F406509

General Info

Members Datasets Scaffolds Average Seq Length
322 160 644 258

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10015023|Ga0265316_100150233
Length 290
Sequence MKRGPLQPVAILTVLLAVAVAGVAQRGFERGGGRFGARIQEPDDPYDKVAERREGEFHFIRTEYTDLPQFHRGFGYSSRDGRGSGWWVVDWPAADNHFTAGLQRLTRIDIGDPRHLSLTDEHLFDYPWIYATQTGWWGLNPAEIARLREYLLRGGYLMTDDFWSNPPGQWEVFRGTMALVLPDQPITDIALSDPVMHVLYDIEEKDLTWIPGSRHLRRGYDGTVTLVQPEGTKPAWLSMEDGQGHMAVAVNYNTDIGDAWEFADVPYYPEKMTALAYRYGINYVVYAMTH

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
153 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.31
Rhizosphere 99.07
Stem 0
Stem Tuber 0
Unclassified 18.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10015023 3300031344 Bacteria 6787
2 Ga0065707_10105989 3300005295 Bacteria 2619
3 Ga0070658_10010397 3300005327 Bacteria 7461
4 Ga0070658_10320407 3300005327 Bacteria 1324
5 Ga0070683_100000006 3300005329 Bacteria 361071
6 Ga0070683_100039058 3300005329 Bacteria 4355
7 Ga0070683_100041392 3300005329 Bacteria 4238
8 Ga0070683_100221350 3300005329 Bacteria 1799
9 Ga0070677_10344146 3300005333 Archaea 771
10 Ga0070666_10008092 3300005335 Bacteria 6511
11 Ga0070680_100336986 3300005336 Bacteria 1281
12 Ga0068868_100027877 3300005338 Unclassified 4312
13 Ga0068868_100034421 3300005338 Bacteria 3911
14 Ga0068868_100035512 3300005338 Bacteria 3853
15 Ga0070660_100005108 3300005339 Bacteria 9065
16 Ga0070691_10109547 3300005341 Bacteria 1380
17 Ga0070692_10257590 3300005345 Archaea 1047
18 Ga0070669_100019161 3300005353 Bacteria 4890
19 Ga0070675_100144354 3300005354 Bacteria 2036
20 Ga0070675_100182806 3300005354 Unclassified 1813
21 Ga0070671_100087943 3300005355 Bacteria 2600
22 Ga0070674_100176900 3300005356 Bacteria 1631
23 Ga0070673_100893009 3300005364 Bacteria 824
24 Ga0070659_100176328 3300005366 Bacteria 1753
25 Ga0070667_100208621 3300005367 Unclassified 1736
26 Ga0070667_100421952 3300005367 Bacteria 1216
27 Ga0070714_100014078 3300005435 Bacteria 6419
28 Ga0070700_100102240 3300005441 Archaea 1890
29 Ga0070678_100184809 3300005456 Bacteria 1709
30 Ga0070681_10005895 3300005458 Bacteria 11864
31 Ga0070681_10067075 3300005458 Bacteria 3557
32 Ga0070681_10151813 3300005458 Bacteria 2243
33 Ga0068867_100105596 3300005459 Bacteria 2157
34 Ga0068867_100111160 3300005459 Unclassified 2105
35 Ga0068867_100369394 3300005459 Archaea 1202
36 Ga0070698_100002466 3300005471 Bacteria 20417
37 Ga0070699_100000916 3300005518 Bacteria 27468
38 Ga0070679_100332093 3300005530 Unclassified 1469
39 Ga0070684_100000063 3300005535 Bacteria 70046
40 Ga0070684_100000876 3300005535 Bacteria 21239
41 Ga0070684_100038539 3300005535 Bacteria 4106
42 Ga0070684_100468446 3300005535 Bacteria 1165
43 Ga0068853_100090519 3300005539 Bacteria 2689
44 Ga0068853_100185739 3300005539 Bacteria 1887
45 Ga0070672_100053240 3300005543 Unclassified 3164
46 Ga0070686_100027246 3300005544 Bacteria 3458
47 Ga0070665_100234519 3300005548 Bacteria 1835
48 Ga0070665_100596116 3300005548 Bacteria 1118
49 Ga0068855_100028326 3300005563 Bacteria 6700
50 Ga0068855_100061522 3300005563 Bacteria 4387
51 Ga0068855_100095451 3300005563 Bacteria 3427
52 Ga0068855_100139007 3300005563 Bacteria 2770
