F406361

General Info

Members Datasets Scaffolds Average Seq Length
322 169 644 365

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100001139|Ga0068857_10000113911
Length 396
Sequence MFFRKTGYIFKDPVFRTFLGEDYETPAVPSRRMLKLLDRYILRKFLGTFIFTLLVITVIAVVIDTSEKADDFVKSGMTAWQLVIHYYIGFVPFIMSMIFPLMTFIAVIYFSSKMAGRSEFIAILAGGVRYNRMLRPYFLGSVILALIFWWASQYWVPRANEIRTDFQAVYVDRNSSYNSDYYRTNNFYLRVDPSTYVGFRYYDTVNKSASNFFMQKLKGNKVYYNLRAETVKWDAHKKDWRLQGVIERKIDGLKETVTKLDSLHVNLNVLPKELRRDDYLKDKLTTPELHQFIHMEEVRGAEGLNTFKVELYHRDATPFSVIIMTLMGAVIGTRKIRGGSGVHLAVGIVLAAIFVVMDKFSVTFSTKGEFPPMIAAWLPNVIFSGVAFWLYARTPK

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
110 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
117 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
120 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
121 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
127 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
136 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 2818991444 Filimonas endophytica 3197 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.93
Nodule 0
Rhizoplane 0.62
Rhizosphere 93.48
Stem 0
Stem Tuber 0
Unclassified 9.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100001139 3300005577 Bacteria 20729
2 rootH2_10063783 3300003320 Bacteria 3811
3 rootL2_10072130 3300003322 Bacteria 1865
4 Ga0070658_10035269 3300005327 Bacteria 4029
5 Ga0070658_10071949 3300005327 Unclassified 2833
6 Ga0070676_10010728 3300005328 Bacteria 4972
7 Ga0070683_100002428 3300005329 Bacteria 14813
8 Ga0070670_100127230 3300005331 Unclassified 2199
9 Ga0070670_100135717 3300005331 Unclassified 2126
10 Ga0068869_100076614 3300005334 Bacteria 2486
11 Ga0070666_10001301 3300005335 Bacteria 15111
12 Ga0070666_10011699 3300005335 Bacteria 5517
13 Ga0070682_100001382 3300005337 Bacteria 13697
14 Ga0068868_100020492 3300005338 Bacteria 4970
15 Ga0068868_100050553 3300005338 Bacteria 3265
16 Ga0068868_100203510 3300005338 Bacteria 1651
17 Ga0070691_10022587 3300005341 Bacteria 2919
18 Ga0070661_100074669 3300005344 Bacteria 2497
19 Ga0070668_100007075 3300005347 Bacteria 8312
20 Ga0070668_100105130 3300005347 Bacteria 2241
21 Ga0070675_100036599 3300005354 Bacteria 3995
22 Ga0070671_100017966 3300005355 Bacteria 5737
23 Ga0070671_100028128 3300005355 Bacteria 4629
24 Ga0070673_100038609 3300005364 Bacteria 3647
25 Ga0070673_100110735 3300005364 Bacteria 2277
26 Ga0070667_100014645 3300005367 Bacteria 6480
27 Ga0070667_100046485 3300005367 Bacteria 3651
28 Ga0070667_100062247 3300005367 Bacteria 3160
29 Ga0070667_100141239 3300005367 Bacteria 2109
30 Ga0070678_100029174 3300005456 Bacteria 3775
31 Ga0070678_100211818 3300005456 Unclassified 1606
32 Ga0070681_10172106 3300005458 Bacteria 2087
33 Ga0068867_100007411 3300005459 Bacteria 7758
34 Ga0068867_100093508 3300005459 Bacteria 2285
35 Ga0070685_10190839 3300005466 Unclassified 1325
36 Ga0070679_100001124 3300005530 Bacteria 23362
37 Ga0070684_100030813 3300005535 Bacteria 4562
38 Ga0068853_100000276 3300005539 Bacteria 36211
39 Ga0068853_100119944 3300005539 Unclassified 2345
40 Ga0068853_100202811 3300005539 Bacteria 1805
41 Ga0068853_100285159 3300005539 Unclassified 1523
42 Ga0070672_100000891 3300005543 Bacteria 17929
