F406401

General Info

Members Datasets Scaffolds Average Seq Length
322 194 644 136

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_101209769|Ga0075430_1012097691
Length 154
Sequence LKVEGEVRSAGRNLKHRSMAKTLRLEIITPDGVVYSADVDMVTLPAIEGQMGVLPEHIRLMTQMEPGEMIVHRNGRDEFLAVGGGLIEVTGDRVSILTDMAIAADKIDEAKVEEARQRAEARLRDRISDEEVASVNASLARALAQLQVKRRRHY

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
105 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
106 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
107 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
108 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
109 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
112 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
113 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
141 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
142 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
143 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
144 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
145 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
146 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
171 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
172 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
173 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.17
Rhizosphere 96.89
Stem 0
Stem Tuber 0
Unclassified 20.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_101209769 3300006846 Unclassified 622
2 JGI25404J52841_10000195 3300003659 Bacteria 7179
3 Ga0065712_10160314 3300005290 Bacteria 1307
4 Ga0065712_10200350 3300005290 Bacteria 1111
5 Ga0065715_10013643 3300005293 Bacteria 2703
6 Ga0065715_10039811 3300005293 Bacteria 1697
7 Ga0065707_10013915 3300005295 Bacteria 2252
8 Ga0065707_10802172 3300005295 Bacteria 599
9 Ga0070690_100367936 3300005330 Bacteria 1048
10 Ga0070670_100289740 3300005331 Bacteria 1431
11 Ga0070670_100434735 3300005331 Bacteria 1161
12 Ga0068869_100250536 3300005334 Bacteria 1414
13 Ga0070689_101683782 3300005340 Unclassified 577
14 Ga0070661_100491656 3300005344 Bacteria 981
15 Ga0070668_100467954 3300005347 Bacteria 1087
16 Ga0070669_100067487 3300005353 Bacteria 2639
17 Ga0070669_101654340 3300005353 Bacteria 558
18 Ga0070675_100047553 3300005354 Bacteria 3515
19 Ga0070675_101250064 3300005354 Bacteria 684
20 Ga0070671_100519883 3300005355 Bacteria 1025
21 Ga0070674_100042718 3300005356 Bacteria 3081
22 Ga0070673_100360181 3300005364 Bacteria 1293
23 Ga0070673_100608855 3300005364 Bacteria 997
24 Ga0070673_100743126 3300005364 Bacteria 903
25 Ga0070659_100777224 3300005366 Bacteria 832
26 Ga0070667_100386092 3300005367 Bacteria 1272
27 Ga0070667_102215563 3300005367 Bacteria 518
28 Ga0070709_10698829 3300005434 Bacteria 789
29 Ga0070701_10166973 3300005438 Bacteria 1279
30 Ga0070701_10531993 3300005438 Unclassified 768
31 Ga0070711_100009705 3300005439 Bacteria 5930
32 Ga0070711_100656264 3300005439 Unclassified 880
33 Ga0070705_100323736 3300005440 Bacteria 1114
34 Ga0070705_100328455 3300005440 Bacteria 1107
35 Ga0070705_100554451 3300005440 Bacteria 882
36 Ga0070663_100371021 3300005455 Bacteria 1163
37 Ga0070663_100604162 3300005455 Bacteria 923
38 Ga0070663_100632589 3300005455 Bacteria 903
39 Ga0070678_100110398 3300005456 Bacteria 2151
40 Ga0070678_100781230 3300005456 Bacteria 866
41 Ga0070681_10172086 3300005458 Bacteria 2087
42 Ga0070698_101122885 3300005471 Unclassified 735
43 Ga0070672_100649131 3300005543 Bacteria 922
44 Ga0070672_100703483 3300005543 Bacteria 885