53 Ga0068855_100170068 3300005563 Bacteria 2469
54 Ga0068855_100236676 3300005563 Bacteria 2042
55 Ga0068855_100260259 3300005563 Unclassified 1933
56 Ga0070664_100053423 3300005564 Bacteria 3425
57 Ga0070664_100065709 3300005564 Bacteria 3096
58 Ga0070664_100075715 3300005564 Bacteria 2891
59 Ga0070664_100184707 3300005564 Bacteria 1855
60 Ga0068857_100006414 3300005577 Bacteria 10087
61 Ga0068857_100166443 3300005577 Bacteria 2002
62 Ga0068856_100007769 3300005614 Bacteria 10476
63 Ga0068856_100256488 3300005614 Unclassified 1764
64 Ga0068852_100008266 3300005616 Bacteria 7657
65 Ga0068852_100085949 3300005616 Bacteria 2803
66 Ga0068852_100332880 3300005616 Unclassified 1478
67 Ga0068852_100438358 3300005616 Bacteria 1291
68 Ga0068859_100062263 3300005617 Bacteria 3761
69 Ga0068859_100099289 3300005617 Unclassified 2966
70 Ga0068859_100277051 3300005617 Archaea 1770
71 Ga0068859_100576762 3300005617 Unclassified 1218
72 Ga0068864_100006354 3300005618 Bacteria 9689
73 Ga0068861_100009964 3300005719 Bacteria 6580
74 Ga0068870_10042952 3300005840 Archaea 2356
75 Ga0068863_100040448 3300005841 Viruses 4433
76 Ga0068863_101332240 3300005841 Bacteria 725
77 Ga0068858_100013621 3300005842 Bacteria 7675
78 Ga0068858_100041986 3300005842 Bacteria 4240
79 Ga0068860_100012315 3300005843 Bacteria 8428
80 Ga0068860_100250372 3300005843 Archaea 1725
81 Ga0068862_100000229 3300005844 Bacteria 62419
82 Ga0070717_10019414 3300006028 Bacteria 5329
83 Ga0070717_10611329 3300006028 Bacteria 989
84 Ga0097621_100002844 3300006237 Bacteria 11875
85 Ga0097621_100010897 3300006237 Bacteria 6673
86 Ga0097621_100015276 3300006237 Bacteria 5774
87 Ga0097621_100659074 3300006237 Bacteria 961
88 Ga0068871_100036228 3300006358 Bacteria 3927
89 Ga0068871_100442486 3300006358 Unclassified 1164
90 Ga0075430_100036861 3300006846 Bacteria 4145
91 Ga0075430_100205021 3300006846 Bacteria 1637
92 Ga0075430_100376533 3300006846 Bacteria 1172
93 Ga0075431_100008317 3300006847 Bacteria 10377
94 Ga0075431_100036288 3300006847 Bacteria 5077
95 Ga0075429_100286690 3300006880 Bacteria 1442
96 Ga0097620_100062265 3300006931 Bacteria 3761
97 Ga0097620_100099293 3300006931 Unclassified 2966
98 Ga0097620_100277058 3300006931 Archaea 1770
99 Ga0097620_100576785 3300006931 Unclassified 1218
100 Ga0105240_10001448 3300009093 Bacteria 40535
101 Ga0105240_10002366 3300009093 Bacteria 30409
102 Ga0105240_10002704 3300009093 Bacteria 28178
103 Ga0105240_10019015 3300009093 Bacteria 9196
104 Ga0105240_10084276 3300009093 Unclassified 3898
105 Ga0105240_10108555 3300009093 Bacteria 3362
106 Ga0105240_10223268 3300009093 Bacteria 2194
107 Ga0105240_10242789 3300009093 Bacteria 2087
108 Ga0105240_10317306 3300009093 Bacteria 1777
109 Ga0105240_10470284 3300009093 Unclassified 1403
110 Ga0111539_10016112 3300009094 Bacteria 9275
111 Ga0111539_10150796 3300009094 Unclassified 2721
112 Ga0105245_10005265 3300009098 Bacteria 11361
113 Ga0105245_10014944 3300009098 Bacteria 6764
114 Ga0105245_10059077 3300009098 Bacteria 3452
115 Ga0105245_10296645 3300009098 Unclassified 1584
116 Ga0114129_10034649 3300009147 Bacteria 7131
117 Ga0114129_10449496 3300009147 Bacteria 1690
