F406469

General Info

Members Datasets Scaffolds Average Seq Length
322 202 322 71

Family's Representative Sequence

Representative Sequence 3300025907|Ga0207645_10322623|Ga0207645_103226232
Length 87
Sequence MAYVITEPCIGKKDASCVGLCPVDCIHPTPDEPDYDKVEMLYIDPEECIDCDACVEACPVDACFAEDQLPGEWAHFAQLNADYFASK

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
103 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
114 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
115 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
116 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
189 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.17
Nodule 0
Rhizoplane 5.59
Rhizosphere 86.96
Stem 0
Stem Tuber 0
Unclassified 5.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1068626 3300001977 Bacteria 514
2 JGI24743J22301_10061961 3300001991 Bacteria 772
3 JGI25406J46586_10067752 3300003203 Bacteria 1130
4 JGI25406J46586_10150746 3300003203 Bacteria 679
5 JGI25407J50210_10024534 3300003373 Bacteria 1564
6 JGI25407J50210_10046900 3300003373 Bacteria 1099
7 Ga0070683_100186279 3300005329 Bacteria 1970
8 Ga0070682_100199150 3300005337 Bacteria 1411
9 Ga0070689_100036427 3300005340 Bacteria 3763
10 Ga0070687_100190792 3300005343 Bacteria 1235
11 Ga0070687_101107486 3300005343 Bacteria 579
12 Ga0070692_10679076 3300005345 Bacteria 691
13 Ga0070668_101408624 3300005347 Bacteria 636
14 Ga0070671_100914168 3300005355 Bacteria 767
15 Ga0070671_101298695 3300005355 Bacteria 642
16 Ga0070674_102217832 3300005356 Bacteria 502
17 Ga0070688_100238014 3300005365 Bacteria 1291
18 Ga0070659_100963547 3300005366 Bacteria 748
19 Ga0070667_100294981 3300005367 Bacteria 1459
20 Ga0070714_100642880 3300005435 Bacteria 1021
21 Ga0070714_100727201 3300005435 Bacteria 959
22 Ga0070714_101599363 3300005435 Bacteria 637
23 Ga0070701_10194419 3300005438 Bacteria 1195
24 Ga0070700_100006253 3300005441 Bacteria 6353
25 Ga0070700_100035102 3300005441 Bacteria 3032
26 Ga0070678_100287376 3300005456 Bacteria 1393
27 Ga0070678_101552204 3300005456 Bacteria 621
28 Ga0068867_100797665 3300005459 Bacteria 842
29 Ga0070685_10442532 3300005466 Bacteria 909
30 Ga0070699_101365242 3300005518 Bacteria 650
31 Ga0070679_100427505 3300005530 Bacteria 1270
32 Ga0070684_100086409 3300005535 Bacteria 2783
33 Ga0070684_100491246 3300005535 Bacteria 1137
34 Ga0070684_100633824 3300005535 Bacteria 995
35 Ga0070672_100005927 3300005543 Bacteria 8154
36 Ga0070686_100289548 3300005544 Bacteria 1211
37 Ga0070693_100095819 3300005547 Bacteria 1798
38 Ga0070693_101155488 3300005547 Bacteria 593
39 Ga0070665_100865678 3300005548 Bacteria 917
40 Ga0070704_100263609 3300005549 Bacteria 1421
41 Ga0068857_102323068 3300005577 Bacteria 527
42 Ga0068857_102523211 3300005577 Bacteria 505
43 Ga0068856_100022275 3300005614 Bacteria 6160
44 Ga0068856_101113846 3300005614 Bacteria 807
45 Ga0068852_100539448 3300005616 Bacteria 1166
46 Ga0068852_100937187 3300005616 Bacteria 884
47 Ga0068852_101903998 3300005616 Bacteria 617
48 Ga0068864_100673557 3300005618 Bacteria 1009
49 Ga0068861_100081616 3300005719 Bacteria 2532
50 Ga0068861_100692908 3300005719 Bacteria 946
51 Ga0068861_102109806 3300005719 Bacteria 564
52 Ga0068870_11323330 3300005840 Bacteria 525
53 Ga0068858_101046522 3300005842 Bacteria 800
54 Ga0068862_102154618 3300005844 Bacteria 569
55 Ga0081455_10016000 3300005937 Bacteria 7258
56 Ga0081538_10000032 3300005981 Bacteria 122398
57 Ga0081538_10002684 3300005981 Bacteria 17127
58 Ga0081538_10007907 3300005981 Bacteria 9109
59 Ga0081538_10017889 3300005981 Bacteria 5354
60 Ga0081538_10023870 3300005981 Bacteria 4378
61 Ga0081538_10024077 3300005981 Bacteria 4349
62 Ga0081538_10043364 3300005981 Bacteria 2825
63 Ga0081538_10043488 3300005981 Bacteria 2819
64 Ga0081538_10121022 3300005981 Bacteria 1257
65 Ga0081538_10167041 3300005981 Bacteria 967
66 Ga0081540_1051117 3300005983 Bacteria 2046
67 Ga0081539_10002492 3300005985 Bacteria 25853
68 Ga0081539_10003844 3300005985 Bacteria 17616
69 Ga0075365_10170768 3300006038 Bacteria 1518
70 Ga0075365_10341243 3300006038 Bacteria 1056
71 Ga0075365_10629461 3300006038 Bacteria 758
72 Ga0097621_100692580 3300006237 Bacteria 938
73 Ga0075430_100095634 3300006846 Bacteria 2483
74 Ga0075433_10032463 3300006852 Bacteria 4472
75 Ga0075433_10579576 3300006852 Bacteria 985
76 Ga0075434_100008698 3300006871 Bacteria 9451
77 Ga0075435_100021015 3300007076 Bacteria 5014
78 Ga0075435_100490604 3300007076 Bacteria 1062
79 Ga0075435_101928138 3300007076 Bacteria 519
80 Ga0105250_10463574 3300009092 Bacteria 570
81 Ga0105240_11315058 3300009093 Bacteria 762
82 Ga0111539_10194892 3300009094 Bacteria 2363
83 Ga0111539_12591548 3300009094 Bacteria 588
84 Ga0105245_12021080 3300009098 Bacteria 630
85 Ga0105247_10028672 3300009101 Bacteria 3369
86 Ga0105247_10572116 3300009101 Bacteria 834
87 Ga0105247_11770764 3300009101 Bacteria 513
88 Ga0114129_10000512 3300009147 Bacteria 47473
89 Ga0114129_10111315 3300009147 Bacteria 3778
90 Ga0114129_13313428 3300009147 Bacteria 520
91 Ga0105243_10040377 3300009148 Bacteria 3644