45 Ga0070695_100077817 3300005545 Bacteria 2186
46 Ga0070693_100658673 3300005547 Bacteria 762
47 Ga0070704_100332865 3300005549 Bacteria 1276
48 Ga0070704_101016889 3300005549 Bacteria 750
49 Ga0070664_100101024 3300005564 Bacteria 2508
50 Ga0070664_102002505 3300005564 Bacteria 550
51 Ga0068857_100146271 3300005577 Bacteria 2138
52 Ga0068854_101576756 3300005578 Bacteria 598
53 Ga0070702_100919687 3300005615 Unclassified 686
54 Ga0068852_100969915 3300005616 Unclassified 868
55 Ga0068859_101791411 3300005617 Unclassified 678
56 Ga0068861_100266505 3300005719 Bacteria 1469
57 Ga0068861_100638567 3300005719 Bacteria 982
58 Ga0068870_10055445 3300005840 Bacteria 2112
59 Ga0068863_100194026 3300005841 Bacteria 1952
60 Ga0068863_100799959 3300005841 Unclassified 940
61 Ga0068858_100335464 3300005842 Bacteria 1446
62 Ga0068858_100614613 3300005842 Bacteria 1055
63 Ga0068860_100548179 3300005843 Unclassified 1158
64 Ga0068862_100248589 3300005844 Bacteria 1620
65 Ga0081540_1000492 3300005983 Bacteria 38821
66 Ga0068871_100422925 3300006358 Bacteria 1190
67 Ga0075428_100030703 3300006844 Bacteria 5942
68 Ga0075428_100383632 3300006844 Bacteria 1506
69 Ga0075428_100597449 3300006844 Bacteria 1179
70 Ga0075428_100788929 3300006844 Bacteria 1010
71 Ga0075428_101692462 3300006844 Bacteria 660
72 Ga0075430_100035005 3300006846 Bacteria 4263
73 Ga0075430_100362623 3300006846 Bacteria 1196
74 Ga0075431_100024227 3300006847 Bacteria 6216
75 Ga0075431_100127871 3300006847 Bacteria 2622
76 Ga0075431_100239606 3300006847 Bacteria 1846
77 Ga0075431_101801737 3300006847 Unclassified 568
78 Ga0075433_10100157 3300006852 Bacteria 2565
79 Ga0075433_10139328 3300006852 Bacteria 2156
80 Ga0075434_100264458 3300006871 Bacteria 1739
81 Ga0075434_100285309 3300006871 Bacteria 1671
82 Ga0075434_101113983 3300006871 Unclassified 802
83 Ga0075429_100031707 3300006880 Bacteria 4593
84 Ga0075429_100141281 3300006880 Bacteria 2108
85 Ga0075429_100171636 3300006880 Bacteria 1899
86 Ga0068865_100352903 3300006881 Bacteria 1192
87 Ga0068865_100602234 3300006881 Unclassified 929
88 Ga0068865_101465942 3300006881 Bacteria 611
89 Ga0068865_101575784 3300006881 Bacteria 590
90 Ga0097620_101791534 3300006931 Unclassified 678
91 Ga0075435_100259679 3300007076 Bacteria 1480
92 Ga0105240_10023905 3300009093 Bacteria 8071
93 Ga0111539_10013420 3300009094 Bacteria 10242
94 Ga0111539_10082235 3300009094 Bacteria 3788
95 Ga0111539_10193589 3300009094 Bacteria 2372
96 Ga0111539_10915898 3300009094 Bacteria 1019
97 Ga0111539_11293869 3300009094 Bacteria 846
98 Ga0105245_10490240 3300009098 Bacteria 1243
99 Ga0114129_10015395 3300009147 Bacteria 10883
100 Ga0114129_10016379 3300009147 Bacteria 10552
101 Ga0114129_10321097 3300009147 Bacteria 2058
102 Ga0105243_12531427 3300009148 Unclassified 552
103 Ga0105242_11797955 3300009176 Bacteria 651
104 Ga0105248_10504799 3300009177 Bacteria 1364
105 Ga0105248_10757899 3300009177 Unclassified 1095
106 Ga0105248_11035556 3300009177 Bacteria 927
107 Ga0105237_10510574 3300009545 Bacteria 1208
108 Ga0105249_10381040 3300009553 Unclassified 1436
109 Ga0105239_10337735 3300010375 Bacteria 1700
110 Ga0157371_10018939 3300013102 Bacteria 5082
111 Ga0157374_11570513 3300013296 Unclassified 682
112 Ga0157378_10613591 3300013297 Bacteria 1100
113 Ga0157378_10937170 3300013297 Unclassified 898
114 Ga0157372_10674337 3300013307 Unclassified 1203
115 Ga0163163_11619971 3300014325 Bacteria 708
116 Ga0163163_12983364 3300014325 Bacteria 528