118 Ga0105243_10398248 3300009148 Bacteria 1278
119 Ga0105241_10001429 3300009174 Bacteria 18313
120 Ga0105241_10054528 3300009174 Bacteria 3060
121 Ga0105241_10079334 3300009174 Bacteria 2566
122 Ga0105242_10031739 3300009176 Bacteria 4222
123 Ga0105242_10035919 3300009176 Unclassified 3973
124 Ga0105242_10132844 3300009176 Unclassified 2151
125 Ga0105248_10094792 3300009177 Bacteria 3360
126 Ga0105248_10251461 3300009177 Bacteria 1989
127 Ga0105237_10001809 3300009545 Bacteria 27592
128 Ga0105237_10008889 3300009545 Bacteria 10823
129 Ga0105237_10011488 3300009545 Bacteria 9368
130 Ga0105237_10021436 3300009545 Bacteria 6643
131 Ga0105237_10571872 3300009545 Bacteria 1137
132 Ga0105238_10020385 3300009551 Bacteria 6750
133 Ga0105238_10034067 3300009551 Bacteria 5183
134 Ga0105238_10035327 3300009551 Bacteria 5082
135 Ga0105238_10146852 3300009551 Unclassified 2334
136 Ga0105249_10000179 3300009553 Bacteria 74358
137 Ga0105249_10045206 3300009553 Bacteria 4004
138 Ga0105239_10006565 3300010375 Bacteria 13472
139 Ga0105239_10024070 3300010375 Bacteria 6707
140 Ga0105239_10099224 3300010375 Bacteria 3219
141 Ga0105239_10122675 3300010375 Bacteria 2887
142 Ga0105239_10131399 3300010375 Bacteria 2785
143 Ga0157373_10001640 3300013100 Bacteria 17081
144 Ga0157370_10001830 3300013104 Bacteria 26200
145 Ga0157369_10066238 3300013105 Bacteria 3886
146 Ga0157369_10077777 3300013105 Bacteria 3556
147 Ga0157369_10183599 3300013105 Bacteria 2200
148 Ga0157369_10275780 3300013105 Unclassified 1752
149 Ga0157369_10286802 3300013105 Unclassified 1714
150 Ga0157369_10506209 3300013105 Bacteria 1249
151 Ga0157378_10019553 3300013297 Bacteria 5954
152 Ga0157378_10566120 3300013297 Unclassified 1144
153 Ga0163162_10006783 3300013306 Bacteria 11111
154 Ga0163162_10023012 3300013306 Bacteria 6145
155 Ga0163162_10055701 3300013306 Bacteria 3982
156 Ga0163162_10071959 3300013306 Unclassified 3512
157 Ga0157372_10015389 3300013307 Bacteria 8198
158 Ga0157372_10020054 3300013307 Bacteria 7209
159 Ga0157372_10120620 3300013307 Bacteria 3011
160 Ga0157375_10021471 3300013308 Bacteria 5921
161 Ga0157375_10044198 3300013308 Bacteria 4326
162 Ga0163163_10004492 3300014325 Bacteria 11906
163 Ga0163163_10005009 3300014325 Bacteria 11415
164 Ga0163163_10120500 3300014325 Bacteria 2657
165 Ga0163163_10522907 3300014325 Unclassified 1249
166 Ga0157380_10021694 3300014326 Bacteria 4821
167 Ga0157376_10161221 3300014969 Unclassified 2033
168 Ga0197907_11066729 3300020069 Bacteria 1824
169 Ga0207682_10003065 3300025893 Bacteria 7334
170 Ga0207680_10004657 3300025903 Bacteria 6511
171 Ga0207643_10045398 3300025908 Archaea 2481
172 Ga0207705_10015499 3300025909 Bacteria 5469
173 Ga0207705_10128861 3300025909 Unclassified 1882
174 Ga0207654_10022064 3300025911 Unclassified 3392
175 Ga0207707_10001765 3300025912 Bacteria 19859
176 Ga0207707_10014368 3300025912 Bacteria 6897
177 Ga0207707_10034149 3300025912 Bacteria 4450
178 Ga0207707_10090051 3300025912 Bacteria 2681
179 Ga0207707_10308174 3300025912 Unclassified 1368
180 Ga0207707_10333749 3300025912 Bacteria 1308
181 Ga0207695_10001858 3300025913 Bacteria 33090
182 Ga0207695_10003644 3300025913 Bacteria 21517