92 Ga0105241_11930454 3300009174 Bacteria 579
93 Ga0105248_10384691 3300009177 Bacteria 1580
94 Ga0105237_12739786 3300009545 Bacteria 504
95 Ga0105238_10593217 3300009551 Bacteria 1115
96 Ga0105238_11773680 3300009551 Bacteria 649
97 Ga0105249_10005000 3300009553 Bacteria 11441
98 Ga0105249_10394008 3300009553 Bacteria 1414
99 Ga0105249_11514474 3300009553 Bacteria 743
100 Ga0105246_10090973 3300011119 Bacteria 2198
101 Ga0105246_10689977 3300011119 Bacteria 894
102 Ga0157314_1032991 3300012500 Bacteria 591
103 Ga0157369_11552653 3300013105 Bacteria 673
104 Ga0157374_10621212 3300013296 Bacteria 1091
105 Ga0163162_12973052 3300013306 Bacteria 545
106 Ga0157372_11020119 3300013307 Bacteria 958
107 Ga0157375_10623017 3300013308 Bacteria 1237
108 Ga0163163_10181389 3300014325 Bacteria 2153
109 Ga0157380_10152894 3300014326 Bacteria 1997
110 Ga0157380_11405035 3300014326 Bacteria 748
111 Ga0157377_10204770 3300014745 Bacteria 1255
112 Ga0157377_11331171 3300014745 Bacteria 563
113 Ga0157379_10377451 3300014968 Bacteria 1300
114 Ga0157376_10556769 3300014969 Bacteria 1135
115 Ga0182005_1181410 3300015265 Bacteria 625
116 Ga0206353_10435260 3300020082 Bacteria 503
117 Ga0213874_10077495 3300021377 Bacteria 1071
118 Ga0213876_10494820 3300021384 Bacteria 651
119 Ga0213875_10077402 3300021388 Bacteria 1552
120 Ga0207710_10013280 3300025900 Bacteria 3470
121 Ga0207688_10034250 3300025901 Bacteria 2812
122 Ga0207647_10628185 3300025904 Bacteria 590
123 Ga0207645_10322623 3300025907 Bacteria 1030
124 Ga0207643_10005113 3300025908 Bacteria 7019
125 Ga0207662_10057074 3300025918 Bacteria 2333
126 Ga0207662_10196776 3300025918 Bacteria 1303
127 Ga0207652_10143763 3300025921 Bacteria 2134
128 Ga0207644_11774598 3300025931 Bacteria 516
129 Ga0207644_11831631 3300025931 Bacteria 508
130 Ga0207706_10049989 3300025933 Bacteria 3694
131 Ga0207686_10356818 3300025934 Bacteria 1102
132 Ga0207709_10497833 3300025935 Bacteria 950
133 Ga0207670_10975620 3300025936 Bacteria 712
134 Ga0207691_10007764 3300025940 Bacteria 10333
135 Ga0207691_11211702 3300025940 Bacteria 626
136 Ga0207689_10404830 3300025942 Bacteria 1138
137 Ga0207712_11098760 3300025961 Bacteria 708
138 Ga0207640_10362117 3300025981 Bacteria 1169
139 Ga0207703_12348998 3300026035 Bacteria 509
140 Ga0207708_10009602 3300026075 Bacteria 7174
141 Ga0207708_10038797 3300026075 Bacteria 3629
142 Ga0207702_10009729 3300026078 Bacteria 8074
143 Ga0207674_10598010 3300026116 Bacteria 1065
144 Ga0207675_100861709 3300026118 Bacteria 921
145 Ga0207683_10323924 3300026121 Bacteria 1412
146 Ga0207698_10034641 3300026142 Bacteria 3683
147 Ga0268264_10671246 3300028381 Bacteria 1027
148 Ga0268264_10751223 3300028381 Bacteria 972
149 Ga0307408_100313480 3300031548 Bacteria 1319
150 Ga0316579_10093830 3300031691 Bacteria 1434
151 Ga0316576_10743033 3300031727 Bacteria 709
152 Ga0307405_10377870 3300031731 Bacteria 1102
153 Ga0307405_11010550 3300031731 Bacteria 710
154 Ga0307405_11302498 3300031731 Bacteria 632
155 Ga0307405_11909257 3300031731 Bacteria 530
156 Ga0307413_10333393 3300031824 Bacteria 1164
157 Ga0307413_11035002 3300031824 Bacteria 706
158 Ga0307406_10415833 3300031901 Bacteria 1070
159 Ga0307407_10426912 3300031903 Bacteria 957
160 Ga0307407_10615302 3300031903 Bacteria 810
161 Ga0307409_100087995 3300031995 Bacteria 2534
162 Ga0307409_100851702 3300031995 Bacteria 922
163 Ga0307409_102131056 3300031995 Bacteria 590
164 Ga0307416_100008421 3300032002 Bacteria 6655
165 Ga0307416_100762109 3300032002 Bacteria 1061
166 Ga0307416_100845245 3300032002 Bacteria 1013
167 Ga0307414_10353013 3300032004 Bacteria 1263
168 Ga0307411_10992995 3300032005 Bacteria 751
169 Ga0307415_100033220 3300032126 Bacteria 3348
170 Ga0307415_100249235 3300032126 Bacteria 1442
171 Ga0307415_102504857 3300032126 Bacteria 508
172 Ga0316583_10117277 3300032133 Bacteria 928
173 Ga0373951_0124878 3300035091 Bacteria 703
174 Ga0373939_0050618 3300035114 Bacteria 1289
175 Ga0316574_0281509 3300035398 Bacteria 1059
176 Ga0373931_0282468 3300035691 Bacteria 1020
177 Ga0316584_0103879 3300036712 Bacteria 2127
178 Ga0316584_0385927 3300036712 Bacteria 1000
179 Ga0395900_0030319 3300037418 Bacteria 5553
180 Ga0395898_0001844 3300037466 Bacteria 27242
181 Ga0436364_0576277 3300037853 Bacteria 998
182 Ga0436364_0588143 3300037853 Bacteria 2559
183 Ga0436364_1400026 3300037853 Bacteria 561
184 Ga0436364_1467034 3300037853 Bacteria 5122
185 Ga0395901_0326999 3300038443 Bacteria 1586
186 Ga0242420_092553 3300038996 Bacteria 636
187 Ga0436365_0265075 3300039437 Bacteria 3351
188 Ga0436365_0507278 3300039437 Bacteria 527
189 Ga0436365_1121702 3300039437 Bacteria 637
190 Ga0436365_1197849 3300039437 Bacteria 1256
191 Ga0436363_0083650 3300039450 Bacteria 796
192 Ga0436363_0190554 3300039450 Bacteria 1016
193 Ga0436363_1062156 3300039450 Bacteria 1941
194 Ga0436363_1187769 3300039450 Bacteria 1125
195 Ga0436363_1314756 3300039450 Bacteria 2793
196 Ga0436363_1649070 3300039450 Bacteria 2693
197 Ga0466969_0002961 3300044656 Bacteria 9070