117 Ga0157376_10844357 3300014969 Bacteria 931
118 Ga0207697_10052236 3300025315 Bacteria 1691
119 Ga0207697_10163405 3300025315 Bacteria 972
120 Ga0207697_10229470 3300025315 Bacteria 820
121 Ga0207685_10783455 3300025905 Unclassified 524
122 Ga0207645_10083211 3300025907 Unclassified 2052
123 Ga0207707_10310902 3300025912 Bacteria 1361
124 Ga0207695_10016769 3300025913 Bacteria 8552
125 Ga0207671_10368604 3300025914 Unclassified 1140
126 Ga0207663_10015545 3300025916 Bacteria 4202
127 Ga0207663_10386899 3300025916 Bacteria 1067
128 Ga0207660_10155331 3300025917 Unclassified 1761
129 Ga0207681_10057262 3300025923 Bacteria 2663
130 Ga0207681_10679551 3300025923 Bacteria 855
131 Ga0207681_10922723 3300025923 Bacteria 732
132 Ga0207650_10214042 3300025925 Bacteria 1548
133 Ga0207659_10317740 3300025926 Bacteria 1284
134 Ga0207659_10917527 3300025926 Bacteria 753
135 Ga0207644_10366323 3300025931 Bacteria 1173
136 Ga0207690_10231839 3300025932 Bacteria 1418
137 Ga0207706_10177055 3300025933 Bacteria 1874
138 Ga0207706_10341484 3300025933 Bacteria 1302
139 Ga0207670_10470768 3300025936 Bacteria 1016
140 Ga0207670_11413392 3300025936 Unclassified 591
141 Ga0207669_10093754 3300025937 Bacteria 1963
142 Ga0207669_10732190 3300025937 Unclassified 815
143 Ga0207669_11639578 3300025937 Bacteria 549
144 Ga0207704_11440276 3300025938 Unclassified 591
145 Ga0207691_10012690 3300025940 Bacteria 8070
146 Ga0207711_10472084 3300025941 Bacteria 1168
147 Ga0207711_10592846 3300025941 Bacteria 1034
148 Ga0207679_10017304 3300025945 Bacteria 4806
149 Ga0207679_10051134 3300025945 Bacteria 3024
150 Ga0207651_10185996 3300025960 Bacteria 1653
151 Ga0207651_10450043 3300025960 Bacteria 1105
152 Ga0207651_10734591 3300025960 Bacteria 872
153 Ga0207668_10381608 3300025972 Bacteria 1186
154 Ga0207658_10814172 3300025986 Bacteria 848
155 Ga0207703_10507094 3300026035 Bacteria 1133
156 Ga0207678_10315297 3300026067 Bacteria 1345
157 Ga0207708_11365294 3300026075 Unclassified 621
158 Ga0207702_10817613 3300026078 Bacteria 921
159 Ga0207702_11019136 3300026078 Bacteria 821
160 Ga0207641_10769279 3300026088 Unclassified 951
161 Ga0207648_10707267 3300026089 Bacteria 934
162 Ga0207674_10002622 3300026116 Bacteria 22512
163 Ga0207674_10122701 3300026116 Bacteria 2564
164 Ga0207675_100009123 3300026118 Bacteria 9305
165 Ga0207683_10776605 3300026121 Bacteria 889
166 Ga0207683_11583949 3300026121 Unclassified 604
167 Ga0207428_10006479 3300027907 Bacteria 10805
168 Ga0207428_10076274 3300027907 Bacteria 2625
169 Ga0268265_10220507 3300028380 Bacteria 1659
170 Ga0268265_10753504 3300028380 Bacteria 945
171 Ga0268265_11748440 3300028380 Unclassified 628
172 Ga0268264_11709443 3300028381 Unclassified 640
173 Ga0265337_1000262 3300028556 Bacteria 28541
174 Ga0265337_1011499 3300028556 Bacteria 3048
175 Ga0265326_10048396 3300028558 Bacteria 1205
176 Ga0265319_1007127 3300028563 Bacteria 5069
177 Ga0265319_1089753 3300028563 Unclassified 971
178 Ga0265334_10014420 3300028573 Bacteria 3295
179 Ga0265334_10035522 3300028573 Bacteria 1972
180 Ga0265323_10081777 3300028653 Bacteria 1090
181 Ga0265336_10127728 3300028666 Bacteria 757
182 Ga0265336_10145327 3300028666 Bacteria 706
183 Ga0265338_10000510 3300028800 Bacteria 68748
184 Ga0265338_10009213 3300028800 Bacteria 11818
185 Ga0265338_10013472 3300028800 Bacteria 9223
186 Ga0265338_10065650 3300028800 Bacteria 3146
187 Ga0265338_10071923 3300028800 Bacteria 2955
188 Ga0265338_10082601 3300028800 Bacteria 2689
189 Ga0265338_10166435 3300028800 Bacteria 1696