183 Ga0207695_10006526 3300025913 Bacteria 15100
184 Ga0207695_10018524 3300025913 Bacteria 8048
185 Ga0207695_10022313 3300025913 Bacteria 7191
186 Ga0207695_10052404 3300025913 Bacteria 4275
187 Ga0207695_10091386 3300025913 Bacteria 3058
188 Ga0207695_10112524 3300025913 Unclassified 2700
189 Ga0207671_10011679 3300025914 Bacteria 7123
190 Ga0207671_10024088 3300025914 Bacteria 4581
191 Ga0207671_10024579 3300025914 Bacteria 4527
192 Ga0207671_10370281 3300025914 Bacteria 1137
193 Ga0207660_10010030 3300025917 Bacteria 6136
194 Ga0207657_10005317 3300025919 Bacteria 13494
195 Ga0207657_10211279 3300025919 Bacteria 1557
196 Ga0207657_10301858 3300025919 Bacteria 1268
197 Ga0207649_10008095 3300025920 Bacteria 5719
198 Ga0207652_10001811 3300025921 Bacteria 18524
199 Ga0207652_10022424 3300025921 Bacteria 5224
200 Ga0207652_10121408 3300025921 Unclassified 2325
201 Ga0207652_10256863 3300025921 Bacteria 1576
202 Ga0207652_10313409 3300025921 Bacteria 1416
203 Ga0207681_10002375 3300025923 Bacteria 11969
204 Ga0207694_10009226 3300025924 Bacteria 7443
205 Ga0207694_10014279 3300025924 Bacteria 5989
206 Ga0207694_10048561 3300025924 Bacteria 3284
207 Ga0207694_10174287 3300025924 Bacteria 1742
208 Ga0207659_10762823 3300025926 Unclassified 830
209 Ga0207687_10010370 3300025927 Bacteria 6088
210 Ga0207687_10027586 3300025927 Bacteria 3812
211 Ga0207700_10231654 3300025928 Bacteria 1571
212 Ga0207690_10193962 3300025932 Bacteria 1538
213 Ga0207686_10091893 3300025934 Unclassified 2006
214 Ga0207686_10104525 3300025934 Bacteria 1897
215 Ga0207669_10373287 3300025937 Bacteria 1109
216 Ga0207665_10301516 3300025939 Unclassified 1198
217 Ga0207661_10000011 3300025944 Bacteria 361200
218 Ga0207661_10031829 3300025944 Bacteria 4080
219 Ga0207661_10124391 3300025944 Bacteria 2200
220 Ga0207661_10233342 3300025944 Bacteria 1630
221 Ga0207679_10003990 3300025945 Bacteria 9166
222 Ga0207679_10013604 3300025945 Bacteria 5334
223 Ga0207679_10058869 3300025945 Bacteria 2849
224 Ga0207667_10024520 3300025949 Bacteria 6621
225 Ga0207667_10041827 3300025949 Bacteria 4873
226 Ga0207667_10055218 3300025949 Bacteria 4176
227 Ga0207667_10073281 3300025949 Unclassified 3558
228 Ga0207667_11020954 3300025949 Unclassified 813
229 Ga0207651_10178860 3300025960 Bacteria 1681
230 Ga0207712_10001568 3300025961 Bacteria 15391
231 Ga0207712_10081870 3300025961 Bacteria 2352
232 Ga0207712_10216668 3300025961 Bacteria 1528
233 Ga0207668_10130582 3300025972 Bacteria 1918
234 Ga0207640_10010518 3300025981 Bacteria 5216
235 Ga0207658_10127771 3300025986 Bacteria 2037
236 Ga0207658_10239535 3300025986 Unclassified 1536
237 Ga0207677_10024863 3300026023 Unclassified 3727
238 Ga0207677_10032311 3300026023 Bacteria 3363
239 Ga0207703_10006913 3300026035 Bacteria 9030
240 Ga0207703_10010104 3300026035 Bacteria 7396
241 Ga0207708_10135835 3300026075 Archaea 1926
242 Ga0207708_10256046 3300026075 Bacteria 1412
243 Ga0207702_10055077 3300026078 Bacteria 3372
244 Ga0207641_10011925 3300026088 Bacteria 7131
245 Ga0207641_10115689 3300026088 Bacteria 2385
246 Ga0207648_10004220 3300026089 Bacteria 14848
247 Ga0207648_10134098 3300026089 Unclassified 2180
248 Ga0207676_10012466 3300026095 Bacteria 6093
