F406322

General Info

Members Datasets Scaffolds Average Seq Length
322 182 644 394

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100031427|Ga0070714_1000314274
Length 449
Sequence LIFVGVDWAEAHHDVHVQDQDGARLGGGRLPDGVEGIARFHELAAAHADDPDQVVIGIETDRGLFVAALVAAGYQVFAVNPLSTSRYRDRHGTSGAKSDPGDAKVLADMVRTDRHNHRPVAGDSDLAGAVKVLARAHQSMIWNRRRQANQLRSVLREFYPAALAAFGDLTSGDAVEVLRVAPAPAAGQGLSRPKIAAALRRGGQQRLIEHRAGEIQAALRSPQLRAAPATEALEADFEQHPDAVVVRSLPGLGIILGARVLGEFGAEPDRYLTAKSRKNYAGTSPVTRASGTRRVVLARHTRNDRLADALYLWAFAALTASPGARAYYDQHRAAGDTHHQALRALGNRLVGILHGCLAHHTTYDETTAWGHRNRVERLTARRSHRYDRPPGRRLGRLGLRPNGLISGRGAAPCIDLAARAAIRIAKLSRALPYATPGKLPGNPRLKPSS

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
102 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
103 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
104 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
105 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
106 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
107 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
108 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
109 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
110 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
156 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
176 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
177 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.86
Nodule 0
Rhizoplane 5.28
Rhizosphere 89.75
Stem 0
Stem Tuber 0
Unclassified 4.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100031427 3300005435 Bacteria 4429
2 JGI25406J46586_10032210 3300003203 Bacteria 1950
3 rootL2_10282537 3300003322 Bacteria 1612
4 JGI25407J50210_10024161 3300003373 Bacteria 1576
5 Ga0070683_100112767 3300005329 Bacteria 2566
6 Ga0070683_100158904 3300005329 Bacteria 2144
7 Ga0070683_100158913 3300005329 Bacteria 2144
8 Ga0070683_100181926 3300005329 Bacteria 1995
9 Ga0070683_100237942 3300005329 Bacteria 1731
10 Ga0068868_100228082 3300005338 Bacteria 1562
11 Ga0070689_100164049 3300005340 Bacteria 1798
12 Ga0070673_100199505 3300005364 Bacteria 1723
13 Ga0070714_100177647 3300005435 Bacteria 1935
14 Ga0070714_100215485 3300005435 Bacteria 1762
15 Ga0070714_100243450 3300005435 Bacteria 1660
16 Ga0070713_100032446 3300005436 Bacteria 4171
17 Ga0070713_100207504 3300005436 Bacteria 1772
18 Ga0070713_100220918 3300005436 Bacteria 1719
19 Ga0070711_100119758 3300005439 Bacteria 1945
20 Ga0070708_100017033 3300005445 Bacteria 6050
21 Ga0070708_100025893 3300005445 Bacteria 5016
22 Ga0070681_10023732 3300005458 Bacteria 6173
23 Ga0070681_10025907 3300005458 Bacteria 5895
24 Ga0070681_10319679 3300005458 Bacteria 1462
25 Ga0070706_100000205 3300005467 Bacteria 74197
26 Ga0070706_100010276 3300005467 Bacteria 8696
27 Ga0070706_100019021 3300005467 Bacteria 6336
28 Ga0070706_100136321 3300005467 Bacteria 2291
29 Ga0070706_100185369 3300005467 Bacteria 1944
30 Ga0070706_100263363 3300005467 Bacteria 1609
31 Ga0070707_100001625 3300005468 Bacteria 21793
32 Ga0070707_100027389 3300005468 Bacteria 5423
33 Ga0070707_100041937 3300005468 Bacteria 4381
34 Ga0070707_100060080 3300005468 Unclassified 3645
35 Ga0070707_100060859 3300005468 Bacteria 3621
36 Ga0070707_100113484 3300005468 Bacteria 2629
37 Ga0070707_100172552 3300005468 Unclassified 2107
38 Ga0070698_100001516 3300005471 Bacteria 25740
39 Ga0070698_100011111 3300005471 Bacteria 9567
40 Ga0070698_100023577 3300005471 Bacteria 6433
41 Ga0070698_100081040 3300005471 Bacteria 3240
