F406563

General Info

Members Datasets Scaffolds Average Seq Length
322 144 644 129

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0022537|Ga0466963_0022537_2788_3168
Length 120
Sequence VVREFTASQRAALDQAIRAAERVSRFEFSVFVGTAEGEPRAYAERLHAALSTPARSVLIMVDPGARVIEVVTGLSDQEVALAVLQMRTEFATGDLLKGLRRGISMLAMSARAPRTLHAQA

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
47 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
50 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
51 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
52 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
53 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
54 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
63 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
64 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
65 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
66 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
67 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
68 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
69 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
84 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
85 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
86 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
89 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
90 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
91 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
92 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
93 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
94 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
95 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
110 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
111 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
114 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
115 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
116 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
117 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
118 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
119 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
128 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
129 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
130 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
131 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
132 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
133 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
134 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
135 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
138 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
139 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
140 2643221561 Nocardioides sp. Root151 Isolate Unclassified
141 2643221615 Nocardioides sp. Root224 Isolate Unclassified
142 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
143 2643221696 Nocardioides sp. Root140 Isolate Unclassified
144 2857481737 Nocardioides sp. R-74106 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.14
Metatranscriptomes 0.31
Isolates 1.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.95
Nodule 0
Rhizoplane 2.17
Rhizosphere 66.15
Stem 0
Stem Tuber 0
Unclassified 2.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0022537 3300044694 Bacteria 3989
2 Ga0070658_10246955 3300005327 Bacteria 1514
3 Ga0070683_100009957 3300005329 Bacteria 8152
4 Ga0070683_100359948 3300005329 Bacteria 1386