43 Ga0070672_100190047 3300005543 Bacteria 1714
44 Ga0070693_100031296 3300005547 Bacteria 2914
45 Ga0070665_100000001 3300005548 Bacteria 1083363
46 Ga0070665_100008882 3300005548 Bacteria 10177
47 Ga0068855_100000210 3300005563 Bacteria 74786
48 Ga0068855_100007690 3300005563 Bacteria 13018
49 Ga0068855_100297443 3300005563 Bacteria 1788
50 Ga0068856_100011104 3300005614 Bacteria 8745
51 Ga0068856_100043776 3300005614 Bacteria 4404
52 Ga0068856_100085700 3300005614 Bacteria 3129
53 Ga0068852_100059122 3300005616 Bacteria 3323
54 Ga0068852_100070886 3300005616 Bacteria 3059
55 Ga0068852_100084705 3300005616 Bacteria 2822
56 Ga0068852_100091475 3300005616 Bacteria 2723
57 Ga0068859_100000035 3300005617 Bacteria 169846
58 Ga0068859_100006691 3300005617 Bacteria 11705
59 Ga0068864_100014629 3300005618 Bacteria 6518
60 Ga0068864_100031790 3300005618 Bacteria 4479
61 Ga0068864_100074662 3300005618 Bacteria 2958
62 Ga0068861_100015457 3300005719 Bacteria 5380
63 Ga0068861_100352652 3300005719 Bacteria 1291
64 Ga0068861_100441212 3300005719 Bacteria 1164
65 Ga0068863_100000284 3300005841 Bacteria 52416
66 Ga0068863_100024625 3300005841 Bacteria 5740
67 Ga0068863_100054085 3300005841 Bacteria 3805
68 Ga0068863_100054921 3300005841 Bacteria 3773
69 Ga0068858_100004864 3300005842 Bacteria 13174
70 Ga0068858_100018766 3300005842 Bacteria 6470
71 Ga0068860_100000004 3300005843 Bacteria 506126
72 Ga0068860_100003394 3300005843 Bacteria 16385
73 Ga0068860_100003442 3300005843 Bacteria 16284
74 Ga0068860_100014813 3300005843 Bacteria 7627
75 Ga0068860_100058702 3300005843 Bacteria 3658
76 Ga0068862_100153288 3300005844 Bacteria 2052
77 Ga0081540_1033855 3300005983 Unclassified 2765
78 Ga0097621_100002686 3300006237 Bacteria 12173
79 Ga0097621_100048389 3300006237 Bacteria 3449
80 Ga0097621_100132746 3300006237 Bacteria 2121
81 Ga0068871_100000076 3300006358 Bacteria 55186
82 Ga0068871_100042213 3300006358 Bacteria 3660
83 Ga0075431_100012623 3300006847 Bacteria 8529
84 Ga0075429_100051259 3300006880 Bacteria 3591
85 Ga0068865_100016033 3300006881 Bacteria 4787
86 Ga0068865_100129894 3300006881 Bacteria 1886
87 Ga0097620_100000035 3300006931 Bacteria 169846
88 Ga0097620_100006691 3300006931 Bacteria 11705
89 Ga0105240_10002773 3300009093 Bacteria 27676
90 Ga0105240_10003397 3300009093 Bacteria 24765
91 Ga0105240_10003620 3300009093 Bacteria 23924
92 Ga0105240_10004711 3300009093 Bacteria 20598
93 Ga0105240_10006456 3300009093 Bacteria 17233
94 Ga0105240_10020111 3300009093 Bacteria 8911
95 Ga0105240_10031577 3300009093 Bacteria 6865
96 Ga0105240_10185091 3300009093 Bacteria 2454
97 Ga0105240_10291187 3300009093 Bacteria 1872
98 Ga0111539_10156350 3300009094 Unclassified 2668
99 Ga0105247_10016667 3300009101 Bacteria 4406
100 Ga0105247_10045869 3300009101 Bacteria 2682
101 Ga0105241_10000764 3300009174 Bacteria 24479
102 Ga0105241_10001925 3300009174 Bacteria 15714
103 Ga0105241_10006406 3300009174 Bacteria 8676
104 Ga0105241_10153590 3300009174 Bacteria 1885
105 Ga0105248_10026892 3300009177 Bacteria 6399
106 Ga0105237_10000377 3300009545 Bacteria 63580
107 Ga0105237_10000769 3300009545 Bacteria 43902
108 Ga0105237_10002457 3300009545 Bacteria 23008
109 Ga0105237_10013544 3300009545 Bacteria 8546