198 Ga0466969_0059785 3300044656 Bacteria 1853
199 Ga0466965_0191899 3300044683 Bacteria 1081
200 Ga0466965_0341357 3300044683 Bacteria 819
201 Ga0466965_0362133 3300044683 Bacteria 796
202 Ga0466965_0885044 3300044683 Bacteria 520
203 Ga0466966_0016298 3300044684 Bacteria 4915
204 Ga0466966_0158597 3300044684 Bacteria 1378
205 Ga0466961_0000190 3300044693 Bacteria 40985
206 Ga0466961_0118475 3300044693 Bacteria 1663
207 Ga0466961_0802290 3300044693 Bacteria 562
208 Ga0466963_0368992 3300044694 Bacteria 1011
209 Ga0466964_0107100 3300044706 Bacteria 1241
210 Ga0466964_0777554 3300044706 Bacteria 539
211 Ga0466970_0691516 3300044765 Bacteria 594
212 Ga0466957_0097960 3300044842 Bacteria 1845
213 Ga0466957_0099632 3300044842 Bacteria 1830
214 Ga0466960_0396852 3300044901 Bacteria 794
215 Ga0466959_0031262 3300045049 Bacteria 3940
216 Ga0466959_0584453 3300045049 Bacteria 752
217 Ga0466959_0721272 3300045049 Bacteria 668
218 Ga0466958_0022565 3300045836 Bacteria 3689
219 Ga0466958_0215408 3300045836 Bacteria 1224
220 Ga0466958_0950168 3300045836 Bacteria 561
221 Ga0466967_0137705 3300045976 Bacteria 2271
222 Ga0466967_0203165 3300045976 Bacteria 1877
223 Ga0466967_0298421 3300045976 Bacteria 1550
224 Ga0466967_0394245 3300045976 Bacteria 1346
225 Ga0466967_0720019 3300045976 Bacteria 989
226 Ga0466967_0788733 3300045976 Bacteria 943
227 Ga0466967_1221323 3300045976 Bacteria 749
228 Ga0495638_0058328 3300046460 Bacteria 2392
229 Ga0495641_0268474 3300046461 Bacteria 767
230 Ga0495633_0040813 3300046558 Bacteria 2209
231 Ga0495625_0007737 3300046660 Bacteria 9288
232 Ga0495672_0229018 3300047320 Bacteria 913
233 Ga0495602_1095532 3300048088 Bacteria 522
234 Ga0496100_0089547 3300048903 Bacteria 2096
235 Ga0496102_0087355 3300048905 Bacteria 2881
236 Ga0496102_0249211 3300048905 Bacteria 1674
237 Ga0496103_0555588 3300048906 Bacteria 733
238 Ga0496105_0292623 3300048908 Bacteria 1311
239 Ga0496106_0049137 3300048909 Bacteria 3177
240 Ga0496106_0089947 3300048909 Bacteria 2368
241 Ga0496107_0176460 3300048910 Bacteria 1586
242 Ga0496108_0112571 3300048911 Bacteria 2328
243 Ga0496108_1719624 3300048911 Bacteria 516
244 Ga0496109_0577513 3300048912 Bacteria 1059
245 Ga0496110_0359514 3300048913 Bacteria 1326
246 Ga0496111_0455637 3300048914 Bacteria 943
247 Ga0496112_1153725 3300048915 Bacteria 692
248 Ga0496113_0102776 3300048916 Bacteria 2216
249 Ga0496113_0212161 3300048916 Bacteria 1541
250 Ga0496114_0101663 3300048917 Bacteria 2455
251 Ga0496115_0301697 3300048918 Bacteria 1312
252 Ga0501031_0150148 3300049568 Bacteria 1522
253 Ga0501032_0024248 3300049569 Bacteria 4190
254 Ga0501033_0008249 3300049570 Bacteria 8065
255 Ga0501034_0127930 3300049571 Bacteria 2525
256 Ga0501034_0991188 3300049571 Bacteria 724
257 Ga0501036_0050636 3300049572 Bacteria 3516
258 Ga0501036_0497916 3300049572 Bacteria 1014
259 Ga0501037_0021614 3300049573 Bacteria 4757
260 Ga0501038_0048276 3300049574 Bacteria 3684
261 Ga0501039_0049655 3300049575 Bacteria 3244
262 Ga0501039_0495097 3300049575 Bacteria 960
263 Ga0501040_0425910 3300049576 Bacteria 954
264 Ga0501042_0021010 3300049578 Bacteria 4546
265 Ga0501042_0567100 3300049578 Bacteria 825
266 Ga0501042_1158156 3300049578 Bacteria 564
267 Ga0501043_0262538 3300049579 Bacteria 1327
268 Ga0501046_0004355 3300049580 Bacteria 12887
269 Ga0501047_0598221 3300049581 Bacteria 924
270 Ga0501048_0008175 3300049582 Bacteria 7914
271 Ga0501067_0418830 3300049583 Bacteria 747
272 Ga0501068_0109726 3300049584 Bacteria 1715
273 Ga0501068_0310702 3300049584 Bacteria 1010
274 Ga0501068_0697240 3300049584 Bacteria 664
275 Ga0501069_0055390 3300049585 Bacteria 2209
276 Ga0501070_0029319 3300049586 Bacteria 4615
277 Ga0501071_0234582 3300049587 Bacteria 1383
278 Ga0501071_0815532 3300049587 Bacteria 720
279 Ga0501072_0107863 3300049588 Bacteria 2215
280 Ga0501072_0437383 3300049588 Bacteria 1036
281 Ga0501072_0603062 3300049588 Bacteria 866
282 Ga0501073_0036473 3300049589 Bacteria 3493
283 Ga0501074_0066966 3300049590 Bacteria 2583
284 Ga0501075_0126264 3300049591 Bacteria 1948
285 Ga0501075_0814244 3300049591 Bacteria 711
286 Ga0501076_0229672 3300049592 Bacteria 1517
287 Ga0501076_0316007 3300049592 Bacteria 1281
288 Ga0501079_0229001 3300049741 Bacteria 1452
289 Ga0501079_0350156 3300049741 Bacteria 1157
290 Ga0501079_0869753 3300049741 Bacteria 710
291 Ga0501080_0139991 3300049742 Bacteria 2237
292 Ga0501081_0580237 3300049743 Bacteria 839
293 Ga0501083_0047898 3300049744 Bacteria 2886
294 Ga0501035_0111979 3300049822 Bacteria 2391
295 Ga0501035_0450501 3300049822 Bacteria 1065
296 Ga0501045_0988845 3300049824 Bacteria 617
297 nmdc:mga00v17_346035_c1 3300050491 Bacteria 966
298 nmdc:mga0yw44_1080937_c1 3300050492 Bacteria 542
299 nmdc:mga0yw44_470870_c1 3300050492 Bacteria 852
300 nmdc:mga05p37_2540_c1 3300050507 Bacteria 21210
301 nmdc:mga05p37_90784_c1 3300050507 Bacteria 3764
302 nmdc:mga08y16_515267_c1 3300050511 Bacteria 1214
303 nmdc:mga08y16_901675_c1 3300050511 Bacteria 870
304 nmdc:mga0n895_18071_c1 3300050512 Bacteria 6518
305 nmdc:mga0rr50_1776061_c1 3300050513 Bacteria 519