5 Ga0070660_100723449 3300005339 Bacteria 835
6 Ga0070667_100028650 3300005367 Bacteria 4638
7 Ga0070667_101155963 3300005367 Bacteria 724
8 Ga0070708_100237414 3300005445 Bacteria 1711
9 Ga0070708_100546058 3300005445 Bacteria 1093
10 Ga0070663_100079815 3300005455 Bacteria 2402
11 Ga0070681_10817928 3300005458 Bacteria 849
12 Ga0070685_10630155 3300005466 Bacteria 775
13 Ga0070707_100781620 3300005468 Bacteria 918
14 Ga0070698_100000999 3300005471 Bacteria 31136
15 Ga0070684_100469335 3300005535 Bacteria 1164
16 Ga0068853_100689271 3300005539 Bacteria 974
17 Ga0070665_100002481 3300005548 Bacteria 20316
18 Ga0068855_100943868 3300005563 Bacteria 909
19 Ga0070664_100282928 3300005564 Bacteria 1496
20 Ga0068857_100172875 3300005577 Bacteria 1964
21 Ga0068857_101257306 3300005577 Bacteria 718
22 Ga0070702_100522107 3300005615 Bacteria 876
23 Ga0068859_101523723 3300005617 Bacteria 738
24 Ga0068870_10381015 3300005840 Bacteria 913
25 Ga0068860_100000388 3300005843 Bacteria 57678
26 Ga0081539_10015520 3300005985 Bacteria 5528
27 Ga0075365_10002950 3300006038 Bacteria 8600
28 Ga0075365_10006955 3300006038 Bacteria 6285
29 Ga0075365_10020398 3300006038 Bacteria 4108
30 Ga0075365_10023257 3300006038 Bacteria 3895
31 Ga0075365_10024255 3300006038 Bacteria 3823
32 Ga0075365_10037574 3300006038 Bacteria 3144
33 Ga0075365_10045017 3300006038 Bacteria 2893
34 Ga0075365_10057374 3300006038 Bacteria 2590
35 Ga0075365_10088304 3300006038 Bacteria 2109
36 Ga0075365_10103280 3300006038 Bacteria 1953
37 Ga0075365_10123455 3300006038 Bacteria 1788
38 Ga0075365_10145995 3300006038 Bacteria 1644
39 Ga0075368_10000320 3300006042 Bacteria 14097
40 Ga0075368_10009792 3300006042 Bacteria 3455
41 Ga0075368_10040992 3300006042 Bacteria 1819
42 Ga0075363_100001500 3300006048 Bacteria 8902
43 Ga0075363_100003318 3300006048 Bacteria 6823
44 Ga0075363_100025205 3300006048 Bacteria 3030
45 Ga0075363_100025535 3300006048 Bacteria 3014
46 Ga0075363_100041262 3300006048 Bacteria 2434
47 Ga0075363_100186297 3300006048 Bacteria 1182
48 Ga0075364_10002222 3300006051 Bacteria 10894
49 Ga0075364_10041681 3300006051 Bacteria 2981
50 Ga0075364_10047945 3300006051 Bacteria 2783
51 Ga0075364_10051458 3300006051 Bacteria 2690
52 Ga0075364_10155386 3300006051 Bacteria 1543
53 Ga0075364_10401417 3300006051 Bacteria 935
54 Ga0075364_10688749 3300006051 Bacteria 698
55 Ga0075364_10721751 3300006051 Bacteria 680
56 Ga0075364_10744322 3300006051 Bacteria 669
57 Ga0075362_10045194 3300006177 Bacteria 1955
58 Ga0075367_10008997 3300006178 Bacteria 5199
59 Ga0075367_10032977 3300006178 Bacteria 2982
60 Ga0075367_10068086 3300006178 Bacteria 2135
61 Ga0075367_10080495 3300006178 Bacteria 1970
62 Ga0075367_10133487 3300006178 Bacteria 1535
63 Ga0075370_10009636 3300006353 Bacteria 5025
64 Ga0075370_10080881 3300006353 Bacteria 1867
65 Ga0075370_10184942 3300006353 Bacteria 1227
66 Ga0075370_10287432 3300006353 Bacteria 977
67 Ga0075428_102504068 3300006844 Bacteria 528
68 Ga0068865_100302319 3300006881 Bacteria 1281
69 Ga0097620_101523226 3300006931 Bacteria 738
70 Ga0105243_10241735 3300009148 Bacteria 1607
71 Ga0157372_11760013 3300013307 Bacteria 713
72 Ga0157372_13134034 3300013307 Bacteria 528
73 Ga0157375_10048137 3300013308 Bacteria 4168
74 Ga0157375_10116289 3300013308 Bacteria 2778
75 Ga0157375_10289458 3300013308 Bacteria 1801
76 Ga0163163_10496668 3300014325 Bacteria 1282
77 Ga0163163_10653995 3300014325 Bacteria 1114