42 Ga0070698_100243900 3300005471 Bacteria 1730
43 Ga0070698_100265724 3300005471 Bacteria 1647
44 Ga0070698_100324916 3300005471 Bacteria 1469
45 Ga0070698_100325489 3300005471 Unclassified 1468
46 Ga0070698_100325687 3300005471 Bacteria 1467
47 Ga0070699_100175215 3300005518 Unclassified 1901
48 Ga0070679_100160527 3300005530 Bacteria 2222
49 Ga0070684_100020421 3300005535 Bacteria 5496
50 Ga0070684_100172287 3300005535 Bacteria 1966
51 Ga0070684_100172598 3300005535 Bacteria 1964
52 Ga0070684_100177612 3300005535 Bacteria 1935
53 Ga0070697_100197380 3300005536 Unclassified 1709
54 Ga0068853_100224974 3300005539 Bacteria 1715
55 Ga0070686_100167083 3300005544 Bacteria 1553
56 Ga0070695_100040405 3300005545 Bacteria 2953
57 Ga0070693_100075244 3300005547 Bacteria 1999
58 Ga0070665_100207333 3300005548 Bacteria 1961
59 Ga0070665_100277832 3300005548 Bacteria 1677
60 Ga0068855_100153039 3300005563 Bacteria 2622
61 Ga0068855_100280414 3300005563 Bacteria 1851
62 Ga0070664_100269364 3300005564 Bacteria 1534
63 Ga0068857_100143847 3300005577 Bacteria 2157
64 Ga0068856_100080373 3300005614 Bacteria 3233
65 Ga0068856_100112157 3300005614 Unclassified 2724
66 Ga0068856_100202324 3300005614 Bacteria 2000
67 Ga0068856_100309800 3300005614 Bacteria 1596
68 Ga0070702_100135418 3300005615 Bacteria 1562
69 Ga0068852_100312950 3300005616 Bacteria 1523
70 Ga0068864_100207269 3300005618 Bacteria 1803
71 Ga0068858_100143256 3300005842 Bacteria 2244
72 Ga0068860_100149382 3300005843 Bacteria 2249
73 Ga0068860_100336083 3300005843 Bacteria 1484
74 Ga0081455_10100648 3300005937 Bacteria 2321
75 Ga0081455_10113586 3300005937 Bacteria 2148
76 Ga0081455_10154353 3300005937 Bacteria 1767
77 Ga0081538_10006245 3300005981 Bacteria 10540
78 Ga0081538_10011607 3300005981 Bacteria 7123
79 Ga0081538_10016116 3300005981 Bacteria 5746
80 Ga0081538_10021055 3300005981 Bacteria 4779
81 Ga0081538_10021154 3300005981 Bacteria 4762
82 Ga0081538_10022191 3300005981 Bacteria 4608
83 Ga0081538_10024097 3300005981 Bacteria 4347
84 Ga0081538_10024869 3300005981 Bacteria 4249
85 Ga0081538_10034846 3300005981 Bacteria 3319
86 Ga0081538_10042328 3300005981 Bacteria 2876
87 Ga0081538_10104319 3300005981 Bacteria 1415
88 Ga0081539_10055019 3300005985 Bacteria 2217
89 Ga0081539_10062613 3300005985 Bacteria 2033
90 Ga0070717_10047224 3300006028 Bacteria 3526
91 Ga0070717_10070749 3300006028 Bacteria 2908
92 Ga0070717_10089017 3300006028 Bacteria 2603
93 Ga0070717_10143643 3300006028 Bacteria 2060
94 Ga0070717_10173815 3300006028 Bacteria 1875
95 Ga0070717_10235369 3300006028 Bacteria 1613
96 Ga0070717_10294103 3300006028 Bacteria 1442
97 Ga0070716_100102190 3300006173 Bacteria 1760
98 Ga0075428_100269150 3300006844 Bacteria 1833
99 Ga0075428_100303490 3300006844 Bacteria 1716
100 Ga0075430_100071045 3300006846 Bacteria 2920
101 Ga0075431_100231749 3300006847 Bacteria 1881
102 Ga0075431_100258990 3300006847 Bacteria 1766
103 Ga0075434_100319196 3300006871 Bacteria 1574
104 Ga0075429_100183703 3300006880 Bacteria 1832
105 Ga0075429_100219780 3300006880 Bacteria 1664
106 Ga0075435_100173534 3300007076 Bacteria 1820
107 Ga0099794_10040217 3300007265 Unclassified 2222
108 Ga0111539_10189721 3300009094 Bacteria 2399
109 Ga0105245_10289940 3300009098 Bacteria 1603
110 Ga0114129_10240738 3300009147 Bacteria 2432
111 Ga0114129_10291930 3300009147 Bacteria 2176
112 Ga0114129_10451851 3300009147 Bacteria 1685
113 Ga0105243_10209040 3300009148 Bacteria 1717
114 Ga0105248_10254362 3300009177 Bacteria 1977