190 Ga0265338_10208506 3300028800 Bacteria 1468
191 Ga0265338_10301239 3300028800 Bacteria 1165
192 Ga0265338_10340143 3300028800 Bacteria 1081
193 Ga0265338_10360543 3300028800 Bacteria 1043
194 Ga0265324_10044694 3300029957 Unclassified 1526
195 Ga0265324_10238800 3300029957 Unclassified 617
196 Ga0265324_10252648 3300029957 Unclassified 599
197 Ga0265330_10234975 3300031235 Bacteria 773
198 Ga0265332_10050106 3300031238 Bacteria 1795
199 Ga0265332_10279519 3300031238 Unclassified 690
200 Ga0265325_10028591 3300031241 Bacteria 3003
201 Ga0265325_10040529 3300031241 Bacteria 2445
202 Ga0265329_10208491 3300031242 Unclassified 645
203 Ga0265340_10001426 3300031247 Bacteria 13719
204 Ga0265340_10027766 3300031247 Bacteria 2851
205 Ga0265340_10063022 3300031247 Bacteria 1770
206 Ga0265340_10080834 3300031247 Bacteria 1530
207 Ga0265339_10003316 3300031249 Bacteria 11278
208 Ga0265331_10151291 3300031250 Bacteria 1054
209 Ga0265316_10006604 3300031344 Bacteria 11054
210 Ga0265316_10015777 3300031344 Bacteria 6588
211 Ga0265316_10084514 3300031344 Bacteria 2430
212 Ga0265316_10171888 3300031344 Bacteria 1616
213 Ga0307408_100033236 3300031548 Bacteria 3602
214 Ga0307408_100054345 3300031548 Bacteria 2895
215 Ga0265313_10006126 3300031595 Bacteria 8641
216 Ga0265314_10007537 3300031711 Bacteria 9429
217 Ga0265314_10112008 3300031711 Bacteria 1732
218 Ga0265314_10365070 3300031711 Unclassified 790
219 Ga0265342_10142033 3300031712 Bacteria 1339
220 Ga0307405_10163776 3300031731 Bacteria 1578
221 Ga0307405_10711159 3300031731 Bacteria 833
222 Ga0307407_10088098 3300031903 Bacteria 1896
223 Ga0307412_10019790 3300031911 Bacteria 4084
224 Ga0307412_10679544 3300031911 Bacteria 881
225 Ga0307409_100153185 3300031995 Bacteria 2005
226 Ga0307409_101778692 3300031995 Bacteria 645
227 Ga0307416_100039467 3300032002 Bacteria 3656
228 Ga0307416_100106739 3300032002 Bacteria 2455
229 Ga0307416_100266476 3300032002 Bacteria 1678
230 Ga0307411_10029102 3300032005 Bacteria 3368
231 Ga0307411_10066185 3300032005 Bacteria 2427
232 Ga0307411_10733950 3300032005 Bacteria 863
233 Ga0373960_0111296 3300035121 Bacteria 899
234 Ga0373931_0227946 3300035691 Bacteria 1125
235 Ga0373935_1129338 3300035692 Bacteria 584
236 Ga0373927_0430784 3300035695 Unclassified 871
237 Ga0373925_0852627 3300037068 Unclassified 751
238 Ga0373925_1509077 3300037068 Unclassified 550
239 Ga0395899_0517243 3300037312 Bacteria 772
240 Ga0395898_0877285 3300037466 Bacteria 836
241 Ga0395905_0142325 3300037471 Bacteria 2256
242 Ga0395905_0375281 3300037471 Bacteria 1316
243 Ga0395905_1816946 3300037471 Unclassified 515
244 Ga0395901_0003535 3300038443 Bacteria 15747
245 Ga0451853_1012846 3300041512 Bacteria 1667
246 Ga0439443_085978 3300042003 Bacteria 589
247 Ga0450898_066041 3300042134 Bacteria 718
248 Ga0450905_079231 3300042142 Unclassified 569
249 Ga0450908_005652 3300042184 Bacteria 2392
250 Ga0439444_0143865 3300042437 Bacteria 572
251 Ga0439459_0021908 3300042438 Bacteria 1232
252 Ga0450918_027957 3300042531 Bacteria 992
253 Ga0451577_1133136 3300042876 Bacteria 699
254 Ga0495651_0264895 3300046462 Unclassified 1168
255 Ga0495580_0861544 3300046472 Bacteria 584
256 Ga0495582_0776721 3300046473 Unclassified 554
257 Ga0495594_0381543 3300046499 Bacteria 802
258 Ga0495628_0297785 3300046516 Unclassified 1195
259 Ga0495630_0813574 3300046517 Unclassified 713
260 Ga0495630_0962126 3300046517 Unclassified 649
261 Ga0495645_0127897 3300046543 Bacteria 1784
262 Ga0495645_0218246 3300046543 Bacteria 1284