78 Ga0157380_12443108 3300014326 Bacteria 588
79 Ga0163161_10114339 3300017792 Bacteria 2022
80 Ga0163161_11708176 3300017792 Bacteria 558
81 Ga0213876_10247019 3300021384 Unclassified 948
82 Ga0207705_10184644 3300025909 Bacteria 1575
83 Ga0207667_11498570 3300025949 Bacteria 646
84 Ga0207678_10702651 3300026067 Bacteria 890
85 Ga0207648_10875675 3300026089 Bacteria 838
86 Ga0207674_10637229 3300026116 Bacteria 1029
87 Ga0207683_11864760 3300026121 Bacteria 550
88 Ga0209813_10014207 3300027866 Bacteria 2141
89 Ga0209813_10108108 3300027866 Bacteria 955
90 Ga0268266_10022293 3300028379 Bacteria 5397
91 Ga0268264_10000387 3300028381 Bacteria 63349
92 Ga0314311_1016711 3300030733 Bacteria 628
93 Ga0307408_101742216 3300031548 Bacteria 594
94 Ga0307405_10651973 3300031731 Bacteria 866
95 Ga0307410_10114808 3300031852 Bacteria 1954
96 Ga0307410_10123304 3300031852 Bacteria 1893
97 Ga0307410_10540045 3300031852 Bacteria 965
98 Ga0307410_11391956 3300031852 Bacteria 616
99 Ga0307406_10506424 3300031901 Bacteria 980
100 Ga0307406_10742327 3300031901 Bacteria 823
101 Ga0307412_10323169 3300031911 Bacteria 1228
102 Ga0307409_100074562 3300031995 Bacteria 2712
103 Ga0307409_100132641 3300031995 Bacteria 2132
104 Ga0307409_100133296 3300031995 Bacteria 2127
105 Ga0307409_100832722 3300031995 Bacteria 932
106 Ga0307416_100220226 3300032002 Bacteria 1819
107 Ga0307416_101424439 3300032002 Bacteria 799
108 Ga0307416_101449055 3300032002 Bacteria 792
109 Ga0307414_10128977 3300032004 Bacteria 1960
110 Ga0307414_11080612 3300032004 Bacteria 740
111 Ga0307411_10323559 3300032005 Bacteria 1246
112 Ga0307411_11090969 3300032005 Bacteria 719
113 Ga0307415_100026623 3300032126 Bacteria 3651
114 Ga0307415_100199306 3300032126 Bacteria 1587
115 Ga0307415_100342387 3300032126 Bacteria 1255
116 Ga0307415_100552442 3300032126 Bacteria 1016
117 Ga0395898_0971724 3300037466 Bacteria 786
118 Ga0395901_0076555 3300038443 Bacteria 3491
119 Ga0436365_1733735 3300039437 Unclassified 1001
120 Ga0451837_0675904 3300041494 Bacteria 846
121 Ga0451853_0537377 3300041512 Bacteria 737
122 Ga0439445_0122962 3300042004 Bacteria 746
123 Ga0439457_176111 3300042014 Bacteria 521
124 Ga0439464_0016361 3300042439 Bacteria 2004
125 Ga0466969_0505657 3300044656 Bacteria 552
126 Ga0466972_0081210 3300044658 Bacteria 1544
127 Ga0466972_0363440 3300044658 Bacteria 677
128 Ga0466965_0060306 3300044683 Bacteria 1895
129 Ga0466965_0135920 3300044683 Bacteria 1277
130 Ga0466966_0144322 3300044684 Bacteria 1453
131 Ga0466961_0051088 3300044693 Bacteria 2641
132 Ga0466961_0135974 3300044693 Bacteria 1540
133 Ga0466963_0020484 3300044694 Bacteria 4159
134 Ga0466963_0361699 3300044694 Bacteria 1022
135 Ga0466963_0538036 3300044694 Bacteria 825
136 Ga0466963_0810162 3300044694 Bacteria 660
137 Ga0466964_0002197 3300044706 Bacteria 6902
138 Ga0466971_0168014 3300044719 Bacteria 1028
139 Ga0466968_0017924 3300044735 Bacteria 2837
140 Ga0466970_0013191 3300044765 Bacteria 4235
141 Ga0466970_0039117 3300044765 Bacteria 2517
142 Ga0466970_0054456 3300044765 Bacteria 2136
143 Ga0466970_0114430 3300044765 Bacteria 1474
144 Ga0466970_0330792 3300044765 Bacteria 862
145 Ga0466970_0657978 3300044765 Bacteria 609
146 Ga0466957_0030161 3300044842 Bacteria 3237
147 Ga0466957_0054272 3300044842 Bacteria 2445
148 Ga0466957_0404009 3300044842 Bacteria 935
149 Ga0466960_0006567 3300044901 Bacteria 4672
150 Ga0466960_0019802 3300044901 Bacteria 2971
151 Ga0466960_0033237 3300044901 Bacteria 2396