115 Ga0105237_10222503 3300009545 Bacteria 1888
116 Ga0105238_10266238 3300009551 Bacteria 1694
117 Ga0105249_10169287 3300009553 Bacteria 2117
118 Ga0157374_10231435 3300013296 Bacteria 1815
119 Ga0157374_10267411 3300013296 Bacteria 1685
120 Ga0157372_10305875 3300013307 Bacteria 1850
121 Ga0157380_10110245 3300014326 Bacteria 2311
122 Ga0182008_10059108 3300014497 Bacteria 1892
123 Ga0157379_10190798 3300014968 Bacteria 1852
124 Ga0157376_10230597 3300014969 Bacteria 1720
125 Ga0213875_10053848 3300021388 Bacteria 1884
126 Ga0207692_10096107 3300025898 Bacteria 1617
127 Ga0207642_10005145 3300025899 Bacteria 4256
128 Ga0207688_10061879 3300025901 Bacteria 2110
129 Ga0207688_10109601 3300025901 Bacteria 1601
130 Ga0207684_10000019 3300025910 Bacteria 353902
131 Ga0207684_10000428 3300025910 Bacteria 55836
132 Ga0207684_10193446 3300025910 Bacteria 1754
133 Ga0207654_10075568 3300025911 Bacteria 2014
134 Ga0207707_10018227 3300025912 Bacteria 6119
135 Ga0207707_10037843 3300025912 Bacteria 4215
136 Ga0207695_10305988 3300025913 Bacteria 1480
137 Ga0207693_10023100 3300025915 Bacteria 4939
138 Ga0207646_10005922 3300025922 Bacteria 12756
139 Ga0207646_10008073 3300025922 Bacteria 10611
140 Ga0207646_10011372 3300025922 Bacteria 8632
141 Ga0207646_10017974 3300025922 Bacteria 6604
142 Ga0207646_10022802 3300025922 Bacteria 5758
143 Ga0207646_10212263 3300025922 Unclassified 1748
144 Ga0207646_10301814 3300025922 Unclassified 1447
145 Ga0207700_10144704 3300025928 Bacteria 1957
146 Ga0207700_10256790 3300025928 Bacteria 1495
147 Ga0207664_10077358 3300025929 Bacteria 2696
148 Ga0207664_10202048 3300025929 Bacteria 1716
149 Ga0207669_10220048 3300025937 Bacteria 1393
150 Ga0207665_10092625 3300025939 Bacteria 2097
151 Ga0207661_10165029 3300025944 Bacteria 1924
152 Ga0207661_10190793 3300025944 Bacteria 1796
153 Ga0207661_10226685 3300025944 Bacteria 1653
154 Ga0207661_10254480 3300025944 Bacteria 1562
155 Ga0207661_10261885 3300025944 Bacteria 1540
156 Ga0207667_10330938 3300025949 Bacteria 1555
157 Ga0207712_10195560 3300025961 Bacteria 1599
158 Ga0207639_10226691 3300026041 Bacteria 1617
159 Ga0207702_10032309 3300026078 Bacteria 4367
160 Ga0207702_10251133 3300026078 Bacteria 1661
161 Ga0207702_10303752 3300026078 Bacteria 1515
162 Ga0207702_10370349 3300026078 Bacteria 1375
163 Ga0207674_10012842 3300026116 Bacteria 9350
164 Ga0207428_10183334 3300027907 Bacteria 1581
165 Ga0268266_10186847 3300028379 Bacteria 1890
166 Ga0268266_10301239 3300028379 Bacteria 1495
167 Ga0268264_10003605 3300028381 Bacteria 13336
168 Ga0268264_10155709 3300028381 Bacteria 2053
169 Ga0307513_10190967 3300031456 Bacteria 1900
170 Ga0307408_100071303 3300031548 Bacteria 2568
171 Ga0307408_100231592 3300031548 Bacteria 1513
172 Ga0265314_10133253 3300031711 Bacteria 1547
173 Ga0307405_10044894 3300031731 Bacteria 2704
174 Ga0307405_10107564 3300031731 Unclassified 1883
175 Ga0307413_10059733 3300031824 Bacteria 2344
176 Ga0307413_10072940 3300031824 Bacteria 2168
177 Ga0307410_10085303 3300031852 Bacteria 2228
178 Ga0307410_10127473 3300031852 Bacteria 1865
179 Ga0307410_10208915 3300031852 Bacteria 1494
180 Ga0307407_10016720 3300031903 Bacteria 3659
181 Ga0307407_10059991 3300031903 Bacteria 2218
182 Ga0307407_10111840 3300031903 Unclassified 1716
183 Ga0307412_10121436 3300031911 Bacteria 1881
184 Ga0307412_10152073 3300031911 Bacteria 1709
185 Ga0307409_100039227 3300031995 Bacteria 3512
186 Ga0307409_100353619 3300031995 Bacteria 1387
