F406504

General Info

Members Datasets Scaffolds Average Seq Length
322 221 302 114

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10135081|Ga0265338_101350813
Length 132
Sequence VSVVADEVDDDLWSAIGDPTRRRLLDQLLADGAGTATSLSEHLPVTRQAVAKHLGVLDRVGLVHVAPAGRERRYQVDEAQLARAVAQLAAVGSTWDARLRRIKRMAEAIQRATDEKKSNRTTRDTINEKEKD

Samples

Sample ID Description Type Environment
1 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
2 2671180195 Frankia sp. CcI49 Isolate Nodule
3 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
4 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
5 2687453737 Frankia sp. BMG5.36 Isolate Nodule
6 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
7 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
8 2773857922 Frankia sp. CcI49 Isolate Nodule
9 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
10 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
11 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
12 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
13 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
14 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
15 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
16 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
17 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
18 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
19 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
86 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
87 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
88 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
102 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
103 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
104 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
105 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
106 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
107 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
108 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
109 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
110 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
111 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
114 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
115 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
116 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
117 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
141 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
216 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
221 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.17
Metatranscriptomes 0.62
Isolates 6.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 1.55
Rhizoplane 13.35
Rhizosphere 77.64
Stem 0
Stem Tuber 0
Unclassified 6.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_101577410 3300005329 Bacteria 631
2 Ga0070670_100721122 3300005331 Bacteria 897
3 Ga0070670_100967585 3300005331 Bacteria 773
4 Ga0070682_100328855 3300005337 Bacteria 1132
5 Ga0070682_100748452 3300005337 Bacteria 789
6 Ga0068868_100145435 3300005338 Bacteria 1949
7 Ga0068868_100241150 3300005338 Bacteria 1519
8 Ga0070691_11016739 3300005341 Bacteria 518
9 Ga0070675_101343700 3300005354 Bacteria 659
10 Ga0070685_10146360 3300005466 Bacteria 1493
11 Ga0070679_100278441 3300005530 Bacteria 1626
12 Ga0070679_101035171 3300005530 Bacteria 765
13 Ga0070665_101450224 3300005548 Bacteria 695
14 Ga0070665_101858240 3300005548 Bacteria 608
15 Ga0068857_100362728 3300005577 Bacteria 1343
16 Ga0068852_100244882 3300005616 Bacteria 1715
17 Ga0068852_100635333 3300005616 Bacteria 1074
18 Ga0081455_10059062 3300005937 Bacteria 3240
19 Ga0070717_10827942 3300006028 Bacteria 842
20 Ga0075365_10656794 3300006038 Bacteria 741
21 Ga0075364_11144662 3300006051 Bacteria 528
22 Ga0097621_100317198 3300006237 Bacteria 1380
23 Ga0075428_100018394 3300006844 Bacteria 7726
24 Ga0075430_100030229 3300006846 Bacteria 4599
25 Ga0075430_100052503 3300006846 Bacteria 3434
26 Ga0075430_100461792 3300006846 Bacteria 1048
27 Ga0075431_100007782 3300006847 Bacteria 10671
28 Ga0075431_100012461 3300006847 Bacteria 8581
29 Ga0075429_100005159 3300006880 Bacteria 11237
30 Ga0075429_100023263 3300006880 Bacteria 5374
31 Ga0068865_100444066 3300006881 Bacteria 1071
32 Ga0105251_10008805 3300009011 Bacteria 6049
33 Ga0105244_10365044 3300009036 Bacteria 665
34 Ga0111539_10320248 3300009094 Bacteria 1804
35 Ga0105245_10984804 3300009098 Bacteria 887
36 Ga0105245_11721743 3300009098 Bacteria 679
37 Ga0105245_12276674 3300009098 Bacteria 596
38 Ga0105247_10000056 3300009101 Bacteria 133965
39 Ga0105247_10681896 3300009101 Bacteria 771
40 Ga0105247_11128085 3300009101 Bacteria 620
41 Ga0114129_10020153 3300009147 Bacteria 9491
42 Ga0114129_10235239 3300009147 Bacteria 2465
43 Ga0105243_10712529 3300009148 Bacteria 980
44 Ga0105241_11246585 3300009174 Bacteria 706
45 Ga0105242_10319224 3300009176 Bacteria 1424
46 Ga0105242_10419468 3300009176 Bacteria 1254
47 Ga0105248_10000079 3300009177 Bacteria 111571
48 Ga0105248_10001665 3300009177 Bacteria 24708
49 Ga0105238_11688339 3300009551 Bacteria 664
50 Ga0105238_11958472 3300009551 Bacteria 619
51 Ga0105249_11593619 3300009553 Bacteria 725
52 Ga0105239_11822498 3300010375 Bacteria 705
53 Ga0105246_10319590 3300011119 Bacteria 1261
54 Ga0105246_11400772 3300011119 Bacteria 652
55 Ga0157369_11303885 3300013105 Bacteria 740
56 Ga0157375_10306382 3300013308 Bacteria 1752
57 Ga0163163_11258332 3300014325 Bacteria 802
58 Ga0163163_11677229 3300014325 Bacteria 696
59 Ga0157380_10235102 3300014326 Bacteria 1648
60 Ga0157377_10466587 3300014745 Bacteria 875
61 Ga0157379_11056511 3300014968 Bacteria 776