152 Ga0466960_0077136 3300044901 Bacteria 1670
153 Ga0466960_0102839 3300044901 Bacteria 1474
154 Ga0466960_0215428 3300044901 Bacteria 1055
155 Ga0466959_0396063 3300045049 Bacteria 939
156 Ga0466959_0940418 3300045049 Bacteria 576
157 Ga0451576_0133971 3300045051 Bacteria 2583
158 Ga0466958_0026620 3300045836 Bacteria 3419
159 Ga0466967_0064404 3300045976 Bacteria 3260
160 Ga0466967_0091485 3300045976 Bacteria 2765
161 Ga0466967_0164467 3300045976 Bacteria 2084
162 Ga0466967_1098289 3300045976 Bacteria 792
163 Ga0466967_1347174 3300045976 Bacteria 711
164 Ga0466967_1396744 3300045976 Bacteria 697
165 Ga0466967_1557549 3300045976 Bacteria 658
166 Ga0466967_1908109 3300045976 Bacteria 591
167 Ga0495629_0156209 3300046459 Bacteria 1585
168 Ga0495635_0122063 3300046663 Bacteria 1777
169 Ga0495676_0521400 3300047321 Bacteria 778
170 Ga0496100_1397957 3300048903 Bacteria 552
171 Ga0496102_0698155 3300048905 Bacteria 938
172 Ga0496107_0974668 3300048910 Bacteria 616
173 Ga0496108_0768281 3300048911 Unclassified 833
174 Ga0496109_1090920 3300048912 Unclassified 735
175 Ga0496110_1900177 3300048913 Unclassified 505
176 Ga0496114_0160648 3300048917 Bacteria 1953
177 Ga0496124_0538839 3300048927 Unclassified 773
178 Ga0496124_0756854 3300048927 Bacteria 608
179 Ga0496126_0257306 3300048929 Bacteria 1453
180 Ga0501318_025580 3300049534 Bacteria 774
181 Ga0501031_0038873 3300049568 Bacteria 3104
182 Ga0501031_0098916 3300049568 Bacteria 1904
183 Ga0501031_0203556 3300049568 Bacteria 1291
184 Ga0501032_0150811 3300049569 Bacteria 1529
185 Ga0501032_0739606 3300049569 Bacteria 622
186 Ga0501033_0076041 3300049570 Bacteria 2465
187 Ga0501033_0140643 3300049570 Bacteria 1745
188 Ga0501034_0125170 3300049571 Bacteria 2556
189 Ga0501036_0003141 3300049572 Bacteria 13174
190 Ga0501036_0066610 3300049572 Bacteria 3047
191 Ga0501037_0840366 3300049573 Bacteria 604
192 Ga0501038_0007635 3300049574 Bacteria 9973
193 Ga0501038_0239307 3300049574 Bacteria 1442
194 Ga0501039_0053467 3300049575 Bacteria 3125
195 Ga0501039_0093126 3300049575 Bacteria 2348
196 Ga0501040_0102187 3300049576 Bacteria 2000
197 Ga0501040_0240050 3300049576 Bacteria 1291
198 Ga0501041_0084852 3300049577 Bacteria 1952
199 Ga0501041_0405061 3300049577 Bacteria 864
200 Ga0501042_0064206 3300049578 Bacteria 2624
201 Ga0501042_0089591 3300049578 Bacteria 2207
202 Ga0501042_0500410 3300049578 Bacteria 882
203 Ga0501046_0177948 3300049580 Bacteria 1592
204 Ga0501046_0328826 3300049580 Unclassified 1113
205 Ga0501048_0015185 3300049582 Bacteria 5690
206 Ga0501067_0022969 3300049583 Bacteria 3454
207 Ga0501067_0313886 3300049583 Bacteria 873
208 Ga0501068_0295846 3300049584 Bacteria 1036
209 Ga0501069_0061554 3300049585 Bacteria 2096
210 Ga0501069_0171966 3300049585 Bacteria 1250
211 Ga0501069_0317556 3300049585 Bacteria 915
212 Ga0501069_0335997 3300049585 Bacteria 889
213 Ga0501069_0462700 3300049585 Bacteria 754
214 Ga0501069_0766949 3300049585 Bacteria 584
215 Ga0501070_0144492 3300049586 Bacteria 1964
216 Ga0501070_0154063 3300049586 Bacteria 1896
217 Ga0501070_0190696 3300049586 Bacteria 1685
218 Ga0501070_0262832 3300049586 Bacteria 1410
219 Ga0501070_0307980 3300049586 Bacteria 1289
220 Ga0501070_0868248 3300049586 Bacteria 705
221 Ga0501071_0010091 3300049587 Bacteria 6315
222 Ga0501071_0146273 3300049587 Bacteria 1762
223 Ga0501071_0200817 3300049587 Bacteria 1497
224 Ga0501071_0957652 3300049587 Bacteria 661
225 Ga0501072_0007038 3300049588 Bacteria 8540