263 Ga0495667_0478645 3300046559 Unclassified 781
264 Ga0495599_0011584 3300046678 Bacteria 5423
265 Ga0495669_0165983 3300046684 Bacteria 1049
266 Ga0495613_1017249 3300046689 Unclassified 532
267 Ga0495675_0361197 3300047444 Unclassified 852
268 Ga0495684_0084733 3300047471 Bacteria 2404
269 Ga0495684_0839827 3300047471 Bacteria 597
270 Ga0496105_1282092 3300048908 Unclassified 536
271 Ga0496108_0087442 3300048911 Bacteria 2647
272 Ga0496109_0499141 3300048912 Bacteria 1149
273 Ga0496110_0727474 3300048913 Bacteria 895
274 Ga0496112_0099874 3300048915 Bacteria 2872
275 Ga0496113_0558909 3300048916 Bacteria 918
276 Ga0496115_0607928 3300048918 Unclassified 869
277 Ga0496118_0533954 3300048921 Unclassified 576
278 Ga0496126_0364290 3300048929 Bacteria 1180
279 Ga0501292_081701 3300049515 Bacteria 616
280 Ga0501298_166067 3300049521 Unclassified 547
281 Ga0501299_005887 3300049522 Bacteria 1903
282 Ga0501300_033696 3300049523 Bacteria 760
283 Ga0501031_0890103 3300049568 Bacteria 570
284 Ga0501034_0000245 3300049571 Bacteria 100221
285 Ga0501034_1017221 3300049571 Unclassified 712
286 Ga0501042_1217463 3300049578 Bacteria 549
287 Ga0501072_0629290 3300049588 Unclassified 845
288 Ga0501075_0203963 3300049591 Unclassified 1508
289 Ga0501079_0568584 3300049741 Viruses 892
290 Ga0501283_002071 3300049779 Bacteria 2602
291 Ga0501044_0946263 3300049823 Unclassified 735
292 Ga0501212_068680 3300049851 Bacteria 624
293 nmdc:mga05p37_1460060_c1 3300050507 Bacteria 684
294 nmdc:mga05p37_16793_c1 3300050507 Bacteria 8825
295 nmdc:mga05p37_440492_c1 3300050507 Bacteria 1511
296 nmdc:mga05p37_466_c1 3300050507 Bacteria 44060
297 nmdc:mga09592_10235_c1 3300050508 Bacteria 7632
298 nmdc:mga09592_10871_c1 3300050508 Bacteria 7407
299 nmdc:mga09592_151788_c1 3300050508 Bacteria 1999
300 nmdc:mga0qj67_597782_c1 3300050509 Bacteria 883
301 nmdc:mga0qj67_9455_c1 3300050509 Bacteria 7256
302 nmdc:mga06r32_1309389_c1 3300050510 Bacteria 668
303 nmdc:mga06r32_141331_c1 3300050510 Bacteria 2384
304 nmdc:mga06r32_262324_c1 3300050510 Bacteria 1715
305 nmdc:mga06r32_48394_c1 3300050510 Bacteria 4063
306 nmdc:mga08y16_119833_c1 3300050511 Bacteria 2739
307 nmdc:mga08y16_178527_c1 3300050511 Bacteria 2205
308 nmdc:mga08y16_333580_c1 3300050511 Unclassified 1560
309 nmdc:mga08y16_351176_c1 3300050511 Bacteria 1515
310 nmdc:mga08y16_4826_c1 3300050511 Bacteria 14066
311 nmdc:mga0n895_51602_c1 3300050512 Bacteria 4035
312 nmdc:mga0n895_967444_c1 3300050512 Unclassified 834
313 nmdc:mga0rr50_1103367_c1 3300050513 Bacteria 675
314 nmdc:mga0rr50_98119_c1 3300050513 Bacteria 2296
315 nmdc:mga08x19_420953_c1 3300050514 Bacteria 938
316 nmdc:mga0a205_1465346_c1 3300050515 Bacteria 531
317 nmdc:mga0a205_227314_c1 3300050515 Unclassified 1750
318 nmdc:mga0a205_474794_c1 3300050515 Bacteria 1109
319 nmdc:mga0a205_5386_c1 3300050515 Bacteria 11540
320 Ga0495601_0711278 3300053077 Unclassified 640
321 Ga0501082_0453312 3300060353 Unclassified 1121
322 Ga0530510_0615376 3300061734 Bacteria 826
323 Ga0075430_101209769
324 JGI25404J52841_10000195
325 Ga0065712_10160314
326 Ga0065712_10200350
327 Ga0065715_10013643
328 Ga0065715_10039811
329 Ga0065707_10013915
330 Ga0065707_10802172
331 Ga0070690_100367936
332 Ga0070670_100289740
333 Ga0070670_100434735
334 Ga0068869_100250536
335 Ga0070689_101683782
336 Ga0070661_100491656
337 Ga0070668_100467954
338 Ga0070669_100067487
339 Ga0070669_101654340
340 Ga0070675_100047553
341 Ga0070675_101250064
342 Ga0070671_100519883
343 Ga0070674_100042718