62 Ga0157376_10074502 3300014969 Bacteria 2894
63 Ga0163161_10645776 3300017792 Bacteria 876
64 Ga0163161_11959301 3300017792 Bacteria 521
65 Ga0224712_10109161 3300022467 Bacteria 1184
66 Ga0224712_10136786 3300022467 Bacteria 1075
67 Ga0207713_1008472 3300025735 Bacteria 5918
68 Ga0207710_10000084 3300025900 Bacteria 133802
69 Ga0207688_10946649 3300025901 Bacteria 545
70 Ga0207647_10163030 3300025904 Bacteria 1300
71 Ga0207652_10797213 3300025921 Bacteria 839
72 Ga0207694_11598903 3300025924 Bacteria 549
73 Ga0207659_10246924 3300025926 Bacteria 1446
74 Ga0207659_10519197 3300025926 Bacteria 1010
75 Ga0207687_10541453 3300025927 Bacteria 976
76 Ga0207709_10884752 3300025935 Bacteria 725
77 Ga0207709_10911658 3300025935 Bacteria 715
78 Ga0207691_10633632 3300025940 Bacteria 904
79 Ga0207691_10975703 3300025940 Bacteria 708
80 Ga0207711_10000072 3300025941 Bacteria 112054
81 Ga0207711_10036395 3300025941 Bacteria 4177
82 Ga0207667_10047676 3300025949 Bacteria 4534
83 Ga0207712_10805714 3300025961 Bacteria 826
84 Ga0207712_11017797 3300025961 Bacteria 735
85 Ga0207658_11379252 3300025986 Bacteria 645
86 Ga0207677_10192051 3300026023 Bacteria 1616
87 Ga0207678_10209112 3300026067 Bacteria 1669
88 Ga0207678_10847866 3300026067 Bacteria 807
89 Ga0207702_10277473 3300026078 Bacteria 1583
90 Ga0207683_10345354 3300026121 Bacteria 1365
91 Ga0207683_11972827 3300026121 Bacteria 532
92 Ga0207698_10218354 3300026142 Bacteria 1721
93 Ga0207698_10347298 3300026142 Bacteria 1400
94 Ga0307515_10171985 3300028794 Bacteria 2155
95 Ga0265338_10135081 3300028800 Bacteria 1941
96 Ga0316177_1174120 3300030731 Bacteria 2369
97 Ga0316176_1068617 3300030732 Bacteria 7193
98 Ga0314311_1119164 3300030733 Bacteria 9249
99 Ga0316180_1010075 3300030736 Bacteria 2234
100 Ga0307513_10001895 3300031456 Bacteria 29712
101 Ga0307509_10272004 3300031507 Bacteria 1461
102 Ga0307408_101643192 3300031548 Bacteria 611
103 Ga0307413_10350686 3300031824 Bacteria 1139
104 Ga0307410_10514290 3300031852 Bacteria 987
105 Ga0307410_11293251 3300031852 Bacteria 638
106 Ga0307409_100345428 3300031995 Bacteria 1402
107 Ga0307409_100478641 3300031995 Bacteria 1208
108 Ga0307409_101844310 3300031995 Bacteria 634
109 Ga0307416_100210049 3300032002 Bacteria 1856
110 Ga0307411_11635952 3300032005 Bacteria 595
111 Ga0307415_100222618 3300032126 Bacteria 1514
112 Ga0307415_101831253 3300032126 Bacteria 588
113 Ga0373948_0083222 3300034817 Bacteria 733
114 Ga0395898_0222409 3300037466 Bacteria 1800
115 Ga0395898_0651790 3300037466 Bacteria 995
116 Ga0395901_0124665 3300038443 Bacteria 2707
117 Ga0395901_1914751 3300038443 Bacteria 540
118 Ga0439447_136242 3300041407 Bacteria 564
119 Ga0451789_1080808 3300041443 Bacteria 948
120 Ga0451791_0501271 3300041451 Bacteria 632
121 Ga0451791_1590370 3300041451 Bacteria 776
122 Ga0451793_0583940 3300041452 Bacteria 830
123 Ga0451793_0698822 3300041452 Bacteria 1084
124 Ga0451795_0064227 3300041456 Bacteria 884
125 Ga0451802_0519959 3300041460 Bacteria 991
126 Ga0451804_0982144 3300041463 Bacteria 529
127 Ga0451837_1667588 3300041494 Bacteria 758
128 Ga0451841_0818454 3300041498 Bacteria 4108
129 Ga0451847_0820850 3300041503 Bacteria 601
130 Ga0451849_1315816 3300041505 Bacteria 1265
131 Ga0451853_0618226 3300041512 Bacteria 606
132 Ga0451853_2328193 3300041512 Bacteria 2660
133 Ga0451853_2918900 3300041512 Bacteria 1360
134 Ga0439431_0062457 3300041997 Bacteria 982
135 Ga0439442_026620 3300042002 Bacteria 1204
136 Ga0439445_0085819 3300042004 Bacteria 883
137 Ga0439446_0036750 3300042156 Bacteria 1432
138 Ga0439434_0006231 3300042435 Bacteria 3479
139 Ga0466969_0159997 3300044656 Bacteria 1035
140 Ga0466965_0002273 3300044683 Bacteria 8096
141 Ga0466965_0006348 3300044683 Bacteria 5360
142 Ga0466965_0019184 3300044683 Bacteria 3284
143 Ga0466966_0195992 3300044684 Bacteria 1223
144 Ga0466961_0857511 3300044693 Bacteria 541
145 Ga0466961_0887455 3300044693 Bacteria 531
146 Ga0466963_0006875 3300044694 Bacteria 6767
147 Ga0466963_0163792 3300044694 Bacteria 1548
148 Ga0466971_0458782 3300044719 Bacteria 625
149 Ga0466970_0023869 3300044765 Bacteria 3197
150 Ga0466970_0228881 3300044765 Bacteria 1039
151 Ga0466970_0623528 3300044765 Bacteria 626
152 Ga0466970_0919243 3300044765 Bacteria 515
153 Ga0466957_0448726 3300044842 Bacteria 888
154 Ga0466960_0488266 3300044901 Bacteria 720
155 Ga0466959_0057567 3300045049 Bacteria 2833
156 Ga0466959_0252997 3300045049 Bacteria 1215
157 Ga0466967_0002802 3300045976 Bacteria 11058
158 Ga0495592_0936128 3300046454 Bacteria 507
159 Ga0495603_0180838 3300046455 Bacteria 1220
160 Ga0495603_0483320 3300046455 Bacteria 709
161 Ga0495629_0053021 3300046459 Bacteria 2838
162 Ga0495629_0158461 3300046459 Bacteria 1572
163 Ga0495638_0215464 3300046460 Bacteria 1076
164 Ga0495651_0852801 3300046462 Bacteria 559
165 Ga0495580_0108006 3300046472 Bacteria 1932
166 Ga0495582_0056406 3300046473 Bacteria 2165
167 Ga0495662_0028234 3300046476 Bacteria 2709
168 Ga0495662_0380550 3300046476 Bacteria 693
169 Ga0495585_0142906 3300046492 Bacteria 1252
170 Ga0495594_0164075 3300046499 Bacteria 1263
171 Ga0495594_0399013 3300046499 Bacteria 782
172 Ga0495618_0031279 3300046514 Bacteria 3329
173 Ga0495632_0236311 3300046519 Bacteria 823
174 Ga0495666_0195406 3300046526 Bacteria 931
175 Ga0495665_0246273 3300046531 Bacteria 921
176 Ga0495640_0206935 3300046533 Bacteria 1242
177 Ga0495640_0344568 3300046533 Bacteria 920
178 Ga0495586_0122729 3300046535 Bacteria 1452
179 Ga0495622_0072335 3300046557 Bacteria 1591
180 Ga0495634_0155398 3300046642 Bacteria 1444
181 Ga0495634_0296773 3300046642 Bacteria 978
182 Ga0495635_0212627 3300046663 Bacteria 1309