249 Ga0207674_10006661 3300026116 Bacteria 13570
250 Ga0207674_10011250 3300026116 Bacteria 10059
251 Ga0207674_10500080 3300026116 Unclassified 1174
252 Ga0207674_10500081 3300026116 Bacteria 1174
253 Ga0207675_100002797 3300026118 Bacteria 17149
254 Ga0207683_10140111 3300026121 Bacteria 2179
255 Ga0207698_10004117 3300026142 Bacteria 8833
256 Ga0207698_10061978 3300026142 Bacteria 2918
257 Ga0207698_10150398 3300026142 Unclassified 2020
258 Ga0207428_10042313 3300027907 Bacteria 3683
259 Ga0207428_10133548 3300027907 Unclassified 1898
260 Ga0207428_10249698 3300027907 Bacteria 1323
261 Ga0268266_10054152 3300028379 Unclassified 3447
262 Ga0268266_10268256 3300028379 Bacteria 1584
263 Ga0268265_10001416 3300028380 Bacteria 20295
264 Ga0268264_10010893 3300028381 Bacteria 7512
265 Ga0268264_10426845 3300028381 Archaea 1279
266 Ga0265338_10216805 3300028800 Bacteria 1432
267 Ga0265339_10169237 3300031249 Unclassified 1095
268 Ga0265316_10057066 3300031344 Unclassified 3046
269 Ga0265314_10000821 3300031711 Bacteria 36981
270 Ga0265314_10107208 3300031711 Bacteria 1783
271 Ga0265342_10090658 3300031712 Bacteria 1753
272 Ga0307405_10004579 3300031731 Bacteria 6558
273 Ga0307413_10060718 3300031824 Bacteria 2328
274 Ga0307410_10168559 3300031852 Bacteria 1647
275 Ga0307406_10005193 3300031901 Bacteria 7111
276 Ga0307407_10070847 3300031903 Bacteria 2073
277 Ga0307412_10039060 3300031911 Bacteria 3061
278 Ga0307409_100199910 3300031995 Unclassified 1787
279 Ga0307416_100017401 3300032002 Bacteria 5029
280 Ga0307414_10001340 3300032004 Bacteria 12725
281 Ga0307411_10016175 3300032005 Bacteria 4217
282 Ga0373935_0402395 3300035692 Bacteria 983
283 Ga0373927_0001454 3300035695 Bacteria 17855
284 Ga0373927_0001636 3300035695 Bacteria 16788
285 Ga0373947_0001888 3300035725 Bacteria 12796
286 Ga0373947_0021685 3300035725 Bacteria 3720
287 Ga0373947_0117887 3300035725 Unclassified 1684
288 Ga0373937_0010426 3300036401 Bacteria 8116
289 Ga0373925_0001564 3300037068 Bacteria 19408
290 Ga0373925_0072262 3300037068 Unclassified 2610
291 Ga0373925_0386272 3300037068 Unclassified 1140
292 Ga0436364_0285517 3300037853 Unclassified 3182
293 Ga0436365_0075896 3300039437 Bacteria 7806
294 Ga0439462_0059555 3300042015 Bacteria 1032
295 Ga0453684_0104436 3300044712 Bacteria 3459
296 Ga0495580_0165555 3300046472 Unclassified 1529
297 Ga0495580_0203603 3300046472 Bacteria 1363
298 Ga0495580_0265628 3300046472 Bacteria 1173
299 Ga0495639_0211724 3300046475 Unclassified 951
300 Ga0495630_0423256 3300046517 Unclassified 1020
301 Ga0495665_0052559 3300046531 Unclassified 2157
302 Ga0495633_0142100 3300046558 Bacteria 1110
303 Ga0495599_0117796 3300046678 Unclassified 1652
304 Ga0495658_0079654 3300046683 Bacteria 1920
305 Ga0495581_0069620 3300047315 Bacteria 2035
306 Ga0495636_0184147 3300047318 Bacteria 949
307 Ga0496112_0307037 3300048915 Unclassified 1532
308 Ga0501249_010780 3300049679 Bacteria 1914
309 Ga0501250_013880 3300049680 Bacteria 972
310 nmdc:mga05p37_123629_c1 3300050507 Bacteria 3178
311 nmdc:mga05p37_439401_c1 3300050507 Unclassified 1513
312 nmdc:mga09592_286952_c1 3300050508 Bacteria 1427
313 nmdc:mga0qj67_161442_c1 3300050509 Bacteria 1819