344 Ga0070673_100360181
345 Ga0070673_100608855
346 Ga0070673_100743126
347 Ga0070659_100777224
348 Ga0070667_100386092
349 Ga0070667_102215563
350 Ga0070709_10698829
351 Ga0070701_10166973
352 Ga0070701_10531993
353 Ga0070711_100009705
354 Ga0070711_100656264
355 Ga0070705_100323736
356 Ga0070705_100328455
357 Ga0070705_100554451
358 Ga0070663_100371021
359 Ga0070663_100604162
360 Ga0070663_100632589
361 Ga0070678_100110398
362 Ga0070678_100781230
363 Ga0070681_10172086
364 Ga0070698_101122885
365 Ga0070672_100649131
366 Ga0070672_100703483
367 Ga0070695_100077817
368 Ga0070693_100658673
369 Ga0070704_100332865
370 Ga0070704_101016889
371 Ga0070664_100101024
372 Ga0070664_102002505
373 Ga0068857_100146271
374 Ga0068854_101576756
375 Ga0070702_100919687
376 Ga0068852_100969915
377 Ga0068859_101791411
378 Ga0068861_100266505
379 Ga0068861_100638567
380 Ga0068870_10055445
381 Ga0068863_100194026
382 Ga0068863_100799959
383 Ga0068858_100335464
384 Ga0068858_100614613
385 Ga0068860_100548179
386 Ga0068862_100248589
387 Ga0081540_1000492
388 Ga0068871_100422925
389 Ga0075428_100030703
390 Ga0075428_100383632
391 Ga0075428_100597449
392 Ga0075428_100788929
393 Ga0075428_101692462
394 Ga0075430_100035005
395 Ga0075430_100362623
396 Ga0075431_100024227
397 Ga0075431_100127871
398 Ga0075431_100239606
399 Ga0075431_101801737
400 Ga0075433_10100157
401 Ga0075433_10139328
402 Ga0075434_100264458
403 Ga0075434_100285309
404 Ga0075434_101113983
405 Ga0075429_100031707
406 Ga0075429_100141281
407 Ga0075429_100171636
408 Ga0068865_100352903
409 Ga0068865_100602234
410 Ga0068865_101465942
411 Ga0068865_101575784
412 Ga0097620_101791534
413 Ga0075435_100259679
414 Ga0105240_10023905
415 Ga0111539_10013420
416 Ga0111539_10082235
417 Ga0111539_10193589
418 Ga0111539_10915898
419 Ga0111539_11293869
420 Ga0105245_10490240
421 Ga0114129_10015395
422 Ga0114129_10016379
423 Ga0114129_10321097
424 Ga0105243_12531427
425 Ga0105242_11797955
426 Ga0105248_10504799
427 Ga0105248_10757899
428 Ga0105248_11035556
429 Ga0105237_10510574
430 Ga0105249_10381040
431 Ga0105239_10337735
432 Ga0157371_10018939
433 Ga0157374_11570513
434 Ga0157378_10613591
435 Ga0157378_10937170
436 Ga0157372_10674337
437 Ga0163163_11619971
438 Ga0163163_12983364
439 Ga0157376_10844357
440 Ga0207697_10052236
441 Ga0207697_10163405
442 Ga0207697_10229470
443 Ga0207685_10783455
444 Ga0207645_10083211
445 Ga0207707_10310902
446 Ga0207695_10016769
447 Ga0207671_10368604
448 Ga0207663_10015545
449 Ga0207663_10386899
450 Ga0207660_10155331
451 Ga0207681_10057262
452 Ga0207681_10679551
453 Ga0207681_10922723
454 Ga0207650_10214042
455 Ga0207659_10317740
456 Ga0207659_10917527
457 Ga0207644_10366323
458 Ga0207690_10231839
459 Ga0207706_10177055
460 Ga0207706_10341484
461 Ga0207670_10470768
462 Ga0207670_11413392
463 Ga0207669_10093754
464 Ga0207669_10732190
465 Ga0207669_11639578
466 Ga0207704_11440276
467 Ga0207691_10012690
468 Ga0207711_10472084
469 Ga0207711_10592846
470 Ga0207679_10017304
471 Ga0207679_10051134
472 Ga0207651_10185996
473 Ga0207651_10450043
474 Ga0207651_10734591
475 Ga0207668_10381608
476 Ga0207658_10814172
477 Ga0207703_10507094
478 Ga0207678_10315297
479 Ga0207708_11365294
480 Ga0207702_10817613
481 Ga0207702_11019136
482 Ga0207641_10769279
483 Ga0207648_10707267
484 Ga0207674_10002622
485 Ga0207674_10122701
486 Ga0207675_100009123
487 Ga0207683_10776605
488 Ga0207683_11583949
489 Ga0207428_10006479
490 Ga0207428_10076274
491 Ga0268265_10220507
492 Ga0268265_10753504
493 Ga0268265_11748440
494 Ga0268264_11709443