110 Ga0105237_10015625 3300009545 Bacteria 7890
111 Ga0105237_10091455 3300009545 Bacteria 3032
112 Ga0105237_10109711 3300009545 Bacteria 2751
113 Ga0105238_10004009 3300009551 Bacteria 14610
114 Ga0105238_10098270 3300009551 Bacteria 2911
115 Ga0105249_10001414 3300009553 Bacteria 20992
116 Ga0105249_10043592 3300009553 Bacteria 4080
117 Ga0105249_10052342 3300009553 Bacteria 3728
118 Ga0105239_10000029 3300010375 Bacteria 234749
119 Ga0105239_10001999 3300010375 Bacteria 26499
120 Ga0105239_10002549 3300010375 Bacteria 23115
121 Ga0105239_10022019 3300010375 Bacteria 7026
122 Ga0105239_10032586 3300010375 Bacteria 5726
123 Ga0105239_10055909 3300010375 Bacteria 4329
124 Ga0105239_10532889 3300010375 Bacteria 1337
125 Ga0105246_10206999 3300011119 Bacteria 1529
126 Ga0157371_10067507 3300013102 Unclassified 2531
127 Ga0157370_10001941 3300013104 Bacteria 25465
128 Ga0157370_10027949 3300013104 Bacteria 5556
129 Ga0157370_10154158 3300013104 Bacteria 2138
130 Ga0157369_10120253 3300013105 Bacteria 2787
131 Ga0157369_10495165 3300013105 Bacteria 1264
132 Ga0157374_10000001 3300013296 Bacteria 1077351
133 Ga0157374_10012275 3300013296 Bacteria 7451
134 Ga0157374_10419286 3300013296 Unclassified 1337
135 Ga0157378_10003283 3300013297 Bacteria 14386
136 Ga0157378_10004321 3300013297 Bacteria 12507
137 Ga0157378_10017195 3300013297 Bacteria 6339
138 Ga0157378_10068216 3300013297 Bacteria 3189
139 Ga0163162_10001306 3300013306 Bacteria 23316
140 Ga0163162_10002251 3300013306 Bacteria 18116
141 Ga0163162_10004691 3300013306 Bacteria 13180
142 Ga0163162_10008316 3300013306 Bacteria 10124
143 Ga0163162_10010477 3300013306 Bacteria 9014
144 Ga0163162_10017201 3300013306 Bacteria 7075
145 Ga0163162_10029635 3300013306 Bacteria 5417
146 Ga0163162_10088742 3300013306 Bacteria 3171
147 Ga0157372_10000535 3300013307 Bacteria 41817
148 Ga0157372_10002089 3300013307 Bacteria 21710
149 Ga0157372_10068990 3300013307 Bacteria 3976
150 Ga0157372_10080903 3300013307 Unclassified 3676
151 Ga0157375_10000754 3300013308 Bacteria 28363
152 Ga0157375_10039500 3300013308 Bacteria 4543
153 Ga0157375_10075302 3300013308 Bacteria 3399
154 Ga0163163_10001404 3300014325 Bacteria 20324
155 Ga0163163_10011499 3300014325 Bacteria 8034
156 Ga0163163_10040998 3300014325 Bacteria 4525
157 Ga0163163_10079251 3300014325 Bacteria 3283
158 Ga0157380_10008145 3300014326 Bacteria 7468
159 Ga0157379_10013980 3300014968 Bacteria 7034
160 Ga0157379_10024022 3300014968 Bacteria 5409
161 Ga0157379_10113645 3300014968 Unclassified 2433
162 Ga0157379_10374083 3300014968 Unclassified 1307
163 Ga0157376_10006460 3300014969 Bacteria 8284
164 Ga0157376_10007810 3300014969 Bacteria 7667
165 Ga0157376_10008586 3300014969 Bacteria 7381
166 Ga0163161_10036221 3300017792 Unclassified 3533
167 Ga0163161_10053659 3300017792 Unclassified 2924
168 Ga0163161_10077167 3300017792 Bacteria 2447
169 Ga0213876_10001135 3300021384 Bacteria 16968
170 Ga0207656_10001795 3300025321 Bacteria 7142
171 Ga0207710_10024166 3300025900 Bacteria 2615
172 Ga0207680_10000133 3300025903 Bacteria 34979
173 Ga0207680_10005281 3300025903 Bacteria 6165
174 Ga0207680_10059202 3300025903 Unclassified 2325
175 Ga0207647_10052200 3300025904 Unclassified 2524