226 Ga0501072_0009611 3300049588 Bacteria 7354
227 Ga0501072_0053390 3300049588 Bacteria 3183
228 Ga0501072_0702723 3300049588 Bacteria 795
229 Ga0501073_0246603 3300049589 Bacteria 1233
230 Ga0501073_0396223 3300049589 Unclassified 954
231 Ga0501074_0061307 3300049590 Bacteria 2710
232 Ga0501074_0160233 3300049590 Bacteria 1607
233 Ga0501074_0845584 3300049590 Bacteria 645
234 Ga0501075_0030366 3300049591 Bacteria 4003
235 Ga0501075_0127214 3300049591 Bacteria 1940
236 Ga0501075_0499524 3300049591 Bacteria 928
237 Ga0501076_0043814 3300049592 Bacteria 3528
238 Ga0501076_0048542 3300049592 Bacteria 3355
239 Ga0501077_0139773 3300049593 Bacteria 1536
240 Ga0501077_0293037 3300049593 Bacteria 1036
241 Ga0501077_0344582 3300049593 Bacteria 951
242 Ga0501079_0092053 3300049741 Bacteria 2349
243 Ga0501079_0213035 3300049741 Bacteria 1509
244 Ga0501079_0237465 3300049741 Bacteria 1424
245 Ga0501079_0239411 3300049741 Bacteria 1418
246 Ga0501080_0059374 3300049742 Bacteria 3559
247 Ga0501080_0268082 3300049742 Bacteria 1555
248 Ga0501080_0819213 3300049742 Bacteria 815
249 Ga0501081_0038917 3300049743 Bacteria 3252
250 Ga0501081_0081059 3300049743 Bacteria 2273
251 Ga0501081_0740537 3300049743 Bacteria 739
252 Ga0501083_0815727 3300049744 Bacteria 607
253 Ga0501035_0083356 3300049822 Bacteria 2821
254 Ga0501035_0154849 3300049822 Bacteria 1987
255 Ga0501044_0427489 3300049823 Bacteria 1234
256 Ga0501044_0451023 3300049823 Bacteria 1193
257 Ga0501045_0031609 3300049824 Bacteria 3834
258 Ga0501045_0176113 3300049824 Bacteria 1593
259 Ga0501045_0427708 3300049824 Bacteria 985
260 nmdc:mga03n38_100499_c1 3300050490 Bacteria 1394
261 nmdc:mga03n38_12795_c1 3300050490 Bacteria 3168
262 nmdc:mga03n38_192692_c1 3300050490 Bacteria 1051
263 nmdc:mga03n38_2906_c1 3300050490 Bacteria 5401
264 nmdc:mga03n38_3658_c1 3300050490 Bacteria 4972
265 nmdc:mga03n38_515524_c1 3300050490 Bacteria 673
266 nmdc:mga03n38_818686_c1 3300050490 Bacteria 543
267 nmdc:mga03n38_886856_c1 3300050490 Bacteria 523
268 nmdc:mga00v17_131994_c1 3300050491 Bacteria 1597
269 nmdc:mga00v17_27885_c1 3300050491 Bacteria 3301
270 nmdc:mga00v17_303185_c1 3300050491 Bacteria 1038
271 nmdc:mga00v17_3703_c1 3300050491 Bacteria 7900
272 nmdc:mga00v17_527304_c1 3300050491 Bacteria 765
273 nmdc:mga00v17_716651_c1 3300050491 Bacteria 641
274 nmdc:mga0yw44_102352_c1 3300050492 Bacteria 1826
275 nmdc:mga0yw44_1257_c1 3300050492 Bacteria 9969
276 nmdc:mga0yw44_14670_c1 3300050492 Bacteria 4170
277 nmdc:mga0yw44_158267_c1 3300050492 Bacteria 1482
278 nmdc:mga0yw44_169128_c1 3300050492 Bacteria 1434
279 nmdc:mga0yw44_17966_c1 3300050492 Bacteria 3863
280 nmdc:mga0yw44_2577_c1 3300050492 Bacteria 7791
281 nmdc:mga0yw44_293253_c1 3300050492 Bacteria 1089
282 nmdc:mga0yw44_41971_c1 3300050492 Bacteria 2726
283 nmdc:mga0yw44_498950_c1 3300050492 Unclassified 826
284 nmdc:mga0yw44_511695_c1 3300050492 Bacteria 815
285 nmdc:mga0yw44_52293_c1 3300050492 Bacteria 2476
286 nmdc:mga0yw44_52514_c1 3300050492 Bacteria 2471
287 nmdc:mga0yw44_82210_c1 3300050492 Bacteria 2020
288 nmdc:mga0yw44_881712_c1 3300050492 Bacteria 607
289 nmdc:mga06z11_138924_c1 3300050494 Bacteria 1372
290 nmdc:mga06z11_32770_c1 3300050494 Bacteria 2536
291 nmdc:mga06z11_34507_c1 3300050494 Bacteria 2484
292 nmdc:mga06z11_490226_c1 3300050494 Bacteria 744
293 nmdc:mga06z11_5900_c1 3300050494 Bacteria 4947
294 nmdc:mga06z11_700721_c1 3300050494 Bacteria 617
295 nmdc:mga06z11_84829_c1 3300050494 Bacteria 1708