495 Ga0265337_1000262
496 Ga0265337_1011499
497 Ga0265326_10048396
498 Ga0265319_1007127
499 Ga0265319_1089753
500 Ga0265334_10014420
501 Ga0265334_10035522
502 Ga0265323_10081777
503 Ga0265336_10127728
504 Ga0265336_10145327
505 Ga0265338_10000510
506 Ga0265338_10009213
507 Ga0265338_10013472
508 Ga0265338_10065650
509 Ga0265338_10071923
510 Ga0265338_10082601
511 Ga0265338_10166435
512 Ga0265338_10208506
513 Ga0265338_10301239
514 Ga0265338_10340143
515 Ga0265338_10360543
516 Ga0265324_10044694
517 Ga0265324_10238800
518 Ga0265324_10252648
519 Ga0265330_10234975
520 Ga0265332_10050106
521 Ga0265332_10279519
522 Ga0265325_10028591
523 Ga0265325_10040529
524 Ga0265329_10208491
525 Ga0265340_10001426
526 Ga0265340_10027766
527 Ga0265340_10063022
528 Ga0265340_10080834
529 Ga0265339_10003316
530 Ga0265331_10151291
531 Ga0265316_10006604
532 Ga0265316_10015777
533 Ga0265316_10084514
534 Ga0265316_10171888
535 Ga0307408_100033236
536 Ga0307408_100054345
537 Ga0265313_10006126
538 Ga0265314_10007537
539 Ga0265314_10112008
540 Ga0265314_10365070
541 Ga0265342_10142033
542 Ga0307405_10163776
543 Ga0307405_10711159
544 Ga0307407_10088098
545 Ga0307412_10019790
546 Ga0307412_10679544
547 Ga0307409_100153185
548 Ga0307409_101778692
549 Ga0307416_100039467
550 Ga0307416_100106739
551 Ga0307416_100266476
552 Ga0307411_10029102
553 Ga0307411_10066185
554 Ga0307411_10733950
555 Ga0373960_0111296
556 Ga0373931_0227946
557 Ga0373935_1129338
558 Ga0373927_0430784
559 Ga0373925_0852627
560 Ga0373925_1509077
561 Ga0395899_0517243
562 Ga0395898_0877285
563 Ga0395905_0142325
564 Ga0395905_0375281
565 Ga0395905_1816946
566 Ga0395901_0003535
567 Ga0451853_1012846
568 Ga0439443_085978
569 Ga0450898_066041
570 Ga0450905_079231
571 Ga0450908_005652
572 Ga0439444_0143865
573 Ga0439459_0021908
574 Ga0450918_027957
575 Ga0451577_1133136
576 Ga0495651_0264895
577 Ga0495580_0861544
578 Ga0495582_0776721
579 Ga0495594_0381543
580 Ga0495628_0297785
581 Ga0495630_0813574
582 Ga0495630_0962126
583 Ga0495645_0127897
584 Ga0495645_0218246
585 Ga0495667_0478645
586 Ga0495599_0011584
587 Ga0495669_0165983
588 Ga0495613_1017249
589 Ga0495675_0361197
590 Ga0495684_0084733
591 Ga0495684_0839827
592 Ga0496105_1282092
593 Ga0496108_0087442
594 Ga0496109_0499141
595 Ga0496110_0727474
596 Ga0496112_0099874
597 Ga0496113_0558909
598 Ga0496115_0607928
599 Ga0496118_0533954
600 Ga0496126_0364290
601 Ga0501292_081701
602 Ga0501298_166067
603 Ga0501299_005887
604 Ga0501300_033696
605 Ga0501031_0890103
606 Ga0501034_0000245
607 Ga0501034_1017221
608 Ga0501042_1217463
609 Ga0501072_0629290
610 Ga0501075_0203963
611 Ga0501079_0568584
612 Ga0501283_002071
613 Ga0501044_0946263
614 Ga0501212_068680
615 nmdc:mga05p37_1460060_c1
616 nmdc:mga05p37_16793_c1
617 nmdc:mga05p37_440492_c1
618 nmdc:mga05p37_466_c1
619 nmdc:mga09592_10235_c1
620 nmdc:mga09592_10871_c1
621 nmdc:mga09592_151788_c1
622 nmdc:mga0qj67_597782_c1
623 nmdc:mga0qj67_9455_c1
624 nmdc:mga06r32_1309389_c1
625 nmdc:mga06r32_141331_c1
626 nmdc:mga06r32_262324_c1
627 nmdc:mga06r32_48394_c1
628 nmdc:mga08y16_119833_c1
629 nmdc:mga08y16_178527_c1
630 nmdc:mga08y16_333580_c1
631 nmdc:mga08y16_351176_c1
632 nmdc:mga08y16_4826_c1
633 nmdc:mga0n895_51602_c1
634 nmdc:mga0n895_967444_c1
635 nmdc:mga0rr50_1103367_c1
636 nmdc:mga0rr50_98119_c1
637 nmdc:mga08x19_420953_c1
638 nmdc:mga0a205_1465346_c1
639 nmdc:mga0a205_227314_c1
640 nmdc:mga0a205_474794_c1
641 nmdc:mga0a205_5386_c1
642 Ga0495601_0711278
643 Ga0501082_0453312
644 Ga0530510_0615376