183 Ga0495588_0006679 3300046674 Bacteria 5211
184 Ga0495657_0013717 3300046675 Bacteria 5969
185 Ga0495657_0054397 3300046675 Bacteria 2674
186 Ga0495599_0310303 3300046678 Bacteria 951
187 Ga0495646_0654851 3300046680 Bacteria 530
188 Ga0495613_0056834 3300046689 Bacteria 2873
189 Ga0495613_0083160 3300046689 Bacteria 2325
190 Ga0495613_0191246 3300046689 Bacteria 1446
191 Ga0495624_0044629 3300046690 Bacteria 2825
192 Ga0495600_0096728 3300046809 Bacteria 1925
193 Ga0495600_0368215 3300046809 Bacteria 898
194 Ga0495581_0069130 3300047315 Bacteria 2042
195 Ga0495581_0168616 3300047315 Bacteria 1280
196 Ga0495581_0214287 3300047315 Bacteria 1126
197 Ga0495581_0534818 3300047315 Bacteria 681
198 Ga0495604_0539067 3300047317 Bacteria 753
199 Ga0495604_0806381 3300047317 Bacteria 591
200 Ga0495676_0051763 3300047321 Bacteria 3282
201 Ga0495680_0432313 3300047322 Bacteria 904
202 Ga0495680_0799829 3300047322 Bacteria 616
203 Ga0495687_025859 3300047443 Bacteria 2768
204 Ga0495593_0013691 3300047673 Bacteria 4620
205 Ga0495614_0010522 3300048089 Bacteria 4080
206 Ga0496100_0346584 3300048903 Bacteria 1121
207 Ga0496100_0388561 3300048903 Bacteria 1061
208 Ga0496101_0388164 3300048904 Bacteria 1099
209 Ga0496102_0043413 3300048905 Bacteria 4077
210 Ga0496102_0378753 3300048905 Bacteria 1332
211 Ga0496102_0437601 3300048905 Bacteria 1227
212 Ga0496103_0382014 3300048906 Bacteria 905
213 Ga0496103_0420685 3300048906 Bacteria 858
214 Ga0496103_0755527 3300048906 Bacteria 615
215 Ga0496104_0002424 3300048907 Bacteria 16066
216 Ga0496104_0271875 3300048907 Bacteria 1607
217 Ga0496105_0045760 3300048908 Bacteria 3611
218 Ga0496105_0052074 3300048908 Bacteria 3380
219 Ga0496106_0366327 3300048909 Bacteria 1158
220 Ga0496107_0233365 3300048910 Bacteria 1369
221 Ga0496108_0011959 3300048911 Bacteria 7060
222 Ga0496108_0019281 3300048911 Bacteria 5599
223 Ga0496108_0381724 3300048911 Bacteria 1230
224 Ga0496108_1236961 3300048911 Bacteria 630
225 Ga0496109_0000769 3300048912 Bacteria 26639
226 Ga0496109_0004867 3300048912 Bacteria 11210
227 Ga0496109_0208448 3300048912 Bacteria 1838
228 Ga0496109_1581359 3300048912 Bacteria 590
229 Ga0496110_0008243 3300048913 Bacteria 8376
230 Ga0496110_0887852 3300048913 Bacteria 797
231 Ga0496111_0000232 3300048914 Bacteria 26683
232 Ga0496111_0112817 3300048914 Bacteria 2003
233 Ga0496111_0429230 3300048914 Bacteria 976
234 Ga0496112_0201585 3300048915 Bacteria 1949
235 Ga0496113_0003587 3300048916 Bacteria 9318
236 Ga0496113_0548439 3300048916 Bacteria 927
237 Ga0496114_0068639 3300048917 Bacteria 2976
238 Ga0496114_0728758 3300048917 Bacteria 868
239 Ga0496114_0901124 3300048917 Bacteria 766
240 Ga0496114_1466057 3300048917 Bacteria 570
241 Ga0496117_0053213 3300048920 Bacteria 2846
242 Ga0496118_0004290 3300048921 Bacteria 17062
243 Ga0496121_0445327 3300048924 Bacteria 836
244 Ga0496125_0115694 3300048928 Bacteria 1928
245 Ga0496126_0298658 3300048929 Bacteria 1330
246 Ga0496126_0831442 3300048929 Bacteria 706
247 Ga0501031_0012005 3300049568 Bacteria 5648
248 Ga0501031_0652126 3300049568 Bacteria 676
249 Ga0501032_0494734 3300049569 Bacteria 782
250 Ga0501033_0081501 3300049570 Bacteria 2373
251 Ga0501036_0007088 3300049572 Bacteria 9118
252 Ga0501036_0082234 3300049572 Bacteria 2722
253 Ga0501036_1002677 3300049572 Bacteria 684
254 Ga0501037_0204887 3300049573 Bacteria 1393
255 Ga0501038_0251987 3300049574 Bacteria 1398
256 Ga0501039_0035680 3300049575 Bacteria 3838
257 Ga0501039_0144737 3300049575 Bacteria 1868
258 Ga0501040_0220740 3300049576 Bacteria 1348
259 Ga0501040_1075848 3300049576 Bacteria 583
260 Ga0501041_0664210 3300049577 Bacteria 666
261 Ga0501042_0308036 3300049578 Bacteria 1144
262 Ga0501043_0058305 3300049579 Bacteria 3031
263 Ga0501046_0072626 3300049580 Bacteria 2671
264 Ga0501048_0411999 3300049582 Bacteria 966
265 Ga0501048_0439673 3300049582 Bacteria 934
266 Ga0501067_0044734 3300049583 Bacteria 2460
267 Ga0501068_0020934 3300049584 Bacteria 3817
268 Ga0501070_0103939 3300049586 Bacteria 2349
269 Ga0501070_0117683 3300049586 Bacteria 2195
270 Ga0501071_0011033 3300049587 Bacteria 6069
271 Ga0501072_0005673 3300049588 Bacteria 9504
272 Ga0501074_0077398 3300049590 Bacteria 2387
273 Ga0501074_0342196 3300049590 Bacteria 1062
274 Ga0501074_0785835 3300049590 Bacteria 671
275 Ga0501075_0006563 3300049591 Bacteria 8012
276 Ga0501076_0118287 3300049592 Bacteria 2145
277 Ga0501076_0153193 3300049592 Bacteria 1875
278 Ga0501077_0108080 3300049593 Bacteria 1762
279 Ga0501079_0570609 3300049741 Bacteria 890
280 Ga0501079_1330231 3300049741 Bacteria 566
281 Ga0501080_0063941 3300049742 Bacteria 3424
282 Ga0501081_0438447 3300049743 Bacteria 970
283 Ga0501035_0521924 3300049822 Bacteria 976
284 Ga0501044_0091121 3300049823 Bacteria 3075
285 nmdc:mga05p37_1014924_c1 3300050507 Bacteria 880
286 nmdc:mga05p37_18078_c1 3300050507 Bacteria 8516
287 nmdc:mga09592_4234_c1 3300050508 Bacteria 11587
288 nmdc:mga09592_65101_c1 3300050508 Bacteria 3087
289 nmdc:mga0qj67_3291_c1 3300050509 Bacteria 11637
290 nmdc:mga06r32_17590_c1 3300050510 Bacteria 6529
291 nmdc:mga08y16_1940010_c1 3300050511 Bacteria 539
292 Ga0495619_0553672 3300053085 Bacteria 789
293 Ga0500604_0028910 3300053151 Bacteria 1612
294 Ga0500616_0003726 3300053153 Bacteria 11375
295 Ga0501084_0106254 3300054114 Bacteria 2358
296 Ga0501082_0325720 3300060353 Bacteria 1339
297 Ga0501082_0357186 3300060353 Bacteria 1274
298 Ga0501082_0709015 3300060353 Bacteria 881
299 Ga0466962_0011154 3300061719 Bacteria 4326
300 Ga0530510_0107072 3300061734 Bacteria 2046
301 Ga0530510_0139220 3300061734 Bacteria 1787
302 Ga0530510_1514535 3300061734 Bacteria 515