176 Ga0207645_10014460 3300025907 Bacteria 5281
177 Ga0207705_10004089 3300025909 Bacteria 11073
178 Ga0207654_10000299 3300025911 Bacteria 30090
179 Ga0207654_10000493 3300025911 Bacteria 22608
180 Ga0207707_10000121 3300025912 Bacteria 80174
181 Ga0207695_10000057 3300025913 Bacteria 376090
182 Ga0207695_10000266 3300025913 Bacteria 132163
183 Ga0207695_10000568 3300025913 Bacteria 75553
184 Ga0207695_10001216 3300025913 Bacteria 44107
185 Ga0207695_10009568 3300025913 Bacteria 11975
186 Ga0207695_10018698 3300025913 Bacteria 8001
187 Ga0207695_10020873 3300025913 Bacteria 7485
188 Ga0207695_10131001 3300025913 Bacteria 2465
189 Ga0207695_10223683 3300025913 Bacteria 1789
190 Ga0207671_10000832 3300025914 Bacteria 39197
191 Ga0207671_10002783 3300025914 Bacteria 18250
192 Ga0207671_10004167 3300025914 Bacteria 13975
193 Ga0207671_10005217 3300025914 Bacteria 12078
194 Ga0207671_10063394 3300025914 Bacteria 2746
195 Ga0207660_10000354 3300025917 Bacteria 29872
196 Ga0207652_10000561 3300025921 Bacteria 37514
197 Ga0207694_10049453 3300025924 Bacteria 3255
198 Ga0207694_10088079 3300025924 Bacteria 2447
199 Ga0207650_10073082 3300025925 Unclassified 2582
200 Ga0207650_10227715 3300025925 Bacteria 1502
201 Ga0207687_10207429 3300025927 Bacteria 1535
202 Ga0207644_10006635 3300025931 Bacteria 7540
203 Ga0207706_10028492 3300025933 Bacteria 4988
204 Ga0207704_10008934 3300025938 Bacteria 4815
205 Ga0207704_10112660 3300025938 Bacteria 1843
206 Ga0207691_10001933 3300025940 Bacteria 20218
207 Ga0207711_10209771 3300025941 Bacteria 1779
208 Ga0207689_10000344 3300025942 Bacteria 43532
209 Ga0207667_10000246 3300025949 Bacteria 76379
210 Ga0207667_10003666 3300025949 Bacteria 18932
211 Ga0207667_10074991 3300025949 Bacteria 3513
212 Ga0207667_10214274 3300025949 Unclassified 1974
213 Ga0207667_10225261 3300025949 Bacteria 1921
214 Ga0207651_10003723 3300025960 Bacteria 7540
215 Ga0207712_10003110 3300025961 Bacteria 10587
216 Ga0207712_10040007 3300025961 Unclassified 3215
217 Ga0207712_10183301 3300025961 Bacteria 1646
218 Ga0207668_10004760 3300025972 Bacteria 7988
219 Ga0207658_10005434 3300025986 Bacteria 8737
220 Ga0207658_10109928 3300025986 Bacteria 2177
221 Ga0207677_10003111 3300026023 Bacteria 8760
222 Ga0207677_10273336 3300026023 Bacteria 1383
223 Ga0207703_10003019 3300026035 Bacteria 14263
224 Ga0207703_10013009 3300026035 Bacteria 6484
225 Ga0207639_10005235 3300026041 Bacteria 8748
226 Ga0207639_10119203 3300026041 Bacteria 2165
227 Ga0207639_10154674 3300026041 Unclassified 1925
228 Ga0207639_10171871 3300026041 Bacteria 1836
229 Ga0207702_10043338 3300026078 Bacteria 3778
230 Ga0207641_10000043 3300026088 Bacteria 186340
231 Ga0207641_10018614 3300026088 Bacteria 5694
232 Ga0207641_10028096 3300026088 Bacteria 4646
233 Ga0207641_10056765 3300026088 Bacteria 3328
234 Ga0207648_10004983 3300026089 Bacteria 13499
235 Ga0207676_10007718 3300026095 Bacteria 7648
236 Ga0207674_10004668 3300026116 Bacteria 16447
237 Ga0207675_100038563 3300026118 Bacteria 4458
238 Ga0207683_10030595 3300026121 Bacteria 4665
239 Ga0207683_10130888 3300026121 Bacteria 2257
240 Ga0207683_10233714 3300026121 Unclassified 1677
241 Ga0207698_10020901 3300026142 Bacteria 4516