296 nmdc:mga04h51_19413_c1 3300050495 Bacteria 2015
297 nmdc:mga04h51_51402_c1 3300050495 Bacteria 1384
298 nmdc:mga04h51_5354_c1 3300050495 Bacteria 3268
299 nmdc:mga07m45_191458_c1 3300050496 Bacteria 1189
300 nmdc:mga07m45_251830_c1 3300050496 Bacteria 1027
301 nmdc:mga07m45_359735_c1 3300050496 Bacteria 846
302 nmdc:mga07m45_56494_c1 3300050496 Bacteria 2218
303 nmdc:mga07m45_693252_c1 3300050496 Bacteria 586
304 nmdc:mga07m45_7704_c1 3300050496 Bacteria 5511
305 Ga0500644_0009962 3300053088 Bacteria 2558
306 Ga0500593_000126 3300053117 Bacteria 30241
307 Ga0500628_139882 3300053129 Bacteria 670
308 Ga0501084_0083257 3300054114 Bacteria 2685
309 Ga0501084_0518273 3300054114 Bacteria 1008
310 Ga0501082_0098637 3300060353 Bacteria 2526
311 Ga0501082_0163039 3300060353 Bacteria 1937
312 Ga0501082_0413350 3300060353 Bacteria 1178
313 Ga0466962_0027020 3300061719 Bacteria 2755
314 Ga0466962_0049323 3300061719 Bacteria 2012
315 Ga0466962_0227980 3300061719 Bacteria 913
316 Ga0530510_0052468 3300061734 Bacteria 2946
317 Ga0530510_0781436 3300061734 Bacteria 728
318 2643828076 2643221561 Bacteria 4984412
319 2644091834 2643221615 Bacteria 5487866
320 2644321637 2643221657 Bacteria 5490246
321 2644531166 2643221696 Bacteria 5431823
322 2857483915 2857481737 Bacteria 4761446
323 Ga0466963_0022537
324 Ga0070658_10246955
325 Ga0070683_100009957
326 Ga0070683_100359948
327 Ga0070660_100723449
328 Ga0070667_100028650
329 Ga0070667_101155963
330 Ga0070708_100237414
331 Ga0070708_100546058
332 Ga0070663_100079815
333 Ga0070681_10817928
334 Ga0070685_10630155
335 Ga0070707_100781620
336 Ga0070698_100000999
337 Ga0070684_100469335
338 Ga0068853_100689271
339 Ga0070665_100002481
340 Ga0068855_100943868
341 Ga0070664_100282928
342 Ga0068857_100172875
343 Ga0068857_101257306
344 Ga0070702_100522107
345 Ga0068859_101523723
346 Ga0068870_10381015
347 Ga0068860_100000388
348 Ga0081539_10015520
349 Ga0075365_10002950
350 Ga0075365_10006955
351 Ga0075365_10020398
352 Ga0075365_10023257
353 Ga0075365_10024255
354 Ga0075365_10037574
355 Ga0075365_10045017
356 Ga0075365_10057374
357 Ga0075365_10088304
358 Ga0075365_10103280
359 Ga0075365_10123455
360 Ga0075365_10145995
361 Ga0075368_10000320
362 Ga0075368_10009792
363 Ga0075368_10040992
364 Ga0075363_100001500
365 Ga0075363_100003318
366 Ga0075363_100025205
367 Ga0075363_100025535
368 Ga0075363_100041262
369 Ga0075363_100186297
370 Ga0075364_10002222
371 Ga0075364_10041681
372 Ga0075364_10047945
373 Ga0075364_10051458
374 Ga0075364_10155386
375 Ga0075364_10401417
376 Ga0075364_10688749
377 Ga0075364_10721751
378 Ga0075364_10744322
379 Ga0075362_10045194
380 Ga0075367_10008997
381 Ga0075367_10032977
382 Ga0075367_10068086
383 Ga0075367_10080495
384 Ga0075367_10133487
385 Ga0075370_10009636
386 Ga0075370_10080881
387 Ga0075370_10184942
388 Ga0075370_10287432
389 Ga0075428_102504068
390 Ga0068865_100302319
391 Ga0097620_101523226
392 Ga0105243_10241735
393 Ga0157372_11760013
394 Ga0157372_13134034
395 Ga0157375_10048137
396 Ga0157375_10116289
397 Ga0157375_10289458
398 Ga0163163_10496668
399 Ga0163163_10653995
400 Ga0157380_12443108
401 Ga0163161_10114339
402 Ga0163161_11708176
403 Ga0213876_10247019
404 Ga0207705_10184644
405 Ga0207667_11498570
406 Ga0207678_10702651
407 Ga0207648_10875675
408 Ga0207674_10637229
409 Ga0207683_11864760
410 Ga0209813_10014207
411 Ga0209813_10108108
412 Ga0268266_10022293
413 Ga0268264_10000387
414 Ga0314311_1016711