306 nmdc:mga0rr50_87763_c1 3300050513 Bacteria 2415
307 nmdc:mga0a205_10932_c1 3300050515 Bacteria 8349
308 nmdc:mga0a205_326354_c1 3300050515 Bacteria 1405
309 Ga0495655_0139735 3300053083 Bacteria 753
310 Ga0495595_0047542 3300053084 Bacteria 1980
311 Ga0495619_1151123 3300053085 Bacteria 515
312 Ga0500641_0001554 3300053096 Bacteria 8181
313 Ga0501084_0114833 3300054114 Bacteria 2263
314 Ga0501084_0495940 3300054114 Bacteria 1032
315 Ga0590077_155312 3300059426 Bacteria 548
316 Ga0501082_0091756 3300060353 Bacteria 2623
317 Ga0501082_0344574 3300060353 Bacteria 1298
318 Ga0501082_0488803 3300060353 Bacteria 1076
319 Ga0501082_0616209 3300060353 Bacteria 950
320 Ga0501082_1079920 3300060353 Bacteria 702
321 Ga0530510_0253461 3300061734 Bacteria 1312
322 Ga0530510_0892831 3300061734 Bacteria 679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300015265 Ga0182005_1181410 Ga0182005_11814102 62
2 3300049571 Ga0501034_0127930 Ga0501034_0127930_1728_1991 64
3 3300039450 Ga0436363_0083650 Ga0436363_0083650_70_330 66
4 3300039450 Ga0436363_1649070 Ga0436363_1649070_1550_1810 66
5 3300044656 Ga0466969_0059785 Ga0466969_0059785_425_682 66
6 3300044684 Ga0466966_0016298 Ga0466966_0016298_2658_2915 66
7 3300044693 Ga0466961_0000190 Ga0466961_0000190_29811_30068 66
8 3300045049 Ga0466959_0031262 Ga0466959_0031262_540_797 66
9 3300045836 Ga0466958_0022565 Ga0466958_0022565_2136_2393 66
10 3300045976 Ga0466967_1221323 Ga0466967_1221323_14_274 66
11 3300001991 JGI24743J22301_10061961 JGI24743J22301_100619612 67
12 3300003373 JGI25407J50210_10024534 JGI25407J50210_100245342 67
13 3300003373 JGI25407J50210_10046900 JGI25407J50210_100469002 67
14 3300005329 Ga0070683_100186279 Ga0070683_1001862792 67
15 3300005337 Ga0070682_100199150 Ga0070682_1001991502 67
16 3300005340 Ga0070689_100036427 Ga0070689_1000364272 67
17 3300005343 Ga0070687_100190792 Ga0070687_1001907922 67
18 3300005343 Ga0070687_101107486 Ga0070687_1011074861 67
19 3300005345 Ga0070692_10679076 Ga0070692_106790762 67
20 3300005347 Ga0070668_101408624 Ga0070668_1014086241 67
21 3300005355 Ga0070671_101298695 Ga0070671_1012986951 67
22 3300005365 Ga0070688_100238014 Ga0070688_1002380141 67
23 3300005366 Ga0070659_100963547 Ga0070659_1009635471 67
24 3300005367 Ga0070667_100294981 Ga0070667_1002949812 67
25 3300005438 Ga0070701_10194419 Ga0070701_101944192 67
26 3300005441 Ga0070700_100006253 Ga0070700_1000062537 67
27 3300005441 Ga0070700_100035102 Ga0070700_1000351023 67
28 3300005456 Ga0070678_100287376 Ga0070678_1002873762 67
29 3300005456 Ga0070678_101552204 Ga0070678_1015522042 67
30 3300005459 Ga0068867_100797665 Ga0068867_1007976652 67
31 3300005466 Ga0070685_10442532 Ga0070685_104425322 67
32 3300005530 Ga0070679_100427505 Ga0070679_1004275052 67
33 3300005535 Ga0070684_100086409 Ga0070684_1000864092 67
34 3300005535 Ga0070684_100633824 Ga0070684_1006338242 67
35 3300005544 Ga0070686_100289548 Ga0070686_1002895482 67
36 3300005547 Ga0070693_100095819 Ga0070693_1000958193 67
37 3300005547 Ga0070693_101155488 Ga0070693_1011554882 67
38 3300005548 Ga0070665_100865678 Ga0070665_1008656781 67
39 3300005577 Ga0068857_102323068 Ga0068857_1023230682 67
40 3300005577 Ga0068857_102523211 Ga0068857_1025232112 67
41 3300005616 Ga0068852_100539448 Ga0068852_1005394482 67
42 3300005616 Ga0068852_100937187 Ga0068852_1009371872 67
43 3300005616 Ga0068852_101903998 Ga0068852_1019039982 67
44 3300005618 Ga0068864_100673557 Ga0068864_1006735572 67
45 3300005719 Ga0068861_100081616 Ga0068861_1000816163 67
46 3300005840 Ga0068870_11323330 Ga0068870_113233302 67
47 3300005842 Ga0068858_101046522 Ga0068858_1010465222 67
48 3300005844 Ga0068862_102154618 Ga0068862_1021546181 67
49 3300005937 Ga0081455_10016000 Ga0081455_100160004 67
50 3300005981 Ga0081538_10000032 Ga0081538_1000003227 67
51 3300005981 Ga0081538_10002684 Ga0081538_100026842 67
52 3300005981 Ga0081538_10007907 Ga0081538_100079075 67
53 3300005981 Ga0081538_10024077 Ga0081538_100240776 67
54 3300005981 Ga0081538_10043364 Ga0081538_100433643 67
55 3300005981 Ga0081538_10043488 Ga0081538_100434882 67
56 3300005981 Ga0081538_10121022 Ga0081538_101210222 67
57 3300005981 Ga0081538_10167041 Ga0081538_101670412 67
58 3300005983 Ga0081540_1051117 Ga0081540_10511172 67
59 3300006038 Ga0075365_10629461 Ga0075365_106294612 67
60 3300006237 Ga0097621_100692580 Ga0097621_1006925802 67
61 3300006852 Ga0075433_10579576 Ga0075433_105795762 67
62 3300007076 Ga0075435_100490604 Ga0075435_1004906042 67
63 3300007076 Ga0075435_101928138 Ga0075435_1019281381 67
64 3300009092 Ga0105250_10463574 Ga0105250_104635741 67
65 3300009093 Ga0105240_11315058 Ga0105240_113150582 67
66 3300009094 Ga0111539_10194892 Ga0111539_101948922 67
67 3300009098 Ga0105245_12021080 Ga0105245_120210801 67
68 3300009101 Ga0105247_10028672 Ga0105247_100286725 67
69 3300009101 Ga0105247_11770764 Ga0105247_117707641 67
70 3300009147 Ga0114129_13313428 Ga0114129_133134282 67
71 3300009148 Ga0105243_10040377 Ga0105243_100403774 67
72 3300009174 Ga0105241_11930454 Ga0105241_119304541 67