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031507 Ga0307509_10272004 Ga0307509_102720042 106
2 iso_pu_bacteria 2675902999 2676202430 106
3 iso_pu_bacteria 2675903059 2676485790 106
4 iso_pu_bacteria 2738541308 2738892239 106
5 iso_pu_bacteria 2773857921 2774847006 106
6 iso_pu_bacteria 8003314358 8003320053 106
7 3300006051 Ga0075364_11144662 Ga0075364_111446622 107
8 3300048904 Ga0496101_0388164 Ga0496101_0388164_371_694 107
9 3300049583 Ga0501067_0044734 Ga0501067_0044734_1242_1601 108
10 3300049742 Ga0501080_0063941 Ga0501080_0063941_1091_1450 108
11 3300060353 Ga0501082_0325720 Ga0501082_0325720_311_670 108
12 iso_pu_bacteria 2643221690 2644505932 108
13 iso_pu_bacteria 2687453737 2689957958 108
14 iso_pu_bacteria 2884994152 2884997868 108
15 iso_pu_bacteria 2945956166 2945959428 108
16 3300041463 Ga0451804_0982144 Ga0451804_0982144_41_376 109
17 3300048906 Ga0496103_0755527 Ga0496103_0755527_234_590 109
18 3300048912 Ga0496109_1581359 Ga0496109_1581359_162_518 109
19 3300005331 Ga0070670_100721122 Ga0070670_1007211222 110
20 3300005937 Ga0081455_10059062 Ga0081455_100590624 110
21 3300026121 Ga0207683_11972827 Ga0207683_119728272 110
22 3300005337 Ga0070682_100748452 Ga0070682_1007484522 111
23 3300005338 Ga0068868_100145435 Ga0068868_1001454353 111
24 3300005354 Ga0070675_101343700 Ga0070675_1013437001 111
25 3300009098 Ga0105245_11721743 Ga0105245_117217432 111
26 3300009101 Ga0105247_10000056 Ga0105247_1000005650 111
27 3300009177 Ga0105248_10001665 Ga0105248_1000166521 111
28 3300025900 Ga0207710_10000084 Ga0207710_1000008459 111
29 3300025901 Ga0207688_10946649 Ga0207688_109466492 111
30 3300025926 Ga0207659_10519197 Ga0207659_105191971 111
31 3300025941 Ga0207711_10036395 Ga0207711_100363954 111
32 3300026023 Ga0207677_10192051 Ga0207677_101920512 111
33 3300026121 Ga0207683_10345354 Ga0207683_103453542 111
34 3300032126 Ga0307415_101831253 Ga0307415_1018312531 111
35 3300044683 Ga0466965_0002273 Ga0466965_0002273_1096_1431 111
36 3300044683 Ga0466965_0006348 Ga0466965_0006348_2999_3334 111
37 3300049586 Ga0501070_0103939 Ga0501070_0103939_1724_2086 111
38 3300049586 Ga0501070_0117683 Ga0501070_0117683_1613_1963 111
39 iso_pu_bacteria 2861520306 2861523422 111
40 3300005331 Ga0070670_100967585 Ga0070670_1009675852 112
41 3300005337 Ga0070682_100328855 Ga0070682_1003288552 112
42 3300005338 Ga0068868_100241150 Ga0068868_1002411502 112
43 3300005341 Ga0070691_11016739 Ga0070691_110167391 112
44 3300005466 Ga0070685_10146360 Ga0070685_101463602 112
45 3300005530 Ga0070679_101035171 Ga0070679_1010351712 112
46 3300005548 Ga0070665_101858240 Ga0070665_1018582402 112
47 3300005577 Ga0068857_100362728 Ga0068857_1003627282 112
48 3300005616 Ga0068852_100635333 Ga0068852_1006353332 112
49 3300006028 Ga0070717_10827942 Ga0070717_108279422 112
50 3300006038 Ga0075365_10656794 Ga0075365_106567942 112
51 3300006237 Ga0097621_100317198 Ga0097621_1003171983 112
52 3300009094 Ga0111539_10320248 Ga0111539_103202483 112
53 3300009098 Ga0105245_12276674 Ga0105245_122766741 112
54 3300009101 Ga0105247_10681896 Ga0105247_106818962 112
55 3300009101 Ga0105247_11128085 Ga0105247_111280852 112
56 3300009148 Ga0105243_10712529 Ga0105243_107125292 112
57 3300009174 Ga0105241_11246585 Ga0105241_112465852 112
58 3300009176 Ga0105242_10319224 Ga0105242_103192242 112
59 3300009176 Ga0105242_10419468 Ga0105242_104194683 112
60 3300009551 Ga0105238_11688339 Ga0105238_116883391 112
61 3300010375 Ga0105239_11822498 Ga0105239_118224982 112
62 3300011119 Ga0105246_11400772 Ga0105246_114007721 112
63 3300013308 Ga0157375_10306382 Ga0157375_103063822 112
64 3300014325 Ga0163163_11677229 Ga0163163_116772292 112
65 3300014326 Ga0157380_10235102 Ga0157380_102351021 112
66 3300014968 Ga0157379_11056511 Ga0157379_110565112 112
67 3300014969 Ga0157376_10074502 Ga0157376_100745024 112
68 3300017792 Ga0163161_10645776 Ga0163161_106457762 112
69 3300022467 Ga0224712_10109161 Ga0224712_101091612 112
70 3300022467 Ga0224712_10136786 Ga0224712_101367862 112
71 3300025904 Ga0207647_10163030 Ga0207647_101630303 112
72 3300025921 Ga0207652_10797213 Ga0207652_107972132 112
73 3300025926 Ga0207659_10246924 Ga0207659_102469242 112
74 3300025927 Ga0207687_10541453 Ga0207687_105414533 112
75 3300025935 Ga0207709_10884752 Ga0207709_108847522 112
76 3300025935 Ga0207709_10911658 Ga0207709_109116582 112
77 3300025940 Ga0207691_10975703 Ga0207691_109757031 112
78 3300025949 Ga0207667_10047676 Ga0207667_100476762 112
79 3300025961 Ga0207712_10805714 Ga0207712_108057142 112
80 3300025986 Ga0207658_11379252 Ga0207658_113792521 112
81 3300026067 Ga0207678_10209112 Ga0207678_102091123 112
82 3300026067 Ga0207678_10847866 Ga0207678_108478662 112
83 3300028794 Ga0307515_10171985 Ga0307515_101719853 112
84 3300031456 Ga0307513_10001895 Ga0307513_100018959 112
85 3300031548 Ga0307408_101643192 Ga0307408_1016431922 112
86 3300031824 Ga0307413_10350686 Ga0307413_103506862 112