415 Ga0307408_101742216
416 Ga0307405_10651973
417 Ga0307410_10114808
418 Ga0307410_10123304
419 Ga0307410_10540045
420 Ga0307410_11391956
421 Ga0307406_10506424
422 Ga0307406_10742327
423 Ga0307412_10323169
424 Ga0307409_100074562
425 Ga0307409_100132641
426 Ga0307409_100133296
427 Ga0307409_100832722
428 Ga0307416_100220226
429 Ga0307416_101424439
430 Ga0307416_101449055
431 Ga0307414_10128977
432 Ga0307414_11080612
433 Ga0307411_10323559
434 Ga0307411_11090969
435 Ga0307415_100026623
436 Ga0307415_100199306
437 Ga0307415_100342387
438 Ga0307415_100552442
439 Ga0395898_0971724
440 Ga0395901_0076555
441 Ga0436365_1733735
442 Ga0451837_0675904
443 Ga0451853_0537377
444 Ga0439445_0122962
445 Ga0439457_176111
446 Ga0439464_0016361
447 Ga0466969_0505657
448 Ga0466972_0081210
449 Ga0466972_0363440
450 Ga0466965_0060306
451 Ga0466965_0135920
452 Ga0466966_0144322
453 Ga0466961_0051088
454 Ga0466961_0135974
455 Ga0466963_0020484
456 Ga0466963_0361699
457 Ga0466963_0538036
458 Ga0466963_0810162
459 Ga0466964_0002197
460 Ga0466971_0168014
461 Ga0466968_0017924
462 Ga0466970_0013191
463 Ga0466970_0039117
464 Ga0466970_0054456
465 Ga0466970_0114430
466 Ga0466970_0330792
467 Ga0466970_0657978
468 Ga0466957_0030161
469 Ga0466957_0054272
470 Ga0466957_0404009
471 Ga0466960_0006567
472 Ga0466960_0019802
473 Ga0466960_0033237
474 Ga0466960_0077136
475 Ga0466960_0102839
476 Ga0466960_0215428
477 Ga0466959_0396063
478 Ga0466959_0940418
479 Ga0451576_0133971
480 Ga0466958_0026620
481 Ga0466967_0064404
482 Ga0466967_0091485
483 Ga0466967_0164467
484 Ga0466967_1098289
485 Ga0466967_1347174
486 Ga0466967_1396744
487 Ga0466967_1557549
488 Ga0466967_1908109
489 Ga0495629_0156209
490 Ga0495635_0122063
491 Ga0495676_0521400
492 Ga0496100_1397957
493 Ga0496102_0698155
494 Ga0496107_0974668
495 Ga0496108_0768281
496 Ga0496109_1090920
497 Ga0496110_1900177
498 Ga0496114_0160648
499 Ga0496124_0538839
500 Ga0496124_0756854
501 Ga0496126_0257306
502 Ga0501318_025580
503 Ga0501031_0038873
504 Ga0501031_0098916
505 Ga0501031_0203556
506 Ga0501032_0150811
507 Ga0501032_0739606
508 Ga0501033_0076041
509 Ga0501033_0140643
510 Ga0501034_0125170
511 Ga0501036_0003141
512 Ga0501036_0066610
513 Ga0501037_0840366
514 Ga0501038_0007635
515 Ga0501038_0239307
516 Ga0501039_0053467
517 Ga0501039_0093126
518 Ga0501040_0102187
519 Ga0501040_0240050
520 Ga0501041_0084852
521 Ga0501041_0405061
522 Ga0501042_0064206
523 Ga0501042_0089591
524 Ga0501042_0500410
525 Ga0501046_0177948
526 Ga0501046_0328826
527 Ga0501048_0015185
528 Ga0501067_0022969
529 Ga0501067_0313886
530 Ga0501068_0295846
531 Ga0501069_0061554
532 Ga0501069_0171966
533 Ga0501069_0317556
534 Ga0501069_0335997
535 Ga0501069_0462700
536 Ga0501069_0766949
537 Ga0501070_0144492
538 Ga0501070_0154063
539 Ga0501070_0190696
540 Ga0501070_0262832
541 Ga0501070_0307980
542 Ga0501070_0868248
543 Ga0501071_0010091
544 Ga0501071_0146273
545 Ga0501071_0200817
546 Ga0501071_0957652
547 Ga0501072_0007038
548 Ga0501072_0009611
549 Ga0501072_0053390
550 Ga0501072_0702723
551 Ga0501073_0246603
552 Ga0501073_0396223
553 Ga0501074_0061307
554 Ga0501074_0160233
555 Ga0501074_0845584
556 Ga0501075_0030366
557 Ga0501075_0127214
558 Ga0501075_0499524
559 Ga0501076_0043814
560 Ga0501076_0048542
561 Ga0501077_0139773
562 Ga0501077_0293037
563 Ga0501077_0344582
564 Ga0501079_0092053
565 Ga0501079_0213035
566 Ga0501079_0237465
567 Ga0501079_0239411
568 Ga0501080_0059374
569 Ga0501080_0268082
570 Ga0501080_0819213