73 3300009177 Ga0105248_10384691 Ga0105248_103846914 67
74 3300009545 Ga0105237_12739786 Ga0105237_127397861 67
75 3300009551 Ga0105238_10593217 Ga0105238_105932172 67
76 3300009551 Ga0105238_11773680 Ga0105238_117736802 67
77 3300009553 Ga0105249_11514474 Ga0105249_115144741 67
78 3300011119 Ga0105246_10090973 Ga0105246_100909732 67
79 3300011119 Ga0105246_10689977 Ga0105246_106899772 67
80 3300012500 Ga0157314_1032991 Ga0157314_10329911 67
81 3300013105 Ga0157369_11552653 Ga0157369_115526532 67
82 3300013296 Ga0157374_10621212 Ga0157374_106212122 67
83 3300013307 Ga0157372_11020119 Ga0157372_110201192 67
84 3300013308 Ga0157375_10623017 Ga0157375_106230172 67
85 3300014326 Ga0157380_10152894 Ga0157380_101528943 67
86 3300014326 Ga0157380_11405035 Ga0157380_114050352 67
87 3300014745 Ga0157377_10204770 Ga0157377_102047702 67
88 3300014968 Ga0157379_10377451 Ga0157379_103774511 67
89 3300014969 Ga0157376_10556769 Ga0157376_105567691 67
90 3300020082 Ga0206353_10435260 Ga0206353_104352602 67
91 3300021377 Ga0213874_10077495 Ga0213874_100774952 67
92 3300021384 Ga0213876_10494820 Ga0213876_104948201 67
93 3300021388 Ga0213875_10077402 Ga0213875_100774022 67
94 3300025900 Ga0207710_10013280 Ga0207710_100132804 67
95 3300025901 Ga0207688_10034250 Ga0207688_100342503 67
96 3300025908 Ga0207643_10005113 Ga0207643_100051137 67
97 3300025918 Ga0207662_10057074 Ga0207662_100570742 67
98 3300025918 Ga0207662_10196776 Ga0207662_101967762 67
99 3300025921 Ga0207652_10143763 Ga0207652_101437633 67
100 3300025931 Ga0207644_11831631 Ga0207644_118316311 67
101 3300025933 Ga0207706_10049989 Ga0207706_100499893 67
102 3300025934 Ga0207686_10356818 Ga0207686_103568182 67
103 3300025935 Ga0207709_10497833 Ga0207709_104978331 67
104 3300025936 Ga0207670_10975620 Ga0207670_109756202 67
105 3300025981 Ga0207640_10362117 Ga0207640_103621172 67
106 3300026035 Ga0207703_12348998 Ga0207703_123489981 67
107 3300026075 Ga0207708_10009602 Ga0207708_100096026 67
108 3300026075 Ga0207708_10038797 Ga0207708_100387974 67
109 3300026116 Ga0207674_10598010 Ga0207674_105980102 67
110 3300026118 Ga0207675_100861709 Ga0207675_1008617092 67
111 3300026121 Ga0207683_10323924 Ga0207683_103239242 67
112 3300026142 Ga0207698_10034641 Ga0207698_100346412 67
113 3300028381 Ga0268264_10671246 Ga0268264_106712462 67
114 3300028381 Ga0268264_10751223 Ga0268264_107512232 67
115 3300031548 Ga0307408_100313480 Ga0307408_1003134802 67
116 3300031731 Ga0307405_11010550 Ga0307405_110105502 67
117 3300031731 Ga0307405_11302498 Ga0307405_113024982 67
118 3300031731 Ga0307405_11909257 Ga0307405_119092571 67
119 3300031824 Ga0307413_11035002 Ga0307413_110350021 67
120 3300031901 Ga0307406_10415833 Ga0307406_104158332 67
121 3300031903 Ga0307407_10426912 Ga0307407_104269122 67
122 3300031995 Ga0307409_100087995 Ga0307409_1000879953 67
123 3300031995 Ga0307409_100851702 Ga0307409_1008517021 67
124 3300031995 Ga0307409_102131056 Ga0307409_1021310561 67
125 3300032002 Ga0307416_100008421 Ga0307416_1000084216 67
126 3300032002 Ga0307416_100845245 Ga0307416_1008452451 67
127 3300032004 Ga0307414_10353013 Ga0307414_103530131 67
128 3300032126 Ga0307415_100033220 Ga0307415_1000332202 67
129 3300032126 Ga0307415_100249235 Ga0307415_1002492352 67
130 3300035091 Ga0373951_0124878 Ga0373951_0124878_195_461 67
131 3300035114 Ga0373939_0050618 Ga0373939_0050618_29_295 67
132 3300035691 Ga0373931_0282468 Ga0373931_0282468_595_861 67
133 3300037853 Ga0436364_0588143 Ga0436364_0588143_1637_1903 67
134 3300037853 Ga0436364_1467034 Ga0436364_1467034_4650_4916 67
135 3300038443 Ga0395901_0326999 Ga0395901_0326999_61_324 67
136 3300038996 Ga0242420_092553 Ga0242420_092553_33_299 67
137 3300039437 Ga0436365_0265075 Ga0436365_0265075_538_804 67
138 3300039437 Ga0436365_0507278 Ga0436365_0507278_42_302 67
139 3300039437 Ga0436365_1121702 Ga0436365_1121702_127_393 67
140 3300039437 Ga0436365_1197849 Ga0436365_1197849_398_661 67
141 3300039450 Ga0436363_0190554 Ga0436363_0190554_411_677 67
142 3300039450 Ga0436363_1314756 Ga0436363_1314756_1735_2001 67
143 3300044683 Ga0466965_0341357 Ga0466965_0341357_439_705 67
144 3300044683 Ga0466965_0362133 Ga0466965_0362133_20_286 67
145 3300044684 Ga0466966_0158597 Ga0466966_0158597_49_312 67
146 3300044693 Ga0466961_0118475 Ga0466961_0118475_1266_1532 67
147 3300044694 Ga0466963_0368992 Ga0466963_0368992_662_925 67
148 3300044765 Ga0466970_0691516 Ga0466970_0691516_24_290 67
149 3300044842 Ga0466957_0099632 Ga0466957_0099632_710_976 67
150 3300045049 Ga0466959_0584453 Ga0466959_0584453_157_423 67
151 3300045049 Ga0466959_0721272 Ga0466959_0721272_128_391 67
152 3300045976 Ga0466967_0298421 Ga0466967_0298421_544_807 67
153 3300045976 Ga0466967_0394245 Ga0466967_0394245_691_957 67
154 3300045976 Ga0466967_0788733 Ga0466967_0788733_651_914 67
155 3300047320 Ga0495672_0229018 Ga0495672_0229018_373_636 67
156 3300048903 Ga0496100_0089547 Ga0496100_0089547_1137_1403 67
157 3300048905 Ga0496102_0087355 Ga0496102_0087355_1554_1817 67
158 3300048905 Ga0496102_0249211 Ga0496102_0249211_1265_1531 67
159 3300048906 Ga0496103_0555588 Ga0496103_0555588_80_343 67