314 nmdc:mga0qj67_306052_c1 3300050509 Bacteria 1287
315 nmdc:mga0qj67_388673_c1 3300050509 Unclassified 1126
316 nmdc:mga0qj67_99075_c1 3300050509 Bacteria 2348
317 nmdc:mga06r32_10814_c1 3300050510 Bacteria 8220
318 nmdc:mga06r32_178033_c1 3300050510 Bacteria 2111
319 nmdc:mga08y16_129412_c1 3300050511 Unclassified 2626
320 nmdc:mga08y16_64488_c1 3300050511 Bacteria 3825
321 Ga0495612_0068561 3300053078 Unclassified 1476
322 Ga0501082_0018533 3300060353 Bacteria 5998
323 Ga0265316_10015023
324 Ga0065707_10105989
325 Ga0070658_10010397
326 Ga0070658_10320407
327 Ga0070683_100000006
328 Ga0070683_100039058
329 Ga0070683_100041392
330 Ga0070683_100221350
331 Ga0070677_10344146
332 Ga0070666_10008092
333 Ga0070680_100336986
334 Ga0068868_100027877
335 Ga0068868_100034421
336 Ga0068868_100035512
337 Ga0070660_100005108
338 Ga0070691_10109547
339 Ga0070692_10257590
340 Ga0070669_100019161
341 Ga0070675_100144354
342 Ga0070675_100182806
343 Ga0070671_100087943
344 Ga0070674_100176900
345 Ga0070673_100893009
346 Ga0070659_100176328
347 Ga0070667_100208621
348 Ga0070667_100421952
349 Ga0070714_100014078
350 Ga0070700_100102240
351 Ga0070678_100184809
352 Ga0070681_10005895
353 Ga0070681_10067075
354 Ga0070681_10151813
355 Ga0068867_100105596
356 Ga0068867_100111160
357 Ga0068867_100369394
358 Ga0070698_100002466
359 Ga0070699_100000916
360 Ga0070679_100332093
361 Ga0070684_100000063
362 Ga0070684_100000876
363 Ga0070684_100038539
364 Ga0070684_100468446
365 Ga0068853_100090519
366 Ga0068853_100185739
367 Ga0070672_100053240
368 Ga0070686_100027246
369 Ga0070665_100234519
370 Ga0070665_100596116
371 Ga0068855_100028326
372 Ga0068855_100061522
373 Ga0068855_100095451
374 Ga0068855_100139007
375 Ga0068855_100170068
376 Ga0068855_100236676
377 Ga0068855_100260259
378 Ga0070664_100053423
379 Ga0070664_100065709
380 Ga0070664_100075715
381 Ga0070664_100184707
382 Ga0068857_100006414
383 Ga0068857_100166443
384 Ga0068856_100007769
385 Ga0068856_100256488
386 Ga0068852_100008266
387 Ga0068852_100085949
388 Ga0068852_100332880
389 Ga0068852_100438358
390 Ga0068859_100062263
391 Ga0068859_100099289
392 Ga0068859_100277051
393 Ga0068859_100576762
394 Ga0068864_100006354
395 Ga0068861_100009964
396 Ga0068870_10042952
397 Ga0068863_100040448
398 Ga0068863_101332240
399 Ga0068858_100013621
400 Ga0068858_100041986
401 Ga0068860_100012315
402 Ga0068860_100250372
403 Ga0068862_100000229
404 Ga0070717_10019414
405 Ga0070717_10611329
406 Ga0097621_100002844
407 Ga0097621_100010897
408 Ga0097621_100015276
409 Ga0097621_100659074
410 Ga0068871_100036228
411 Ga0068871_100442486
412 Ga0075430_100036861
413 Ga0075430_100205021
414 Ga0075430_100376533
415 Ga0075431_100008317
416 Ga0075431_100036288
417 Ga0075429_100286690
418 Ga0097620_100062265
419 Ga0097620_100099293
420 Ga0097620_100277058
421 Ga0097620_100576785
422 Ga0105240_10001448
423 Ga0105240_10002366
424 Ga0105240_10002704
425 Ga0105240_10019015
426 Ga0105240_10084276
427 Ga0105240_10108555
428 Ga0105240_10223268
429 Ga0105240_10242789
430 Ga0105240_10317306
431 Ga0105240_10470284
432 Ga0111539_10016112
433 Ga0111539_10150796
434 Ga0105245_10005265
435 Ga0105245_10014944