242 Ga0207698_10053438 3300026142 Bacteria 3101
243 Ga0207698_10187277 3300026142 Bacteria 1839
244 Ga0268266_10000065 3300028379 Bacteria 246498
245 Ga0268266_10004126 3300028379 Bacteria 14038
246 Ga0268264_10000011 3300028381 Bacteria 580884
247 Ga0268264_10001194 3300028381 Bacteria 25099
248 Ga0268264_10001289 3300028381 Bacteria 23664
249 Ga0268264_10009266 3300028381 Bacteria 8152
250 Ga0265336_10005524 3300028666 Bacteria 4659
251 Ga0307517_10003653 3300028786 Bacteria 23914
252 Ga0307515_10000036 3300028794 Bacteria 332188
253 Ga0307511_10000734 3300030521 Bacteria 34994
254 Ga0265327_10050459 3300031251 Bacteria 2177
255 Ga0265316_10010086 3300031344 Bacteria 8632
256 Ga0307509_10065647 3300031507 Bacteria 3810
257 Ga0307508_10002368 3300031616 Bacteria 19945
258 Ga0307516_10002940 3300031730 Bacteria 22319
259 Ga0307516_10021081 3300031730 Bacteria 6718
260 Ga0307411_10012242 3300032005 Bacteria 4670
261 Ga0307507_10102124 3300033179 Bacteria 2393
262 Ga0307510_10006641 3300033180 Bacteria 13799
263 Ga0373936_0074231 3300035113 Bacteria 1407
264 Ga0373935_0176582 3300035692 Bacteria 1464
265 Ga0436365_0722843 3300039437 Bacteria 20827
266 Ga0451855_0172590 3300041511 Bacteria 6549
267 Ga0451577_0057464 3300042876 Bacteria 3468
268 Ga0451577_0343877 3300042876 Bacteria 1353
269 Ga0466972_0006495 3300044658 Bacteria 5874
270 Ga0466965_0096392 3300044683 Bacteria 1509
271 Ga0453684_0000199 3300044712 Bacteria 264155
272 Ga0453684_0009030 3300044712 Bacteria 17593
273 Ga0453684_0051631 3300044712 Bacteria 5387
274 Ga0453684_0055349 3300044712 Bacteria 5159
275 Ga0453684_0189951 3300044712 Bacteria 2404
276 Ga0453684_0344980 3300044712 Bacteria 1680
277 Ga0466971_0013802 3300044719 Bacteria 3552
278 Ga0466970_0046864 3300044765 Bacteria 2303
279 Ga0466959_0008407 3300045049 Bacteria 7296
280 Ga0451576_0017597 3300045051 Bacteria 7854
281 Ga0451576_0064570 3300045051 Bacteria 3813
282 Ga0495638_0136729 3300046460 Bacteria 1434
283 Ga0495606_0012333 3300046507 Bacteria 6868
284 Ga0495648_0011939 3300046524 Bacteria 6515
285 Ga0495611_0000021 3300046648 Bacteria 123657
286 Ga0495625_0083592 3300046660 Unclassified 2219
287 Ga0495624_0106638 3300046690 Bacteria 1724
288 Ga0495670_0102623 3300046691 Bacteria 1474
289 Ga0495674_0013442 3300047319 Bacteria 7697
290 Ga0495687_000001 3300047443 Bacteria 1215582
291 Ga0495686_0000094 3300047472 Bacteria 187720
292 Ga0496101_0042652 3300048904 Bacteria 3239
293 Ga0496109_0433654 3300048912 Unclassified 1241
294 Ga0496124_0272948 3300048927 Bacteria 1237
295 Ga0501031_0096264 3300049568 Bacteria 1932
296 Ga0501032_0008278 3300049569 Bacteria 7578
297 Ga0501032_0063388 3300049569 Bacteria 2475
298 Ga0501034_0003274 3300049571 Bacteria 18491
299 Ga0501034_0018272 3300049571 Bacteria 7191
300 Ga0501037_0009762 3300049573 Bacteria 7048
301 Ga0501038_0049949 3300049574 Bacteria 3615
302 Ga0501039_0029048 3300049575 Bacteria 4258
303 Ga0501043_0080605 3300049579 Bacteria 2558
304 Ga0501047_0051131 3300049581 Bacteria 3991
305 Ga0501069_0080313 3300049585 Bacteria 1836
306 Ga0501070_0029694 3300049586 Bacteria 4581
307 Ga0501076_0228521 3300049592 Bacteria 1521
308 Ga0501083_0058769 3300049744 Unclassified 2572
309 Ga0501035_0036432 3300049822 Bacteria 4458