160 3300048908 Ga0496105_0292623 Ga0496105_0292623_561_824 67
161 3300048909 Ga0496106_0049137 Ga0496106_0049137_79_348 67
162 3300048909 Ga0496106_0089947 Ga0496106_0089947_185_448 67
163 3300048910 Ga0496107_0176460 Ga0496107_0176460_1108_1374 67
164 3300048911 Ga0496108_0112571 Ga0496108_0112571_1574_1840 67
165 3300048912 Ga0496109_0577513 Ga0496109_0577513_601_867 67
166 3300048913 Ga0496110_0359514 Ga0496110_0359514_905_1171 67
167 3300048914 Ga0496111_0455637 Ga0496111_0455637_271_537 67
168 3300048915 Ga0496112_1153725 Ga0496112_1153725_70_333 67
169 3300048916 Ga0496113_0102776 Ga0496113_0102776_1365_1631 67
170 3300048916 Ga0496113_0212161 Ga0496113_0212161_890_1156 67
171 3300048918 Ga0496115_0301697 Ga0496115_0301697_659_925 67
172 3300049824 Ga0501045_0988845 Ga0501045_0988845_38_301 67
173 3300050492 nmdc:mga0yw44_1080937_c1 nmdc:mga0yw44_1080937_c1_238_504 67
174 3300050492 nmdc:mga0yw44_470870_c1 nmdc:mga0yw44_470870_c1_179_442 67
175 3300050511 nmdc:mga08y16_515267_c1 nmdc:mga08y16_515267_c1_345_611 67
176 3300050511 nmdc:mga08y16_901675_c1 nmdc:mga08y16_901675_c1_347_610 67
177 3300050513 nmdc:mga0rr50_1776061_c1 nmdc:mga0rr50_1776061_c1_51_314 67
178 3300050515 nmdc:mga0a205_326354_c1 nmdc:mga0a205_326354_c1_245_511 67
179 3300053083 Ga0495655_0139735 Ga0495655_0139735_176_439 67
180 3300053084 Ga0495595_0047542 Ga0495595_0047542_504_767 67
181 3300053085 Ga0495619_1151123 Ga0495619_1151123_128_391 67
182 3300059426 Ga0590077_155312 Ga0590077_155312_92_370 67
183 3300060353 Ga0501082_0488803 Ga0501082_0488803_34_297 67
184 3300005355 Ga0070671_100914168 Ga0070671_1009141682 68
185 3300005435 Ga0070714_100727201 Ga0070714_1007272011 68
186 3300005543 Ga0070672_100005927 Ga0070672_1000059278 68
187 3300009094 Ga0111539_12591548 Ga0111539_125915481 68
188 3300014325 Ga0163163_10181389 Ga0163163_101813894 68
189 3300025931 Ga0207644_11774598 Ga0207644_117745982 68
190 3300025940 Ga0207691_10007764 Ga0207691_100077643 68
191 3300031731 Ga0307405_10377870 Ga0307405_103778701 68
192 3300031824 Ga0307413_10333393 Ga0307413_103333932 68
193 3300031903 Ga0307407_10615302 Ga0307407_106153022 68
194 3300032002 Ga0307416_100762109 Ga0307416_1007621092 68
195 3300032005 Ga0307411_10992995 Ga0307411_109929952 68
196 3300049578 Ga0501042_0567100 Ga0501042_0567100_477_752 68
197 3300049584 Ga0501068_0697240 Ga0501068_0697240_20_295 68
198 3300049588 Ga0501072_0603062 Ga0501072_0603062_274_549 68
199 3300049592 Ga0501076_0229672 Ga0501076_0229672_759_1034 68
200 3300060353 Ga0501082_0616209 Ga0501082_0616209_25_300 68
201 3300061734 Ga0530510_0892831 Ga0530510_0892831_166_441 68
202 3300032126 Ga0307415_102504857 Ga0307415_1025048571 71
203 3300013306 Ga0163162_12973052 Ga0163162_129730522 72
204 3300005614 Ga0068856_100022275 Ga0068856_1000222752 73
205 3300026078 Ga0207702_10009729 Ga0207702_100097296 73
206 3300037418 Ga0395900_0030319 Ga0395900_0030319_528_791 73
207 3300037466 Ga0395898_0001844 Ga0395898_0001844_15908_16171 73
208 3300037853 Ga0436364_1400026 Ga0436364_1400026_272_529 73
209 3300044656 Ga0466969_0002961 Ga0466969_0002961_4747_5010 73
210 3300044693 Ga0466961_0802290 Ga0466961_0802290_48_311 73
211 3300044842 Ga0466957_0097960 Ga0466957_0097960_683_946 73
212 3300045836 Ga0466958_0215408 Ga0466958_0215408_18_281 73
213 3300045836 Ga0466958_0950168 Ga0466958_0950168_129_398 73
214 3300045976 Ga0466967_0720019 Ga0466967_0720019_505_768 73
215 3300046461 Ga0495641_0268474 Ga0495641_0268474_31_291 73
216 3300049584 Ga0501068_0109726 Ga0501068_0109726_1059_1316 73
217 3300005549 Ga0070704_100263609 Ga0070704_1002636092 74
218 3300005719 Ga0068861_102109806 Ga0068861_1021098062 74
219 3300006038 Ga0075365_10341243 Ga0075365_103412432 74
220 3300009147 Ga0114129_10111315 Ga0114129_101113152 74
221 3300025904 Ga0207647_10628185 Ga0207647_106281851 74
222 3300048088 Ga0495602_1095532 Ga0495602_1095532_83_343 74
223 3300050507 nmdc:mga05p37_90784_c1 nmdc:mga05p37_90784_c1_624_884 74
224 3300001977 JGI24746J21847_1068626 JGI24746J21847_10686262 75
225 3300003203 JGI25406J46586_10067752 JGI25406J46586_100677522 75
226 3300003203 JGI25406J46586_10150746 JGI25406J46586_101507462 75
227 3300005356 Ga0070674_102217832 Ga0070674_1022178321 75
228 3300005435 Ga0070714_100642880 Ga0070714_1006428801 75
229 3300005435 Ga0070714_101599363 Ga0070714_1015993632 75
230 3300005518 Ga0070699_101365242 Ga0070699_1013652421 75
231 3300005535 Ga0070684_100491246 Ga0070684_1004912461 75
232 3300005614 Ga0068856_101113846 Ga0068856_1011138462 75
233 3300005719 Ga0068861_100692908 Ga0068861_1006929082 75
234 3300005981 Ga0081538_10017889 Ga0081538_100178895 75
235 3300005981 Ga0081538_10023870 Ga0081538_100238704 75
236 3300005985 Ga0081539_10002492 Ga0081539_1000249215 75
237 3300005985 Ga0081539_10003844 Ga0081539_100038443 75
238 3300006038 Ga0075365_10170768 Ga0075365_101707682 75
239 3300006846 Ga0075430_100095634 Ga0075430_1000956341 75
240 3300006852 Ga0075433_10032463 Ga0075433_100324636 75
241 3300006871 Ga0075434_100008698 Ga0075434_1000086982 75