187 Ga0307416_100000346 3300032002 Bacteria 24025
188 Ga0307416_100021993 3300032002 Bacteria 4592
189 Ga0307416_100034314 3300032002 Bacteria 3859
190 Ga0307416_100142629 3300032002 Bacteria 2180
191 Ga0307416_100169084 3300032002 Bacteria 2032
192 Ga0307414_10231564 3300032004 Bacteria 1523
193 Ga0307411_10109020 3300032005 Bacteria 1976
194 Ga0307415_100000484 3300032126 Bacteria 17226
195 Ga0307415_100023593 3300032126 Bacteria 3822
196 Ga0307415_100059945 3300032126 Bacteria 2627
197 Ga0307415_100101323 3300032126 Bacteria 2113
198 Ga0307415_100148718 3300032126 Bacteria 1799
199 Ga0307415_100171948 3300032126 Bacteria 1690
200 Ga0395900_0212310 3300037418 Bacteria 1954
201 Ga0395900_0238462 3300037418 Bacteria 1825
202 Ga0395900_0329708 3300037418 Bacteria 1504
203 Ga0395900_0337074 3300037418 Bacteria 1484
204 Ga0395898_0133770 3300037466 Bacteria 2374
205 Ga0395898_0206920 3300037466 Bacteria 1872
206 Ga0395898_0275973 3300037466 Bacteria 1603
207 Ga0395905_0092477 3300037471 Bacteria 2836
208 Ga0395905_0180424 3300037471 Bacteria 1982
209 Ga0395905_0205256 3300037471 Bacteria 1847
210 Ga0436364_0287271 3300037853 Bacteria 2372
211 Ga0395901_0101180 3300038443 Bacteria 3024
212 Ga0395901_0108608 3300038443 Bacteria 2912
213 Ga0395901_0300790 3300038443 Bacteria 1663
214 Ga0451837_1174852 3300041494 Bacteria 3092
215 Ga0439450_002062 3300042008 Bacteria 3092
216 Ga0439451_009686 3300042009 Bacteria 1948
217 Ga0439454_004448 3300042011 Unclassified 1617
218 Ga0439463_013701 3300042016 Unclassified 1997
219 Ga0439463_016574 3300042016 Bacteria 1822
220 Ga0450915_000239 3300042119 Bacteria 1703
221 Ga0450888_000972 3300042126 Bacteria 2717
222 Ga0450888_003135 3300042126 Unclassified 1661
223 Ga0439459_0017508 3300042438 Bacteria 1336
224 Ga0439460_0017260 3300042461 Unclassified 1932
225 Ga0439460_0018108 3300042461 Bacteria 1893
226 Ga0439440_0009096 3300042993 Bacteria 2051
227 Ga0439440_0016731 3300042993 Bacteria 1609
228 Ga0466972_0037274 3300044658 Bacteria 2377
229 Ga0466966_0052434 3300044684 Bacteria 2591
230 Ga0466966_0077236 3300044684 Bacteria 2078
231 Ga0466966_0113825 3300044684 Bacteria 1666
232 Ga0466961_0140806 3300044693 Bacteria 1510
233 Ga0466964_0021498 3300044706 Bacteria 2496
234 Ga0466968_0049379 3300044735 Bacteria 1792
235 Ga0466970_0036654 3300044765 Bacteria 2598
236 Ga0466957_0156984 3300044842 Bacteria 1475
237 Ga0466960_0067373 3300044901 Bacteria 1773
238 Ga0466959_0058337 3300045049 Bacteria 2811
239 Ga0466958_0139022 3300045836 Bacteria 1528
240 Ga0466967_0110123 3300045976 Bacteria 2529
241 Ga0466967_0262693 3300045976 Bacteria 1652
242 Ga0495662_0031176 3300046476 Bacteria 2575
243 Ga0495664_0086547 3300046477 Bacteria 1882
244 Ga0495606_0134511 3300046507 Bacteria 1466
245 Ga0495618_0153646 3300046514 Bacteria 1470
246 Ga0495620_0042292 3300046515 Bacteria 1991
247 Ga0495628_0155125 3300046516 Bacteria 1742
248 Ga0495630_0150853 3300046517 Bacteria 1768
249 Ga0495630_0172476 3300046517 Bacteria 1648
250 Ga0495644_0050274 3300046523 Bacteria 1565
251 Ga0495652_0176254 3300046529 Bacteria 1645
252 Ga0495640_0101875 3300046533 Bacteria 1884
253 Ga0495640_0116830 3300046533 Bacteria 1737
254 Ga0495586_0080533 3300046535 Bacteria 1789
255 Ga0495587_0107708 3300046536 Bacteria 1602
256 Ga0495645_0072537 3300046543 Bacteria 2481
257 Ga0495645_0086337 3300046543 Bacteria 2245
258 Ga0495599_0122516 3300046678 Bacteria 1616
259 Ga0495623_0063917 3300046679 Bacteria 2303