310 Ga0501035_0276296 3300049822 Unclassified 1421
311 Ga0501044_0009652 3300049823 Bacteria 10499
312 Ga0501044_0079056 3300049823 Unclassified 3333
313 Ga0501284_00262 3300050005 Bacteria 2932
314 nmdc:mga09592_63466_c1 3300050508 Bacteria 3127
315 nmdc:mga06r32_4303_c1 3300050510 Bacteria 12745
316 nmdc:mga08y16_125666_c1 3300050511 Unclassified 2668
317 Ga0495619_0170648 3300053085 Bacteria 1504
318 Ga0500588_0011737 3300053146 Bacteria 2153
319 Ga0500616_0015104 3300053153 Bacteria 4424
320 Ga0500622_0016530 3300053156 Bacteria 3942
321 Ga0501084_0010875 3300054114 Bacteria 7537
322 2819586394 2818991444 Bacteria 6968812
323 Ga0068857_100001139
324 rootH2_10063783
325 rootL2_10072130
326 Ga0070658_10035269
327 Ga0070658_10071949
328 Ga0070676_10010728
329 Ga0070683_100002428
330 Ga0070670_100127230
331 Ga0070670_100135717
332 Ga0068869_100076614
333 Ga0070666_10001301
334 Ga0070666_10011699
335 Ga0070682_100001382
336 Ga0068868_100020492
337 Ga0068868_100050553
338 Ga0068868_100203510
339 Ga0070691_10022587
340 Ga0070661_100074669
341 Ga0070668_100007075
342 Ga0070668_100105130
343 Ga0070675_100036599
344 Ga0070671_100017966
345 Ga0070671_100028128
346 Ga0070673_100038609
347 Ga0070673_100110735
348 Ga0070667_100014645
349 Ga0070667_100046485
350 Ga0070667_100062247
351 Ga0070667_100141239
352 Ga0070678_100029174
353 Ga0070678_100211818
354 Ga0070681_10172106
355 Ga0068867_100007411
356 Ga0068867_100093508
357 Ga0070685_10190839
358 Ga0070679_100001124
359 Ga0070684_100030813
360 Ga0068853_100000276
361 Ga0068853_100119944
362 Ga0068853_100202811
363 Ga0068853_100285159
364 Ga0070672_100000891
365 Ga0070672_100190047
366 Ga0070693_100031296
367 Ga0070665_100000001
368 Ga0070665_100008882
369 Ga0068855_100000210
370 Ga0068855_100007690
371 Ga0068855_100297443
372 Ga0068856_100011104
373 Ga0068856_100043776
374 Ga0068856_100085700
375 Ga0068852_100059122
376 Ga0068852_100070886
377 Ga0068852_100084705
378 Ga0068852_100091475
379 Ga0068859_100000035
380 Ga0068859_100006691
381 Ga0068864_100014629
382 Ga0068864_100031790
383 Ga0068864_100074662
384 Ga0068861_100015457
385 Ga0068861_100352652
386 Ga0068861_100441212
387 Ga0068863_100000284
388 Ga0068863_100024625
389 Ga0068863_100054085
390 Ga0068863_100054921
391 Ga0068858_100004864
392 Ga0068858_100018766
393 Ga0068860_100000004
394 Ga0068860_100003394
395 Ga0068860_100003442
396 Ga0068860_100014813
397 Ga0068860_100058702
398 Ga0068862_100153288
399 Ga0081540_1033855
400 Ga0097621_100002686
401 Ga0097621_100048389
402 Ga0097621_100132746
403 Ga0068871_100000076
404 Ga0068871_100042213
405 Ga0075431_100012623
406 Ga0075429_100051259
407 Ga0068865_100016033
408 Ga0068865_100129894
409 Ga0097620_100000035
410 Ga0097620_100006691
411 Ga0105240_10002773
412 Ga0105240_10003397
413 Ga0105240_10003620
414 Ga0105240_10004711
415 Ga0105240_10006456
416 Ga0105240_10020111
417 Ga0105240_10031577
418 Ga0105240_10185091
419 Ga0105240_10291187
420 Ga0111539_10156350
421 Ga0105247_10016667
422 Ga0105247_10045869
423 Ga0105241_10000764
424 Ga0105241_10001925
425 Ga0105241_10006406
426 Ga0105241_10153590
427 Ga0105248_10026892
428 Ga0105237_10000377
429 Ga0105237_10000769
430 Ga0105237_10002457
431 Ga0105237_10013544