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02823

ATP-synt_DE_N

ATP synthase, Delta/Epsilon chain, beta-sandwich domain

23

101

0.98

PF00401

ATP-synt_DE

ATP synthase, Delta/Epsilon chain, long alpha-helix domain

105

150

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hkk-assembly2.cif.gz_P caldalaklibacillus thermarum f1-atpase (wild type) 0.9174 4 106
5ik2-assembly1.cif.gz_H caldalaklibacillus thermarum f1-atpase (epsilon mutant) 0.9112 4 106
5dn6-assembly1.cif.gz_I atp synthase from paracoccus denitrificans 0.8966 10 80
6ree-assembly1.cif.gz_R cryo-em structure of polytomella f-atp synthase, rotary substate 3b, composite map 0.8763 3 90
3ofn-assembly1.cif.gz_H structure of four mutant forms of yeast f1 atpase: alpha-n67i 0.8746 5 91
ID Description Score Start End Superfamily
af_Q2FWF1_1_89_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9442 3 89 2.60.15.10
af_P00835_1_88_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9383 4 89 2.60.15.10
2e5yB01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.937 3 89 2.60.15.10
2e5yB01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9168 3 89 2.60.15.10
af_Q2FWF1_1_89_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9138 3 89 2.60.15.10
ID Description Score Start End GO Terms
AF-A0A7C2NWA4-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9591 4 107 GO:0005524
GO:0005886
GO:0012505
GO:0045261
GO:0046933
AF-A0A359JLV4-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9585 2 104 GO:0005524
GO:0005886
GO:0012505
GO:0045261
GO:0046933
AF-A0A2G3PVM9-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9583 4 105 GO:0005524
GO:0005886
GO:0045261
GO:0046933
AF-A0A2V6B799-F1-model_v4 ATP synthase F1 subunit epsilon 0.9549 1 93 GO:0012505
GO:0045261
GO:0046933
AF-A0A7C7L6X6-F1-model_v4 ATP synthase F1 complex delta/epsilon subunit N-terminal domain-containing protein 0.9545 1 85 GO:0012505
GO:0045261
GO:0046933

Map