260 Ga0495624_0102554 3300046690 Bacteria 1761
261 Ga0495649_0092233 3300046694 Bacteria 1613
262 Ga0495581_0115101 3300047315 Bacteria 1564
263 Ga0495636_0042558 3300047318 Bacteria 1887
264 Ga0495674_0000190 3300047319 Bacteria 49393
265 Ga0495674_0150251 3300047319 Bacteria 1953
266 Ga0495672_0121854 3300047320 Bacteria 1385
267 Ga0495676_0167646 3300047321 Bacteria 1548
268 Ga0495602_0086576 3300048088 Bacteria 2615
269 Ga0496102_0021985 3300048905 Bacteria 5649
270 Ga0496103_0125877 3300048906 Bacteria 1634
271 Ga0496104_0255116 3300048907 Bacteria 1666
272 Ga0496105_0172722 3300048908 Bacteria 1771
273 Ga0496106_0149740 3300048909 Bacteria 1840
274 Ga0496108_0069958 3300048911 Bacteria 2961
275 Ga0496108_0081878 3300048911 Bacteria 2736
276 Ga0496108_0121062 3300048911 Bacteria 2245
277 Ga0496108_0199921 3300048911 Bacteria 1734
278 Ga0496109_0161925 3300048912 Bacteria 2096
279 Ga0496110_0043836 3300048913 Bacteria 3906
280 Ga0496110_0266130 3300048913 Bacteria 1560
281 Ga0496112_0300225 3300048915 Bacteria 1551
282 Ga0496112_0314525 3300048915 Bacteria 1511
283 Ga0496114_0124161 3300048917 Bacteria 2223
284 Ga0496114_0229701 3300048917 Bacteria 1630
285 Ga0496114_0238554 3300048917 Bacteria 1598
286 Ga0496117_0035214 3300048920 Bacteria 3760
287 Ga0496118_0000595 3300048921 Bacteria 59802
288 Ga0501033_0026187 3300049570 Bacteria 4390
289 Ga0501034_0000981 3300049571 Bacteria 41010
290 Ga0501034_0410148 3300049571 Bacteria 1277
291 Ga0501036_0095199 3300049572 Bacteria 2517
292 Ga0501039_0171334 3300049575 Bacteria 1707
293 Ga0501067_0020670 3300049583 Bacteria 3643
294 Ga0501068_0072611 3300049584 Bacteria 2101
295 Ga0501068_0113522 3300049584 Bacteria 1686
296 Ga0501070_0041742 3300049586 Bacteria 3821
297 Ga0501071_0136182 3300049587 Bacteria 1827
298 Ga0501080_0062937 3300049742 Bacteria 3453
299 Ga0501080_0163428 3300049742 Bacteria 2055
300 Ga0501080_0189071 3300049742 Bacteria 1892
301 Ga0501080_0264762 3300049742 Bacteria 1565
302 Ga0501044_0119030 3300049823 Bacteria 2643
303 nmdc:mga00v17_43834_c1 3300050491 Bacteria 2696
304 nmdc:mga07m45_93055_c1 3300050496 Bacteria 1728
305 nmdc:mga05p37_295022_c1 3300050507 Bacteria 1929
306 nmdc:mga09592_195584_c1 3300050508 Bacteria 1751
307 nmdc:mga09592_63155_c1 3300050508 Bacteria 3134
308 nmdc:mga0qj67_220210_c1 3300050509 Bacteria 1541
309 nmdc:mga06r32_241295_c1 3300050510 Bacteria 1795
310 nmdc:mga06r32_287607_c1 3300050510 Bacteria 1631
311 nmdc:mga08y16_94393_c1 3300050511 Bacteria 3116
312 nmdc:mga0n895_296691_c1 3300050512 Bacteria 1639
313 Ga0500635_0025841 3300053080 Bacteria 1853
314 Ga0500578_0138947 3300053086 Bacteria 1520
315 Ga0500604_0010027 3300053151 Bacteria 2529
316 Ga0500616_0011129 3300053153 Bacteria 5340
317 Ga0501084_0206195 3300054114 Bacteria 1659
318 Ga0590071_031380 3300059421 Bacteria 1267
319 Ga0501082_0222462 3300060353 Bacteria 1642
320 2819424728 2818991318 Bacteria 5266538
321 2819426239 2818991318 Bacteria 5266538
322 2819428679 2818991318 Bacteria 5266538
323 Ga0070714_100031427
324 JGI25406J46586_10032210
325 rootL2_10282537
326 JGI25407J50210_10024161
327 Ga0070683_100112767
328 Ga0070683_100158904
329 Ga0070683_100158913
330 Ga0070683_100181926
331 Ga0070683_100237942
332 Ga0068868_100228082
333 Ga0070689_100164049
334 Ga0070673_100199505
335 Ga0070714_100177647
336 Ga0070714_100215485
337 Ga0070714_100243450
338 Ga0070713_100032446
339 Ga0070713_100207504
340 Ga0070713_100220918
341 Ga0070711_100119758
342 Ga0070708_100017033