432 Ga0105237_10015625
433 Ga0105237_10091455
434 Ga0105237_10109711
435 Ga0105238_10004009
436 Ga0105238_10098270
437 Ga0105249_10001414
438 Ga0105249_10043592
439 Ga0105249_10052342
440 Ga0105239_10000029
441 Ga0105239_10001999
442 Ga0105239_10002549
443 Ga0105239_10022019
444 Ga0105239_10032586
445 Ga0105239_10055909
446 Ga0105239_10532889
447 Ga0105246_10206999
448 Ga0157371_10067507
449 Ga0157370_10001941
450 Ga0157370_10027949
451 Ga0157370_10154158
452 Ga0157369_10120253
453 Ga0157369_10495165
454 Ga0157374_10000001
455 Ga0157374_10012275
456 Ga0157374_10419286
457 Ga0157378_10003283
458 Ga0157378_10004321
459 Ga0157378_10017195
460 Ga0157378_10068216
461 Ga0163162_10001306
462 Ga0163162_10002251
463 Ga0163162_10004691
464 Ga0163162_10008316
465 Ga0163162_10010477
466 Ga0163162_10017201
467 Ga0163162_10029635
468 Ga0163162_10088742
469 Ga0157372_10000535
470 Ga0157372_10002089
471 Ga0157372_10068990
472 Ga0157372_10080903
473 Ga0157375_10000754
474 Ga0157375_10039500
475 Ga0157375_10075302
476 Ga0163163_10001404
477 Ga0163163_10011499
478 Ga0163163_10040998
479 Ga0163163_10079251
480 Ga0157380_10008145
481 Ga0157379_10013980
482 Ga0157379_10024022
483 Ga0157379_10113645
484 Ga0157379_10374083
485 Ga0157376_10006460
486 Ga0157376_10007810
487 Ga0157376_10008586
488 Ga0163161_10036221
489 Ga0163161_10053659
490 Ga0163161_10077167
491 Ga0213876_10001135
492 Ga0207656_10001795
493 Ga0207710_10024166
494 Ga0207680_10000133
495 Ga0207680_10005281
496 Ga0207680_10059202
497 Ga0207647_10052200
498 Ga0207645_10014460
499 Ga0207705_10004089
500 Ga0207654_10000299
501 Ga0207654_10000493
502 Ga0207707_10000121
503 Ga0207695_10000057
504 Ga0207695_10000266
505 Ga0207695_10000568
506 Ga0207695_10001216
507 Ga0207695_10009568
508 Ga0207695_10018698
509 Ga0207695_10020873
510 Ga0207695_10131001
511 Ga0207695_10223683
512 Ga0207671_10000832
513 Ga0207671_10002783
514 Ga0207671_10004167
515 Ga0207671_10005217
516 Ga0207671_10063394
517 Ga0207660_10000354
518 Ga0207652_10000561
519 Ga0207694_10049453
520 Ga0207694_10088079
521 Ga0207650_10073082
522 Ga0207650_10227715
523 Ga0207687_10207429
524 Ga0207644_10006635
525 Ga0207706_10028492
526 Ga0207704_10008934
527 Ga0207704_10112660
528 Ga0207691_10001933
529 Ga0207711_10209771
530 Ga0207689_10000344
531 Ga0207667_10000246
532 Ga0207667_10003666
533 Ga0207667_10074991
534 Ga0207667_10214274
535 Ga0207667_10225261
536 Ga0207651_10003723
537 Ga0207712_10003110
538 Ga0207712_10040007
539 Ga0207712_10183301
540 Ga0207668_10004760
541 Ga0207658_10005434
542 Ga0207658_10109928
543 Ga0207677_10003111
544 Ga0207677_10273336
545 Ga0207703_10003019
546 Ga0207703_10013009
547 Ga0207639_10005235
548 Ga0207639_10119203
549 Ga0207639_10154674
550 Ga0207639_10171871
551 Ga0207702_10043338
552 Ga0207641_10000043
553 Ga0207641_10018614
554 Ga0207641_10028096
555 Ga0207641_10056765
556 Ga0207648_10004983
557 Ga0207676_10007718
558 Ga0207674_10004668
559 Ga0207675_100038563
560 Ga0207683_10030595
561 Ga0207683_10130888
562 Ga0207683_10233714
563 Ga0207698_10020901
564 Ga0207698_10053438
565 Ga0207698_10187277
566 Ga0268266_10000065
567 Ga0268266_10004126
568 Ga0268264_10000011
569 Ga0268264_10001194
570 Ga0268264_10001289
571 Ga0268264_10009266