242 3300007076 Ga0075435_100021015 Ga0075435_1000210156 75
243 3300009101 Ga0105247_10572116 Ga0105247_105721162 75
244 3300009147 Ga0114129_10000512 Ga0114129_100005126 75
245 3300009553 Ga0105249_10005000 Ga0105249_100050004 75
246 3300009553 Ga0105249_10394008 Ga0105249_103940082 75
247 3300014745 Ga0157377_11331171 Ga0157377_113311711 75
248 3300025907 Ga0207645_10322623 Ga0207645_103226232 75
249 3300025940 Ga0207691_11211702 Ga0207691_112117021 75
250 3300025942 Ga0207689_10404830 Ga0207689_104048303 75
251 3300025961 Ga0207712_11098760 Ga0207712_110987602 75
252 3300031691 Ga0316579_10093830 Ga0316579_100938302 75
253 3300031727 Ga0316576_10743033 Ga0316576_107430332 75
254 3300032133 Ga0316583_10117277 Ga0316583_101172771 75
255 3300035398 Ga0316574_0281509 Ga0316574_0281509_717_980 75
256 3300036712 Ga0316584_0103879 Ga0316584_0103879_1580_1843 75
257 3300036712 Ga0316584_0385927 Ga0316584_0385927_87_350 75
258 3300037853 Ga0436364_0576277 Ga0436364_0576277_372_635 75
259 3300039450 Ga0436363_1062156 Ga0436363_1062156_809_1072 75
260 3300039450 Ga0436363_1187769 Ga0436363_1187769_304_570 75
261 3300044683 Ga0466965_0191899 Ga0466965_0191899_62_328 75
262 3300044683 Ga0466965_0885044 Ga0466965_0885044_128_400 75
263 3300044706 Ga0466964_0107100 Ga0466964_0107100_146_412 75
264 3300044706 Ga0466964_0777554 Ga0466964_0777554_240_506 75
265 3300044901 Ga0466960_0396852 Ga0466960_0396852_489_752 75
266 3300045976 Ga0466967_0137705 Ga0466967_0137705_440_706 75
267 3300045976 Ga0466967_0203165 Ga0466967_0203165_384_650 75
268 3300046460 Ga0495638_0058328 Ga0495638_0058328_2064_2333 75
269 3300046558 Ga0495633_0040813 Ga0495633_0040813_1888_2160 75
270 3300046660 Ga0495625_0007737 Ga0495625_0007737_4854_5123 75
271 3300048911 Ga0496108_1719624 Ga0496108_1719624_192_455 75
272 3300048917 Ga0496114_0101663 Ga0496114_0101663_38_301 75
273 3300049568 Ga0501031_0150148 Ga0501031_0150148_568_834 75
274 3300049569 Ga0501032_0024248 Ga0501032_0024248_1744_2010 75
275 3300049570 Ga0501033_0008249 Ga0501033_0008249_7590_7856 75
276 3300049571 Ga0501034_0991188 Ga0501034_0991188_249_515 75
277 3300049572 Ga0501036_0050636 Ga0501036_0050636_2611_2877 75
278 3300049572 Ga0501036_0497916 Ga0501036_0497916_559_822 75
279 3300049573 Ga0501037_0021614 Ga0501037_0021614_2385_2651 75
280 3300049574 Ga0501038_0048276 Ga0501038_0048276_1711_1977 75
281 3300049575 Ga0501039_0049655 Ga0501039_0049655_1788_2054 75
282 3300049575 Ga0501039_0495097 Ga0501039_0495097_397_660 75
283 3300049576 Ga0501040_0425910 Ga0501040_0425910_75_338 75
284 3300049578 Ga0501042_0021010 Ga0501042_0021010_2409_2675 75
285 3300049578 Ga0501042_1158156 Ga0501042_1158156_281_544 75
286 3300049579 Ga0501043_0262538 Ga0501043_0262538_144_410 75
287 3300049580 Ga0501046_0004355 Ga0501046_0004355_9367_9633 75
288 3300049581 Ga0501047_0598221 Ga0501047_0598221_249_515 75
289 3300049582 Ga0501048_0008175 Ga0501048_0008175_5379_5645 75
290 3300049583 Ga0501067_0418830 Ga0501067_0418830_69_335 75
291 3300049584 Ga0501068_0310702 Ga0501068_0310702_601_867 75
292 3300049585 Ga0501069_0055390 Ga0501069_0055390_72_338 75
293 3300049586 Ga0501070_0029319 Ga0501070_0029319_2382_2648 75
294 3300049587 Ga0501071_0234582 Ga0501071_0234582_899_1162 75
295 3300049587 Ga0501071_0815532 Ga0501071_0815532_18_284 75
296 3300049588 Ga0501072_0107863 Ga0501072_0107863_309_575 75
297 3300049588 Ga0501072_0437383 Ga0501072_0437383_554_817 75
298 3300049589 Ga0501073_0036473 Ga0501073_0036473_2109_2375 75
299 3300049590 Ga0501074_0066966 Ga0501074_0066966_34_300 75
300 3300049591 Ga0501075_0126264 Ga0501075_0126264_1197_1460 75
301 3300049591 Ga0501075_0814244 Ga0501075_0814244_435_698 75
302 3300049592 Ga0501076_0316007 Ga0501076_0316007_303_566 75
303 3300049741 Ga0501079_0229001 Ga0501079_0229001_1170_1436 75
304 3300049741 Ga0501079_0350156 Ga0501079_0350156_429_692 75
305 3300049741 Ga0501079_0869753 Ga0501079_0869753_220_483 75
306 3300049742 Ga0501080_0139991 Ga0501080_0139991_1531_1797 75
307 3300049743 Ga0501081_0580237 Ga0501081_0580237_451_714 75
308 3300049744 Ga0501083_0047898 Ga0501083_0047898_917_1183 75
309 3300049822 Ga0501035_0111979 Ga0501035_0111979_510_776 75
310 3300049822 Ga0501035_0450501 Ga0501035_0450501_206_469 75
311 3300050491 nmdc:mga00v17_346035_c1 nmdc:mga00v17_346035_c1_490_753 75
312 3300050507 nmdc:mga05p37_2540_c1 nmdc:mga05p37_2540_c1_20067_20333 75
313 3300050512 nmdc:mga0n895_18071_c1 nmdc:mga0n895_18071_c1_5308_5574 75
314 3300050513 nmdc:mga0rr50_87763_c1 nmdc:mga0rr50_87763_c1_639_905 75
315 3300050515 nmdc:mga0a205_10932_c1 nmdc:mga0a205_10932_c1_3947_4213 75
316 3300053096 Ga0500641_0001554 Ga0500641_0001554_4205_4474 75
317 3300054114 Ga0501084_0114833 Ga0501084_0114833_1021_1287 75
318 3300054114 Ga0501084_0495940 Ga0501084_0495940_483_746 75
319 3300060353 Ga0501082_0091756 Ga0501082_0091756_2287_2550 75
320 3300060353 Ga0501082_0344574 Ga0501082_0344574_303_569 75
321 3300060353 Ga0501082_1079920 Ga0501082_1079920_406_669 75
322 3300061734 Ga0530510_0253461 Ga0530510_0253461_1039_1302 75