87 3300031852 Ga0307410_11293251 Ga0307410_112932511 112
88 3300031995 Ga0307409_100478641 Ga0307409_1004786412 112
89 3300031995 Ga0307409_101844310 Ga0307409_1018443101 112
90 3300034817 Ga0373948_0083222 Ga0373948_0083222_268_606 112
91 3300037466 Ga0395898_0651790 Ga0395898_0651790_347_685 112
92 3300038443 Ga0395901_0124665 Ga0395901_0124665_1961_2299 112
93 3300038443 Ga0395901_1914751 Ga0395901_1914751_140_478 112
94 3300041407 Ga0439447_136242 Ga0439447_136242_187_525 112
95 3300041452 Ga0451793_0698822 Ga0451793_0698822_147_485 112
96 3300041503 Ga0451847_0820850 Ga0451847_0820850_102_452 112
97 3300041512 Ga0451853_0618226 Ga0451853_0618226_69_407 112
98 3300044694 Ga0466963_0006875 Ga0466963_0006875_1128_1469 112
99 3300044765 Ga0466970_0023869 Ga0466970_0023869_1839_2177 112
100 3300044765 Ga0466970_0919243 Ga0466970_0919243_12_356 112
101 3300044901 Ga0466960_0488266 Ga0466960_0488266_327_665 112
102 3300046454 Ga0495592_0936128 Ga0495592_0936128_69_407 112
103 3300046455 Ga0495603_0180838 Ga0495603_0180838_415_753 112
104 3300046455 Ga0495603_0483320 Ga0495603_0483320_340_678 112
105 3300046459 Ga0495629_0053021 Ga0495629_0053021_2198_2536 112
106 3300046459 Ga0495629_0158461 Ga0495629_0158461_689_1027 112
107 3300046462 Ga0495651_0852801 Ga0495651_0852801_202_540 112
108 3300046472 Ga0495580_0108006 Ga0495580_0108006_1158_1496 112
109 3300046473 Ga0495582_0056406 Ga0495582_0056406_438_776 112
110 3300046476 Ga0495662_0028234 Ga0495662_0028234_1233_1571 112
111 3300046476 Ga0495662_0380550 Ga0495662_0380550_228_566 112
112 3300046492 Ga0495585_0142906 Ga0495585_0142906_392_736 112
113 3300046499 Ga0495594_0399013 Ga0495594_0399013_292_636 112
114 3300046514 Ga0495618_0031279 Ga0495618_0031279_2332_2670 112
115 3300046526 Ga0495666_0195406 Ga0495666_0195406_330_668 112
116 3300046531 Ga0495665_0246273 Ga0495665_0246273_387_725 112
117 3300046533 Ga0495640_0206935 Ga0495640_0206935_194_532 112
118 3300046533 Ga0495640_0344568 Ga0495640_0344568_472_816 112
119 3300046535 Ga0495586_0122729 Ga0495586_0122729_79_417 112
120 3300046642 Ga0495634_0155398 Ga0495634_0155398_365_703 112
121 3300046642 Ga0495634_0296773 Ga0495634_0296773_38_376 112
122 3300046663 Ga0495635_0212627 Ga0495635_0212627_529_867 112
123 3300046675 Ga0495657_0013717 Ga0495657_0013717_2291_2629 112
124 3300046675 Ga0495657_0054397 Ga0495657_0054397_596_934 112
125 3300046678 Ga0495599_0310303 Ga0495599_0310303_485_823 112
126 3300046680 Ga0495646_0654851 Ga0495646_0654851_132_470 112
127 3300046689 Ga0495613_0056834 Ga0495613_0056834_1468_1806 112
128 3300046689 Ga0495613_0083160 Ga0495613_0083160_647_985 112
129 3300046689 Ga0495613_0191246 Ga0495613_0191246_48_392 112
130 3300046690 Ga0495624_0044629 Ga0495624_0044629_1328_1666 112
131 3300046809 Ga0495600_0096728 Ga0495600_0096728_405_743 112
132 3300046809 Ga0495600_0368215 Ga0495600_0368215_58_396 112
133 3300047315 Ga0495581_0168616 Ga0495581_0168616_406_744 112
134 3300047315 Ga0495581_0214287 Ga0495581_0214287_480_818 112
135 3300047315 Ga0495581_0534818 Ga0495581_0534818_265_603 112
136 3300047317 Ga0495604_0539067 Ga0495604_0539067_309_653 112
137 3300047317 Ga0495604_0806381 Ga0495604_0806381_165_503 112
138 3300047321 Ga0495676_0051763 Ga0495676_0051763_2849_3187 112
139 3300047322 Ga0495680_0432313 Ga0495680_0432313_496_834 112
140 3300047322 Ga0495680_0799829 Ga0495680_0799829_109_447 112
141 3300047443 Ga0495687_025859 Ga0495687_025859_875_1213 112
142 3300047673 Ga0495593_0013691 Ga0495593_0013691_2957_3295 112
143 3300048089 Ga0495614_0010522 Ga0495614_0010522_994_1332 112
144 3300048903 Ga0496100_0346584 Ga0496100_0346584_493_831 112
145 3300048905 Ga0496102_0043413 Ga0496102_0043413_969_1307 112
146 3300048905 Ga0496102_0378753 Ga0496102_0378753_262_600 112
147 3300048905 Ga0496102_0437601 Ga0496102_0437601_535_873 112
148 3300048906 Ga0496103_0382014 Ga0496103_0382014_382_720 112
149 3300048906 Ga0496103_0420685 Ga0496103_0420685_290_628 112
150 3300048907 Ga0496104_0002424 Ga0496104_0002424_11507_11845 112
151 3300048908 Ga0496105_0045760 Ga0496105_0045760_519_869 112
152 3300048908 Ga0496105_0052074 Ga0496105_0052074_2662_3000 112
153 3300048911 Ga0496108_0011959 Ga0496108_0011959_4437_4775 112
154 3300048911 Ga0496108_0381724 Ga0496108_0381724_453_791 112
155 3300048911 Ga0496108_1236961 Ga0496108_1236961_182_520 112
156 3300048912 Ga0496109_0004867 Ga0496109_0004867_10228_10566 112
157 3300048912 Ga0496109_0208448 Ga0496109_0208448_1078_1416 112
158 3300048913 Ga0496110_0008243 Ga0496110_0008243_4222_4560 112
159 3300048913 Ga0496110_0887852 Ga0496110_0887852_425_763 112
160 3300048914 Ga0496111_0000232 Ga0496111_0000232_13184_13522 112
161 3300048914 Ga0496111_0112817 Ga0496111_0112817_747_1097 112
162 3300048915 Ga0496112_0201585 Ga0496112_0201585_374_712 112
163 3300048916 Ga0496113_0003587 Ga0496113_0003587_7804_8142 112