572 Ga0265336_10005524
573 Ga0307517_10003653
574 Ga0307515_10000036
575 Ga0307511_10000734
576 Ga0265327_10050459
577 Ga0265316_10010086
578 Ga0307509_10065647
579 Ga0307508_10002368
580 Ga0307516_10002940
581 Ga0307516_10021081
582 Ga0307411_10012242
583 Ga0307507_10102124
584 Ga0307510_10006641
585 Ga0373936_0074231
586 Ga0373935_0176582
587 Ga0436365_0722843
588 Ga0451855_0172590
589 Ga0451577_0057464
590 Ga0451577_0343877
591 Ga0466972_0006495
592 Ga0466965_0096392
593 Ga0453684_0000199
594 Ga0453684_0009030
595 Ga0453684_0051631
596 Ga0453684_0055349
597 Ga0453684_0189951
598 Ga0453684_0344980
599 Ga0466971_0013802
600 Ga0466970_0046864
601 Ga0466959_0008407
602 Ga0451576_0017597
603 Ga0451576_0064570
604 Ga0495638_0136729
605 Ga0495606_0012333
606 Ga0495648_0011939
607 Ga0495611_0000021
608 Ga0495625_0083592
609 Ga0495624_0106638
610 Ga0495670_0102623
611 Ga0495674_0013442
612 Ga0495687_000001
613 Ga0495686_0000094
614 Ga0496101_0042652
615 Ga0496109_0433654
616 Ga0496124_0272948
617 Ga0501031_0096264
618 Ga0501032_0008278
619 Ga0501032_0063388
620 Ga0501034_0003274
621 Ga0501034_0018272
622 Ga0501037_0009762
623 Ga0501038_0049949
624 Ga0501039_0029048
625 Ga0501043_0080605
626 Ga0501047_0051131
627 Ga0501069_0080313
628 Ga0501070_0029694
629 Ga0501076_0228521
630 Ga0501083_0058769
631 Ga0501035_0036432
632 Ga0501035_0276296
633 Ga0501044_0009652
634 Ga0501044_0079056
635 Ga0501284_00262
636 nmdc:mga09592_63466_c1
637 nmdc:mga06r32_4303_c1
638 nmdc:mga08y16_125666_c1
639 Ga0495619_0170648
640 Ga0500588_0011737
641 Ga0500616_0015104
642 Ga0500622_0016530
643 Ga0501084_0010875
644 2819586394

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03739

LptF_LptG

Lipopolysaccharide export system permease LptF/LptG

39

393

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7efo-assembly1.cif.gz_G lptb2fg-lps from klebsiella pneumoniae in nanodiscs 0.8721 20 379
6mi7-assembly1.cif.gz_G nucleotide-free cryo-em structure of e.coli lptb2fgc 0.8696 20 379
7efo-assembly1.cif.gz_G lptb2fg-lps from klebsiella pneumoniae in nanodiscs 0.8685 20 379
6mi7-assembly1.cif.gz_G nucleotide-free cryo-em structure of e.coli lptb2fgc 0.8661 20 379
6s8n-assembly1.cif.gz_G cryo-em structure of lptb2fgc in complex with lipopolysaccharide 0.86 20 379
ID Description Score Start End Superfamily
af_Q4D851_7_108_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.7656 208 252 2.30.30.100
af_Q0J803_1_62_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.7205 207 252 2.30.30.100
af_A4I7N8_89_167_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.7134 207 252 2.30.30.100
af_O65705_13_97_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.7118 208 250 2.30.30.100
1xmxA02 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.7098 225 252 3.40.1350.10
ID Description Score Start End GO Terms
AF-A0A4Q3UI04-F1-model_v4 LptF/LptG family permease 0.9459 170 380 GO:0015920
GO:0043190
AF-A0A7X8BXC9-F1-model_v4 YjgP/YjgQ family permease 0.9383 18 380 GO:0015920
GO:0043190
AF-F4KXM5-F1-model_v4 Permease YjgP/YjgQ family protein 0.9379 15 380 GO:0015920
GO:0043190
AF-A0A7X8BXC9-F1-model_v4 YjgP/YjgQ family permease 0.9358 18 380 GO:0015920
GO:0043190
AF-A0A842PXK1-F1-model_v4 deleted 0.9343 216 380

Map