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00037

Fer4

4Fe-4S binding domain

41

64

0.95

PF12797

Fer4_2

4Fe-4S binding domain

39

60

0.92

PF12838

Fer4_7

4Fe-4S dicluster domain

6

62

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fd1-assembly1.cif.gz_A crystal structures of oxidized and reduced azotobacter vinelandii ferredoxin at ph 8 and ph 6 0.5698 9 71
1b0t-assembly1.cif.gz_A d15k/k84d mutant of azotobacter vinelandii fdi 0.5697 9 71
1a6l-assembly1.cif.gz_A t14c mutant of azotobacter vinelandii fdi 0.5658 9 71
1g3o-assembly1.cif.gz_A crystal structure of v19e mutant of ferredoxin i 0.5654 9 71
1bqx-assembly1.cif.gz_A artificial fe8s8 ferredoxin: the d13c variant of bacillus schlegelii fe7s8 ferredoxin 0.5516 5 73
ID Description Score Start End Superfamily
1h98A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.5724 7 68 3.30.70.20
af_O50433_2_106_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.5536 2 73 3.30.70.20
af_O50433_2_106_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.5316 2 73 3.30.70.20
af_A0A1D6PB11_1_97_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.4952 25 51 3.30.70.20
1h98A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.4905 7 68 3.30.70.20
ID Description Score Start End GO Terms
AF-A0A538F2R2-F1-model_v4 4Fe-4S dicluster domain-containing protein 0.7881 23 75 GO:0046872
GO:0051536
AF-X8DCW8-F1-model_v4 4Fe-4S binding domain protein 0.77 25 71 GO:0046872
GO:0051536
AF-X8C631-F1-model_v4 deleted 0.7546 25 75
AF-A0A438BCS0-F1-model_v4 ferredoxin--NADP(+) reductase (EC 1.18.1.2) 0.7332 12 75 GO:0016491
GO:0046872
GO:0051536
AF-A0A5C5R9F4-F1-model_v4 ferredoxin--NADP(+) reductase (EC 1.18.1.2) 0.7258 12 75 GO:0016491
GO:0046872
GO:0051536

Feature Viewer

pLDDT pTM Quality
65.85 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map