343 Ga0070708_100025893
344 Ga0070681_10023732
345 Ga0070681_10025907
346 Ga0070681_10319679
347 Ga0070706_100000205
348 Ga0070706_100010276
349 Ga0070706_100019021
350 Ga0070706_100136321
351 Ga0070706_100185369
352 Ga0070706_100263363
353 Ga0070707_100001625
354 Ga0070707_100027389
355 Ga0070707_100041937
356 Ga0070707_100060080
357 Ga0070707_100060859
358 Ga0070707_100113484
359 Ga0070707_100172552
360 Ga0070698_100001516
361 Ga0070698_100011111
362 Ga0070698_100023577
363 Ga0070698_100081040
364 Ga0070698_100243900
365 Ga0070698_100265724
366 Ga0070698_100324916
367 Ga0070698_100325489
368 Ga0070698_100325687
369 Ga0070699_100175215
370 Ga0070679_100160527
371 Ga0070684_100020421
372 Ga0070684_100172287
373 Ga0070684_100172598
374 Ga0070684_100177612
375 Ga0070697_100197380
376 Ga0068853_100224974
377 Ga0070686_100167083
378 Ga0070695_100040405
379 Ga0070693_100075244
380 Ga0070665_100207333
381 Ga0070665_100277832
382 Ga0068855_100153039
383 Ga0068855_100280414
384 Ga0070664_100269364
385 Ga0068857_100143847
386 Ga0068856_100080373
387 Ga0068856_100112157
388 Ga0068856_100202324
389 Ga0068856_100309800
390 Ga0070702_100135418
391 Ga0068852_100312950
392 Ga0068864_100207269
393 Ga0068858_100143256
394 Ga0068860_100149382
395 Ga0068860_100336083
396 Ga0081455_10100648
397 Ga0081455_10113586
398 Ga0081455_10154353
399 Ga0081538_10006245
400 Ga0081538_10011607
401 Ga0081538_10016116
402 Ga0081538_10021055
403 Ga0081538_10021154
404 Ga0081538_10022191
405 Ga0081538_10024097
406 Ga0081538_10024869
407 Ga0081538_10034846
408 Ga0081538_10042328
409 Ga0081538_10104319
410 Ga0081539_10055019
411 Ga0081539_10062613
412 Ga0070717_10047224
413 Ga0070717_10070749
414 Ga0070717_10089017
415 Ga0070717_10143643
416 Ga0070717_10173815
417 Ga0070717_10235369
418 Ga0070717_10294103
419 Ga0070716_100102190
420 Ga0075428_100269150
421 Ga0075428_100303490
422 Ga0075430_100071045
423 Ga0075431_100231749
424 Ga0075431_100258990
425 Ga0075434_100319196
426 Ga0075429_100183703
427 Ga0075429_100219780
428 Ga0075435_100173534
429 Ga0099794_10040217
430 Ga0111539_10189721
431 Ga0105245_10289940
432 Ga0114129_10240738
433 Ga0114129_10291930
434 Ga0114129_10451851
435 Ga0105243_10209040
436 Ga0105248_10254362
437 Ga0105237_10222503
438 Ga0105238_10266238
439 Ga0105249_10169287
440 Ga0157374_10231435
441 Ga0157374_10267411
442 Ga0157372_10305875
443 Ga0157380_10110245
444 Ga0182008_10059108
445 Ga0157379_10190798
446 Ga0157376_10230597
447 Ga0213875_10053848
448 Ga0207692_10096107
449 Ga0207642_10005145
450 Ga0207688_10061879
451 Ga0207688_10109601
452 Ga0207684_10000019
453 Ga0207684_10000428
454 Ga0207684_10193446
455 Ga0207654_10075568
456 Ga0207707_10018227
457 Ga0207707_10037843
458 Ga0207695_10305988
459 Ga0207693_10023100
460 Ga0207646_10005922
461 Ga0207646_10008073
462 Ga0207646_10011372
463 Ga0207646_10017974
464 Ga0207646_10022802
465 Ga0207646_10212263
466 Ga0207646_10301814
467 Ga0207700_10144704
468 Ga0207700_10256790
469 Ga0207664_10077358
470 Ga0207664_10202048
471 Ga0207669_10220048
472 Ga0207665_10092625
473 Ga0207661_10165029
474 Ga0207661_10190793
475 Ga0207661_10226685
476 Ga0207661_10254480
477 Ga0207661_10261885
478 Ga0207667_10330938
479 Ga0207712_10195560
480 Ga0207639_10226691
481 Ga0207702_10032309
482 Ga0207702_10251133
483 Ga0207702_10303752
484 Ga0207702_10370349
485 Ga0207674_10012842
486 Ga0207428_10183334
487 Ga0268266_10186847
488 Ga0268266_10301239
489 Ga0268264_10003605
490 Ga0268264_10155709
491 Ga0307513_10190967
