496121_0076569_1873_2376 167
309 3300048928 Ga0496125_0115847 Ga0496125_0115847_1131_1634 167
310 3300050512 nmdc:mga0n895_32050_c1 nmdc:mga0n895_32050_c1_2858_3379 167
311 3300050513 nmdc:mga0rr50_109597_c1 nmdc:mga0rr50_109597_c1_437_958 167
312 3300050515 nmdc:mga0a205_143565_c1 nmdc:mga0a205_143565_c1_209_730 167
313 3300053077 Ga0495601_0430951 Ga0495601_0430951_90_593 167
314 3300053079 Ga0500610_0091107 Ga0500610_0091107_732_1235 167
315 3300053085 Ga0495619_0105005 Ga0495619_0105005_943_1446 167
316 3300053086 Ga0500578_0270697 Ga0500578_0270697_264_767 167
317 3300053093 Ga0500651_0173345 Ga0500651_0173345_388_891 167
318 3300053109 Ga0500569_022899 Ga0500569_022899_1096_1599 167
319 3300053119 Ga0500595_002551 Ga0500595_002551_3206_3709 167
320 3300053133 Ga0500655_024254 Ga0500655_024254_573_1076 167
321 3300053134 Ga0500658_0167108 Ga0500658_0167108_156_659 167
322 3300053731 Ga0500609_001501 Ga0500609_001501_1952_2455 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF23451

146

198

0.91

PF01883

FeS_assembly_P

Iron-sulfur cluster assembly protein

33

118

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lno-assembly1.cif.gz_A crystal structure of domain of unknown function duf59 from bacillus anthracis 0.8919 6 105
3cq2-assembly1.cif.gz_B structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 0.8478 11 105
3lno-assembly1.cif.gz_A crystal structure of domain of unknown function duf59 from bacillus anthracis 0.8376 6 105
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.8221 11 99
3cq2-assembly1.cif.gz_B structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 0.817 11 105
ID Description Score Start End Superfamily
af_P76080_10_106_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9344 12 105 3.30.300.130
af_P76080_10_106_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8982 12 105 3.30.300.130
af_Q2FZT0_1_88_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8657 21 105 3.30.300.130
af_O53157_4_110_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8622 5 105 3.30.300.130
af_Q1G391_89_370_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.8619 136 164 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A257S6A0-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaJ 0.9735 125 167
AF-A0A4R4MCF4-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaJ 0.9459 15 118
AF-A0A0A0D1F0-F1-model_v4 Phenylacetate-CoA oxygenase 0.944 11 84
AF-A0A2E0SYA7-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaJ 0.9421 15 101
AF-A0A7Y1V914-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaJ 0.9367 13 113

Feature Viewer

pLDDT pTM Quality
84.84 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map