436 Ga0105245_10059077
437 Ga0105245_10296645
438 Ga0114129_10034649
439 Ga0114129_10449496
440 Ga0105243_10398248
441 Ga0105241_10001429
442 Ga0105241_10054528
443 Ga0105241_10079334
444 Ga0105242_10031739
445 Ga0105242_10035919
446 Ga0105242_10132844
447 Ga0105248_10094792
448 Ga0105248_10251461
449 Ga0105237_10001809
450 Ga0105237_10008889
451 Ga0105237_10011488
452 Ga0105237_10021436
453 Ga0105237_10571872
454 Ga0105238_10020385
455 Ga0105238_10034067
456 Ga0105238_10035327
457 Ga0105238_10146852
458 Ga0105249_10000179
459 Ga0105249_10045206
460 Ga0105239_10006565
461 Ga0105239_10024070
462 Ga0105239_10099224
463 Ga0105239_10122675
464 Ga0105239_10131399
465 Ga0157373_10001640
466 Ga0157370_10001830
467 Ga0157369_10066238
468 Ga0157369_10077777
469 Ga0157369_10183599
470 Ga0157369_10275780
471 Ga0157369_10286802
472 Ga0157369_10506209
473 Ga0157378_10019553
474 Ga0157378_10566120
475 Ga0163162_10006783
476 Ga0163162_10023012
477 Ga0163162_10055701
478 Ga0163162_10071959
479 Ga0157372_10015389
480 Ga0157372_10020054
481 Ga0157372_10120620
482 Ga0157375_10021471
483 Ga0157375_10044198
484 Ga0163163_10004492
485 Ga0163163_10005009
486 Ga0163163_10120500
487 Ga0163163_10522907
488 Ga0157380_10021694
489 Ga0157376_10161221
490 Ga0197907_11066729
491 Ga0207682_10003065
492 Ga0207680_10004657
493 Ga0207643_10045398
494 Ga0207705_10015499
495 Ga0207705_10128861
496 Ga0207654_10022064
497 Ga0207707_10001765
498 Ga0207707_10014368
499 Ga0207707_10034149
500 Ga0207707_10090051
501 Ga0207707_10308174
502 Ga0207707_10333749
503 Ga0207695_10001858
504 Ga0207695_10003644
505 Ga0207695_10006526
506 Ga0207695_10018524
507 Ga0207695_10022313
508 Ga0207695_10052404
509 Ga0207695_10091386
510 Ga0207695_10112524
511 Ga0207671_10011679
512 Ga0207671_10024088
513 Ga0207671_10024579
514 Ga0207671_10370281
515 Ga0207660_10010030
516 Ga0207657_10005317
517 Ga0207657_10211279
518 Ga0207657_10301858
519 Ga0207649_10008095
520 Ga0207652_10001811
521 Ga0207652_10022424
522 Ga0207652_10121408
523 Ga0207652_10256863
524 Ga0207652_10313409
525 Ga0207681_10002375
526 Ga0207694_10009226
527 Ga0207694_10014279
528 Ga0207694_10048561
529 Ga0207694_10174287
530 Ga0207659_10762823
531 Ga0207687_10010370
532 Ga0207687_10027586
533 Ga0207700_10231654
534 Ga0207690_10193962
535 Ga0207686_10091893
536 Ga0207686_10104525
537 Ga0207669_10373287
538 Ga0207665_10301516
539 Ga0207661_10000011
540 Ga0207661_10031829
541 Ga0207661_10124391
542 Ga0207661_10233342
543 Ga0207679_10003990
544 Ga0207679_10013604
545 Ga0207679_10058869
546 Ga0207667_10024520
547 Ga0207667_10041827
548 Ga0207667_10055218
549 Ga0207667_10073281
550 Ga0207667_11020954
551 Ga0207651_10178860
552 Ga0207712_10001568
553 Ga0207712_10081870
554 Ga0207712_10216668
555 Ga0207668_10130582
556 Ga0207640_10010518
557 Ga0207658_10127771
558 Ga0207658_10239535
559 Ga0207677_10024863
560 Ga0207677_10032311
561 Ga0207703_10006913
562 Ga0207703_10010104
563 Ga0207708_10135835
564 Ga0207708_10256046
565 Ga0207702_10055077
566 Ga0207641_10011925
567 Ga0207641_10115689
568 Ga0207648_10004220
569 Ga0207648_10134098
570 Ga0207676_10012466
571 Ga0207674_10006661
572 Ga0207674_10011250
573 Ga0207674_10500080
574 Ga0207674_10500081