164 3300048917 Ga0496114_0068639 Ga0496114_0068639_740_1078 112
165 3300048917 Ga0496114_0728758 Ga0496114_0728758_21_359 112
166 3300048917 Ga0496114_0901124 Ga0496114_0901124_254_592 112
167 3300048917 Ga0496114_1466057 Ga0496114_1466057_135_473 112
168 3300048929 Ga0496126_0298658 Ga0496126_0298658_325_663 112
169 3300049568 Ga0501031_0012005 Ga0501031_0012005_4877_5215 112
170 3300049572 Ga0501036_0007088 Ga0501036_0007088_8391_8729 112
171 3300049572 Ga0501036_0082234 Ga0501036_0082234_1914_2252 112
172 3300049574 Ga0501038_0251987 Ga0501038_0251987_788_1126 112
173 3300049575 Ga0501039_0035680 Ga0501039_0035680_850_1188 112
174 3300049575 Ga0501039_0144737 Ga0501039_0144737_210_548 112
175 3300049576 Ga0501040_0220740 Ga0501040_0220740_303_641 112
176 3300049576 Ga0501040_1075848 Ga0501040_1075848_183_521 112
177 3300049577 Ga0501041_0664210 Ga0501041_0664210_251_589 112
178 3300049578 Ga0501042_0308036 Ga0501042_0308036_473_811 112
179 3300049579 Ga0501043_0058305 Ga0501043_0058305_2151_2489 112
180 3300049580 Ga0501046_0072626 Ga0501046_0072626_1816_2154 112
181 3300049582 Ga0501048_0411999 Ga0501048_0411999_113_451 112
182 3300049584 Ga0501068_0020934 Ga0501068_0020934_1524_1862 112
183 3300049587 Ga0501071_0011033 Ga0501071_0011033_113_451 112
184 3300049588 Ga0501072_0005673 Ga0501072_0005673_8667_9005 112
185 3300049590 Ga0501074_0077398 Ga0501074_0077398_1258_1596 112
186 3300049590 Ga0501074_0342196 Ga0501074_0342196_48_386 112
187 3300049591 Ga0501075_0006563 Ga0501075_0006563_1358_1696 112
188 3300049592 Ga0501076_0153193 Ga0501076_0153193_581_919 112
189 3300049593 Ga0501077_0108080 Ga0501077_0108080_371_709 112
190 3300049741 Ga0501079_1330231 Ga0501079_1330231_212_550 112
191 3300049743 Ga0501081_0438447 Ga0501081_0438447_412_750 112
192 3300049822 Ga0501035_0521924 Ga0501035_0521924_512_850 112
193 3300050511 nmdc:mga08y16_1940010_c1 nmdc:mga08y16_1940010_c1_122_460 112
194 3300053085 Ga0495619_0553672 Ga0495619_0553672_339_677 112
195 3300054114 Ga0501084_0106254 Ga0501084_0106254_1603_1941 112
196 3300060353 Ga0501082_0357186 Ga0501082_0357186_634_972 112
197 3300060353 Ga0501082_0709015 Ga0501082_0709015_524_862 112
198 3300061734 Ga0530510_0107072 Ga0530510_0107072_1042_1380 112
199 3300061734 Ga0530510_0139220 Ga0530510_0139220_851_1189 112
200 3300061734 Ga0530510_1514535 Ga0530510_1514535_155_493 112
201 3300005530 Ga0070679_100278441 Ga0070679_1002784414 113
202 3300005616 Ga0068852_100244882 Ga0068852_1002448823 113
203 3300009011 Ga0105251_10008805 Ga0105251_100088053 113
204 3300009036 Ga0105244_10365044 Ga0105244_103650441 113
205 3300009177 Ga0105248_10000079 Ga0105248_1000007971 113
206 3300009551 Ga0105238_11958472 Ga0105238_119584722 113
207 3300009553 Ga0105249_11593619 Ga0105249_115936192 113
208 3300013105 Ga0157369_11303885 Ga0157369_113038852 113
209 3300017792 Ga0163161_11959301 Ga0163161_119593012 113
210 3300025735 Ga0207713_1008472 Ga0207713_10084728 113
211 3300025924 Ga0207694_11598903 Ga0207694_115989032 113
212 3300025941 Ga0207711_10000072 Ga0207711_1000007237 113
213 3300025961 Ga0207712_11017797 Ga0207712_110177972 113
214 3300026078 Ga0207702_10277473 Ga0207702_102774733 113
215 3300026142 Ga0207698_10218354 Ga0207698_102183542 113
216 3300041452 Ga0451793_0583940 Ga0451793_0583940_100_441 113
217 3300048903 Ga0496100_0388561 Ga0496100_0388561_358_702 113
218 3300048907 Ga0496104_0271875 Ga0496104_0271875_510_854 113
219 3300048909 Ga0496106_0366327 Ga0496106_0366327_445_789 113
220 3300048910 Ga0496107_0233365 Ga0496107_0233365_523_867 113
221 3300048911 Ga0496108_0019281 Ga0496108_0019281_1079_1423 113
222 3300048912 Ga0496109_0000769 Ga0496109_0000769_6553_6897 113
223 3300048914 Ga0496111_0429230 Ga0496111_0429230_173_517 113
224 3300048916 Ga0496113_0548439 Ga0496113_0548439_525_869 113
225 3300048920 Ga0496117_0053213 Ga0496117_0053213_690_1031 113
226 3300048921 Ga0496118_0004290 Ga0496118_0004290_6890_7231 113
227 3300048924 Ga0496121_0445327 Ga0496121_0445327_180_524 113
228 3300048928 Ga0496125_0115694 Ga0496125_0115694_906_1250 113
229 3300005548 Ga0070665_101450224 Ga0070665_1014502241 114
230 3300014325 Ga0163163_11258332 Ga0163163_112583321 114
231 3300032126 Ga0307415_100222618 Ga0307415_1002226183 114
232 3300041451 Ga0451791_1590370 Ga0451791_1590370_92_505 114
233 3300045976 Ga0466967_0002802 Ga0466967_0002802_8673_9020 114
234 3300046499 Ga0495594_0164075 Ga0495594_0164075_789_1133 114
235 3300046557 Ga0495622_0072335 Ga0495622_0072335_1120_1464 114
236 3300046674 Ga0495588_0006679 Ga0495588_0006679_4765_5109 114
237 3300047315 Ga0495581_0069130 Ga0495581_0069130_800_1144 114
238 3300049568 Ga0501031_0652126 Ga0501031_0652126_200_544 114
239 3300049569 Ga0501032_0494734 Ga0501032_0494734_246_590 114
240 3300049570 Ga0501033_0081501 Ga0501033_0081501_1740_2084 114
241 3300049573 Ga0501037_0204887 Ga0501037_0204887_30_374 114