571 Ga0501081_0038917
572 Ga0501081_0081059
573 Ga0501081_0740537
574 Ga0501083_0815727
575 Ga0501035_0083356
576 Ga0501035_0154849
577 Ga0501044_0427489
578 Ga0501044_0451023
579 Ga0501045_0031609
580 Ga0501045_0176113
581 Ga0501045_0427708
582 nmdc:mga03n38_100499_c1
583 nmdc:mga03n38_12795_c1
584 nmdc:mga03n38_192692_c1
585 nmdc:mga03n38_2906_c1
586 nmdc:mga03n38_3658_c1
587 nmdc:mga03n38_515524_c1
588 nmdc:mga03n38_818686_c1
589 nmdc:mga03n38_886856_c1
590 nmdc:mga00v17_131994_c1
591 nmdc:mga00v17_27885_c1
592 nmdc:mga00v17_303185_c1
593 nmdc:mga00v17_3703_c1
594 nmdc:mga00v17_527304_c1
595 nmdc:mga00v17_716651_c1
596 nmdc:mga0yw44_102352_c1
597 nmdc:mga0yw44_1257_c1
598 nmdc:mga0yw44_14670_c1
599 nmdc:mga0yw44_158267_c1
600 nmdc:mga0yw44_169128_c1
601 nmdc:mga0yw44_17966_c1
602 nmdc:mga0yw44_2577_c1
603 nmdc:mga0yw44_293253_c1
604 nmdc:mga0yw44_41971_c1
605 nmdc:mga0yw44_498950_c1
606 nmdc:mga0yw44_511695_c1
607 nmdc:mga0yw44_52293_c1
608 nmdc:mga0yw44_52514_c1
609 nmdc:mga0yw44_82210_c1
610 nmdc:mga0yw44_881712_c1
611 nmdc:mga06z11_138924_c1
612 nmdc:mga06z11_32770_c1
613 nmdc:mga06z11_34507_c1
614 nmdc:mga06z11_490226_c1
615 nmdc:mga06z11_5900_c1
616 nmdc:mga06z11_700721_c1
617 nmdc:mga06z11_84829_c1
618 nmdc:mga04h51_19413_c1
619 nmdc:mga04h51_51402_c1
620 nmdc:mga04h51_5354_c1
621 nmdc:mga07m45_191458_c1
622 nmdc:mga07m45_251830_c1
623 nmdc:mga07m45_359735_c1
624 nmdc:mga07m45_56494_c1
625 nmdc:mga07m45_693252_c1
626 nmdc:mga07m45_7704_c1
627 Ga0500644_0009962
628 Ga0500593_000126
629 Ga0500628_139882
630 Ga0501084_0083257
631 Ga0501084_0518273
632 Ga0501082_0098637
633 Ga0501082_0163039
634 Ga0501082_0413350
635 Ga0466962_0027020
636 Ga0466962_0049323
637 Ga0466962_0227980
638 Ga0530510_0052468
639 Ga0530510_0781436
640 2643828076
641 2644091834
642 2644321637
643 2644531166
644 2857483915

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17174

DUF5130

Domain of unknown function (DUF5130)

1

107

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lt2-assembly1.cif.gz_A nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov. 0.8941 3 118
5anp-assembly2.cif.gz_B crystal structure of the ba41 protein from bizionia argentinensis 0.8774 4 121
8hcr-assembly1.cif.gz_V cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci 0.8705 1 121
7e1v-assembly1.cif.gz_J cryo-em structure of apo hybrid respiratory supercomplex consisting of mycobacterium tuberculosis complexiii and mycobacterium smegmatis complexiv 0.8681 1 121
3ptj-assembly1.cif.gz_A structural and functional analysis of arabidopsis thaliana thylakoid lumen protein attlp18.3 0.8326 7 118
ID Description Score Start End Superfamily
af_P9WLA7_26_161_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.9073 1 114 3.10.310.50
2lt2A00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8941 3 118 3.10.310.50
5anpB00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8774 4 121 3.10.310.50
af_Q9XVA8_42_196_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8576 1 118 3.10.310.50
af_P55140_17_164_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8471 3 125 3.10.310.50
ID Description Score Start End GO Terms
AF-A0A6J7NSE9-F1-model_v4 Unannotated protein 0.9874 6 119
AF-A0A3A4A6V8-F1-model_v4 DUF5130 family protein 0.9868 6 120
AF-A0A4S8PKE4-F1-model_v4 DUF5130 family protein 0.9783 6 118
AF-A0A4P7ICK5-F1-model_v4 DUF5130 family protein 0.9778 1 119
AF-A0A3D4X160-F1-model_v4 DUF5130 domain-containing protein 0.9765 6 121

Map