575 Ga0207675_100002797
576 Ga0207683_10140111
577 Ga0207698_10004117
578 Ga0207698_10061978
579 Ga0207698_10150398
580 Ga0207428_10042313
581 Ga0207428_10133548
582 Ga0207428_10249698
583 Ga0268266_10054152
584 Ga0268266_10268256
585 Ga0268265_10001416
586 Ga0268264_10010893
587 Ga0268264_10426845
588 Ga0265338_10216805
589 Ga0265339_10169237
590 Ga0265316_10057066
591 Ga0265314_10000821
592 Ga0265314_10107208
593 Ga0265342_10090658
594 Ga0307405_10004579
595 Ga0307413_10060718
596 Ga0307410_10168559
597 Ga0307406_10005193
598 Ga0307407_10070847
599 Ga0307412_10039060
600 Ga0307409_100199910
601 Ga0307416_100017401
602 Ga0307414_10001340
603 Ga0307411_10016175
604 Ga0373935_0402395
605 Ga0373927_0001454
606 Ga0373927_0001636
607 Ga0373947_0001888
608 Ga0373947_0021685
609 Ga0373947_0117887
610 Ga0373937_0010426
611 Ga0373925_0001564
612 Ga0373925_0072262
613 Ga0373925_0386272
614 Ga0436364_0285517
615 Ga0436365_0075896
616 Ga0439462_0059555
617 Ga0453684_0104436
618 Ga0495580_0165555
619 Ga0495580_0203603
620 Ga0495580_0265628
621 Ga0495639_0211724
622 Ga0495630_0423256
623 Ga0495665_0052559
624 Ga0495633_0142100
625 Ga0495599_0117796
626 Ga0495658_0079654
627 Ga0495581_0069620
628 Ga0495636_0184147
629 Ga0496112_0307037
630 Ga0501249_010780
631 Ga0501250_013880
632 nmdc:mga05p37_123629_c1
633 nmdc:mga05p37_439401_c1
634 nmdc:mga09592_286952_c1
635 nmdc:mga0qj67_161442_c1
636 nmdc:mga0qj67_306052_c1
637 nmdc:mga0qj67_388673_c1
638 nmdc:mga0qj67_99075_c1
639 nmdc:mga06r32_10814_c1
640 nmdc:mga06r32_178033_c1
641 nmdc:mga08y16_129412_c1
642 nmdc:mga08y16_64488_c1
643 Ga0495612_0068561
644 Ga0501082_0018533

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13709

DUF4159

Domain of unknown function (DUF4159)

76

288

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i66-assembly1.cif.gz_A-2 crystal structure of hoch_4089 protein from haliangium ochraceum 0.8303 25 217
4i66-assembly1.cif.gz_A-2 crystal structure of hoch_4089 protein from haliangium ochraceum 0.7991 25 217
4kie-assembly1.cif.gz_A crystal structure of the eal domain of c-di-gmp specific phosphodiesterase yaha 0.7016 79 129
5mfu-assembly1.cif.gz_A pa3825-eal mn-pgpg structure 0.6824 79 127
5fms-assembly1.cif.gz_A mmift52 n-terminal domain 0.6132 26 163
ID Description Score Start End Superfamily
4i66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 0.7959 25 217 3.40.50.12140
4i66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 0.7845 25 217 3.40.50.12140
af_Q4DHC1_29_128_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6648 79 127 3.40.50.1000
af_O01916_50_234_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.6638 185 219 1.20.120.1760
af_F1QAW1_1_253_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6148 183 218 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A2V7M6J9-F1-model_v4 DUF4159 domain-containing protein 0.9476 22 221
AF-A0A838QEM6-F1-model_v4 DUF4159 domain-containing protein 0.9441 21 221
AF-A0A2V7P7T0-F1-model_v4 DUF4159 domain-containing protein 0.9439 40 221
AF-A0A3D2RGB7-F1-model_v4 DUF4159 domain-containing protein 0.9429 25 218
AF-A0A1G3U6T2-F1-model_v4 DUF4159 domain-containing protein 0.9416 44 216

Map