242 3300049823 Ga0501044_0091121 Ga0501044_0091121_562_906 114
243 iso_pu_bacteria 2905926851 2905931043 114
244 3300014745 Ga0157377_10466587 Ga0157377_104665872 115
245 3300030731 Ga0316177_1174120 Ga0316177_11741203 115
246 3300030732 Ga0316176_1068617 Ga0316176_106861710 115
247 3300030733 Ga0314311_1119164 Ga0314311_111916412 115
248 3300030736 Ga0316180_1010075 Ga0316180_10100754 115
249 3300044656 Ga0466969_0159997 Ga0466969_0159997_410_757 115
250 3300044684 Ga0466966_0195992 Ga0466966_0195992_452_799 115
251 3300044693 Ga0466961_0857511 Ga0466961_0857511_177_524 115
252 3300044765 Ga0466970_0623528 Ga0466970_0623528_150_497 115
253 3300045049 Ga0466959_0057567 Ga0466959_0057567_269_616 115
254 3300049582 Ga0501048_0439673 Ga0501048_0439673_372_719 115
255 3300025940 Ga0207691_10633632 Ga0207691_106336322 116
256 3300026142 Ga0207698_10347298 Ga0207698_103472983 116
257 3300041451 Ga0451791_0501271 Ga0451791_0501271_133_483 116
258 3300041456 Ga0451795_0064227 Ga0451795_0064227_293_643 116
259 3300041498 Ga0451841_0818454 Ga0451841_0818454_152_502 116
260 3300041505 Ga0451849_1315816 Ga0451849_1315816_847_1197 116
261 3300041512 Ga0451853_2918900 Ga0451853_2918900_173_523 116
262 3300048929 Ga0496126_0831442 Ga0496126_0831442_133_519 116
263 iso_pu_bacteria 2816332119 2816425959 116
264 iso_pu_bacteria 2954711539 2954719398 116
265 iso_pu_bacteria 2954721474 2954729378 116
266 iso_pu_bacteria 2954731030 2954732430 116
267 iso_pu_bacteria 2954740390 2954748281 116
268 iso_pu_bacteria 2954749733 2954751318 116
269 iso_pu_bacteria 2954759201 2954767404 116
270 3300041460 Ga0451802_0519959 Ga0451802_0519959_463_816 117
271 3300041494 Ga0451837_1667588 Ga0451837_1667588_47_400 117
272 3300041512 Ga0451853_2328193 Ga0451853_2328193_940_1293 117
273 3300044683 Ga0466965_0019184 Ga0466965_0019184_641_994 117
274 3300044693 Ga0466961_0887455 Ga0466961_0887455_117_470 117
275 3300044694 Ga0466963_0163792 Ga0466963_0163792_234_587 117
276 3300044719 Ga0466971_0458782 Ga0466971_0458782_182_535 117
277 3300044765 Ga0466970_0228881 Ga0466970_0228881_212_565 117
278 3300044842 Ga0466957_0448726 Ga0466957_0448726_506_859 117
279 3300045049 Ga0466959_0252997 Ga0466959_0252997_444_797 117
280 3300049572 Ga0501036_1002677 Ga0501036_1002677_56_409 117
281 3300050507 nmdc:mga05p37_18078_c1 nmdc:mga05p37_18078_c1_4451_4807 117
282 3300050508 nmdc:mga09592_4234_c1 nmdc:mga09592_4234_c1_4193_4549 117
283 3300050509 nmdc:mga0qj67_3291_c1 nmdc:mga0qj67_3291_c1_3913_4269 117
284 3300050510 nmdc:mga06r32_17590_c1 nmdc:mga06r32_17590_c1_3347_3703 117
285 3300061719 Ga0466962_0011154 Ga0466962_0011154_2448_2801 117
286 3300006881 Ga0068865_100444066 Ga0068865_1004440661 118
287 3300031852 Ga0307410_10514290 Ga0307410_105142902 118
288 3300031995 Ga0307409_100345428 Ga0307409_1003454282 118
289 3300032002 Ga0307416_100210049 Ga0307416_1002100494 118
290 3300032005 Ga0307411_11635952 Ga0307411_116359522 118
291 3300037466 Ga0395898_0222409 Ga0395898_0222409_130_486 118
292 3300041997 Ga0439431_0062457 Ga0439431_0062457_616_972 118
293 3300042002 Ga0439442_026620 Ga0439442_026620_589_945 118
294 3300042004 Ga0439445_0085819 Ga0439445_0085819_245_601 118
295 3300042156 Ga0439446_0036750 Ga0439446_0036750_81_437 118
296 3300042435 Ga0439434_0006231 Ga0439434_0006231_479_835 118
297 3300049590 Ga0501074_0785835 Ga0501074_0785835_171_530 118
298 3300049592 Ga0501076_0118287 Ga0501076_0118287_648_1007 118
299 3300049741 Ga0501079_0570609 Ga0501079_0570609_65_424 118
300 3300006846 Ga0075430_100461792 Ga0075430_1004617922 119
301 3300041443 Ga0451789_1080808 Ga0451789_1080808_485_898 119
302 3300046460 Ga0495638_0215464 Ga0495638_0215464_20_379 119
303 3300046519 Ga0495632_0236311 Ga0495632_0236311_367_726 119
304 3300053151 Ga0500604_0028910 Ga0500604_0028910_931_1290 119
305 3300053153 Ga0500616_0003726 Ga0500616_0003726_9016_9375 119
306 3300006844 Ga0075428_100018394 Ga0075428_1000183946 120
307 3300006846 Ga0075430_100030229 Ga0075430_1000302293 120
308 3300006846 Ga0075430_100052503 Ga0075430_1000525034 120
309 3300006847 Ga0075431_100007782 Ga0075431_1000077824 120
310 3300006847 Ga0075431_100012461 Ga0075431_1000124617 120
311 3300006880 Ga0075429_100005159 Ga0075429_10000515911 120
312 3300006880 Ga0075429_100023263 Ga0075429_1000232634 120
313 3300009147 Ga0114129_10020153 Ga0114129_100201537 120
314 3300009147 Ga0114129_10235239 Ga0114129_102352393 120
315 3300050507 nmdc:mga05p37_1014924_c1 nmdc:mga05p37_1014924_c1_117_479 120
316 3300050508 nmdc:mga09592_65101_c1 nmdc:mga09592_65101_c1_757_1119 120
317 3300005329 Ga0070683_101577410 Ga0070683_1015774101 122
318 3300009098 Ga0105245_10984804 Ga0105245_109848042 122
319 3300011119 Ga0105246_10319590 Ga0105246_103195903 122
320 3300028800 Ga0265338_10135081 Ga0265338_101350813 122
321 iso_pu_bacteria 2671180195 2671839789 122
322 iso_pu_bacteria 2773857922 2774857945 122