492 Ga0307408_100071303
493 Ga0307408_100231592
494 Ga0265314_10133253
495 Ga0307405_10044894
496 Ga0307405_10107564
497 Ga0307413_10059733
498 Ga0307413_10072940
499 Ga0307410_10085303
500 Ga0307410_10127473
501 Ga0307410_10208915
502 Ga0307407_10016720
503 Ga0307407_10059991
504 Ga0307407_10111840
505 Ga0307412_10121436
506 Ga0307412_10152073
507 Ga0307409_100039227
508 Ga0307409_100353619
509 Ga0307416_100000346
510 Ga0307416_100021993
511 Ga0307416_100034314
512 Ga0307416_100142629
513 Ga0307416_100169084
514 Ga0307414_10231564
515 Ga0307411_10109020
516 Ga0307415_100000484
517 Ga0307415_100023593
518 Ga0307415_100059945
519 Ga0307415_100101323
520 Ga0307415_100148718
521 Ga0307415_100171948
522 Ga0395900_0212310
523 Ga0395900_0238462
524 Ga0395900_0329708
525 Ga0395900_0337074
526 Ga0395898_0133770
527 Ga0395898_0206920
528 Ga0395898_0275973
529 Ga0395905_0092477
530 Ga0395905_0180424
531 Ga0395905_0205256
532 Ga0436364_0287271
533 Ga0395901_0101180
534 Ga0395901_0108608
535 Ga0395901_0300790
536 Ga0451837_1174852
537 Ga0439450_002062
538 Ga0439451_009686
539 Ga0439454_004448
540 Ga0439463_013701
541 Ga0439463_016574
542 Ga0450915_000239
543 Ga0450888_000972
544 Ga0450888_003135
545 Ga0439459_0017508
546 Ga0439460_0017260
547 Ga0439460_0018108
548 Ga0439440_0009096
549 Ga0439440_0016731
550 Ga0466972_0037274
551 Ga0466966_0052434
552 Ga0466966_0077236
553 Ga0466966_0113825
554 Ga0466961_0140806
555 Ga0466964_0021498
556 Ga0466968_0049379
557 Ga0466970_0036654
558 Ga0466957_0156984
559 Ga0466960_0067373
560 Ga0466959_0058337
561 Ga0466958_0139022
562 Ga0466967_0110123
563 Ga0466967_0262693
564 Ga0495662_0031176
565 Ga0495664_0086547
566 Ga0495606_0134511
567 Ga0495618_0153646
568 Ga0495620_0042292
569 Ga0495628_0155125
570 Ga0495630_0150853
571 Ga0495630_0172476
572 Ga0495644_0050274
573 Ga0495652_0176254
574 Ga0495640_0101875
575 Ga0495640_0116830
576 Ga0495586_0080533
577 Ga0495587_0107708
578 Ga0495645_0072537
579 Ga0495645_0086337
580 Ga0495599_0122516
581 Ga0495623_0063917
582 Ga0495624_0102554
583 Ga0495649_0092233
584 Ga0495581_0115101
585 Ga0495636_0042558
586 Ga0495674_0000190
587 Ga0495674_0150251
588 Ga0495672_0121854
589 Ga0495676_0167646
590 Ga0495602_0086576
591 Ga0496102_0021985
592 Ga0496103_0125877
593 Ga0496104_0255116
594 Ga0496105_0172722
595 Ga0496106_0149740
596 Ga0496108_0069958
597 Ga0496108_0081878
598 Ga0496108_0121062
599 Ga0496108_0199921
600 Ga0496109_0161925
601 Ga0496110_0043836
602 Ga0496110_0266130
603 Ga0496112_0300225
604 Ga0496112_0314525
605 Ga0496114_0124161
606 Ga0496114_0229701
607 Ga0496114_0238554
608 Ga0496117_0035214
609 Ga0496118_0000595
610 Ga0501033_0026187
611 Ga0501034_0000981
612 Ga0501034_0410148
613 Ga0501036_0095199
614 Ga0501039_0171334
615 Ga0501067_0020670
616 Ga0501068_0072611
617 Ga0501068_0113522
618 Ga0501070_0041742
619 Ga0501071_0136182
620 Ga0501080_0062937
621 Ga0501080_0163428
622 Ga0501080_0189071
623 Ga0501080_0264762
624 Ga0501044_0119030
625 nmdc:mga00v17_43834_c1
626 nmdc:mga07m45_93055_c1
627 nmdc:mga05p37_295022_c1
628 nmdc:mga09592_195584_c1
629 nmdc:mga09592_63155_c1
630 nmdc:mga0qj67_220210_c1
631 nmdc:mga06r32_241295_c1
632 nmdc:mga06r32_287607_c1
633 nmdc:mga08y16_94393_c1
634 nmdc:mga0n895_296691_c1
635 Ga0500635_0025841
636 Ga0500578_0138947
637 Ga0500604_0010027
638 Ga0500616_0011129
639 Ga0501084_0206195
640 Ga0590071_031380
641 Ga0501082_0222462
642 2819424728
643 2819426239
644 2819428679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02371

Transposase_20

Transposase IS116/IS110/IS902 family

243

329

0.96

PF01548

DEDD_Tnp_IS110

Transposase

4

160

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j9e-assembly1.cif.gz_J cryo-em structure of xanthomonos oryzae transcription elongation complex with nusa and the bacteriophage protein p7 0.7505 3 50
1bu6-assembly1.cif.gz_Z crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation 0.7427 2 58
3ezw-assembly2.cif.gz_D crystal structure of a hyperactive escherichia coli glycerol kinase mutant gly230 --> asp obtained using microfluidic crystallization devices 0.7398 2 58
3ll3-assembly1.cif.gz_B the crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus 0.7382 2 57
3ezw-assembly2.cif.gz_H crystal structure of a hyperactive escherichia coli glycerol kinase mutant gly230 --> asp obtained using microfluidic crystallization devices 0.7343 2 58
ID Description Score Start End Superfamily
af_K7KQ43_71_310_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.875 2 30 3.60.21.10
af_E7FFG0_8_119_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8059 4 32 2.30.29.30
af_A0A1D8PMB3_8_308_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7949 2 31 3.30.420.40
4bc2A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7928 4 31 3.30.420.40
af_O07182_4_158_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7854 5 157 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A6N7C6T6-F1-model_v4 IS110 family transposase ISMpa1 0.9471 1 290 GO:0003677
GO:0004803
GO:0006313
AF-A0A2N3SJE2-F1-model_v4 deleted 0.9443 127 403
AF-A0A7K3LX25-F1-model_v4 IS110 family transposase 0.9412 1 303 GO:0003677
GO:0004803
GO:0006313
AF-A0A7R7TV56-F1-model_v4 deleted 0.9335 242 401
AF-A0A239LVT7-F1-model_v4 Transposase 0.9334 2 278 GO:0003677
GO:0004803
GO:0006313

Map