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

16

66

0.97

PF01022

HTH_5

Bacterial regulatory protein, arsR family

18

65

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.942 8 85
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9359 18 74
3f6v-assembly1.cif.gz_A-2 crystal structure of possible transcriptional regulator for arsenical resistance 0.9343 11 88
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9227 19 73
2acj-assembly1.cif.gz_D crystal structure of the b/z junction containing dna bound to z-dna binding proteins 0.9048 15 74
ID Description Score Start End Superfamily
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9544 8 85 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9422 15 72 1.10.10.10
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.938 8 88 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9359 18 74 1.10.10.10
3f6vA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9343 11 88 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A316EMP6-F1-model_v4 ArsR family transcriptional regulator 0.9896 3 108 GO:0003700
AF-A0A1G7NL56-F1-model_v4 DNA-binding transcriptional regulator, ArsR family 0.9866 5 117 GO:0003677
GO:0003700
AF-D3CW67-F1-model_v4 Putative transcriptional regulator, ArsR family 0.9864 1 117 GO:0003700
AF-A0A379JLC4-F1-model_v4 HTH-type transcriptional regulator CmtR 0.984 3 117 GO:0003700
AF-A0A7W0CT36-F1-model_v4 DNA-binding transcriptional ArsR family regulator 0.9819 1 117 GO:0003677
GO:0003700

Feature Viewer

pLDDT pTM Quality
89.43 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map