F406303
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 322 | 222 | 322 | 332 |
Family's Representative Sequence
| Representative Sequence | 3300005335|Ga0070666_10197935|Ga0070666_101979352 |
| Length | 365 |
| Sequence | MQNSAEHLGPGPIGDDDTPAFARLADLASARVGGRTLDASDDFFAPRSNLLKPQPPIFVPGKFTSRGKWMDGWESRRKRTPGHDWCVIRLGLRGAVRGVDVDTSFFVGNHPSQCSIDALDHARPLTPSIAGRLGAPWVTILDRSPLNGNSHNYFAIDAGGANRADGSPPAAQPGPAWTHLRLNIYPDGGVARFRAYGDVILDWTDLATTRRSVDLASIRNGGRVIAASDMHFGAVGNMLMPDRAANMGDGWETRRRRGPGHDWAVVRLGAPGLLTRIEIDTNHFKGNYPDRATVEGCLVPSNEVAAMDIAGWFPVLPETKLRAHHRHLFSRELLPSGPVSHVRLNIFPDGGVSRLRVHGIVAPAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 121 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 125 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 126 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 127 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 128 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 129 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 130 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 135 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 136 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 137 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 138 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 139 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 140 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 141 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 143 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 144 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 145 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 147 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 148 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 149 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 150 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 151 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 152 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 154 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 155 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 156 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 157 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 179 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 180 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 181 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 182 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 184 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 185 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 186 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 194 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 195 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 196 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 197 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 198 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 199 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 200 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 201 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 202 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 205 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 215 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 216 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 217 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 218 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 219 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 220 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 221 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 222 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.48 |
| Nodule | 0 |
| Rhizoplane | 2.8 |
| Rhizosphere | 94.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2891936 | 2162886007 | Unclassified | 3434 |
| 2 | JGI24744J21845_10010659 | 3300002077 | Bacteria | 1882 |
| 3 | JGI24751J29686_10000010 | 3300002459 | Bacteria | 124816 |
| 4 | Ga0065165_1002490 | 3300005262 | Bacteria | 15444 |
| 5 | Ga0065704_10005815 | 3300005289 | Bacteria | 2753 |
| 6 | Ga0065715_10000428 | 3300005293 | Bacteria | 13809 |
| 7 | Ga0065715_10141237 | 3300005293 | Bacteria | 1851 |
| 8 | Ga0065707_10162539 | 3300005295 | Bacteria | 1551 |
| 9 | Ga0070676_10049292 | 3300005328 | Bacteria | 2465 |
| 10 | Ga0070690_100010451 | 3300005330 | Bacteria | 5403 |
| 11 | Ga0070670_100000172 | 3300005331 | Bacteria | 58670 |
| 12 | Ga0070670_100001104 | 3300005331 | Bacteria | 21445 |
| 13 | Ga0070670_100024053 | 3300005331 | Bacteria | 5240 |
| 14 | Ga0070666_10002969 | 3300005335 | Bacteria | 10287 |
| 15 | Ga0070666_10167939 | 3300005335 | Bacteria | 1536 |
| 16 | Ga0070666_10197935 | 3300005335 | Bacteria | 1413 |
| 17 | Ga0070682_100001017 | 3300005337 | Bacteria | 16243 |
| 18 | Ga0068868_100111046 | 3300005338 | Bacteria | 2228 |
| 19 | Ga0068868_100267717 | 3300005338 | Bacteria | 1443 |
| 20 | Ga0070687_100004547 | 3300005343 | Bacteria | 5542 |
| 21 | Ga0070687_100072647 | 3300005343 | Bacteria | 1852 |
| 22 | Ga0070692_10058412 | 3300005345 | Unclassified | 2026 |
| 23 | Ga0070668_100000444 | 3300005347 | Bacteria | 27368 |
| 24 | Ga0070669_100004745 | 3300005353 | Bacteria | 9800 |
| 25 | Ga0070669_100013244 | 3300005353 | Bacteria | 5862 |
| 26 | Ga0070675_100249148 | 3300005354 | Bacteria | 1554 |
| 27 | Ga0070671_100085981 | 3300005355 | Bacteria | 2631 |
| 28 | Ga0070674_100016582 | 3300005356 | Bacteria | 4618 |
| 29 | Ga0070688_100109139 | 3300005365 | Bacteria | 1837 |
| 30 | Ga0070659_100007802 | 3300005366 | Bacteria | 7786 |
| 31 | Ga0070659_100056305 | 3300005366 | Bacteria | 3101 |
| 32 | Ga0070667_100405323 | 3300005367 | Bacteria | 1242 |
| 33 | Ga0070701_10020120 | 3300005438 | Bacteria | 3164 |
| 34 | Ga0070705_100003079 | 3300005440 | Bacteria | 8207 |
| 35 | Ga0070700_100039749 | 3300005441 | Bacteria | 2875 |
| 36 | Ga0070694_100011976 | 3300005444 | Bacteria | 5383 |
| 37 | Ga0070662_100120723 | 3300005457 | Bacteria | 2008 |
| 38 | Ga0068867_100047274 | 3300005459 | Bacteria | 3163 |
| 39 | Ga0070685_10002474 | 3300005466 | Bacteria | 9489 |
| 40 | Ga0070699_100125875 | 3300005518 | Bacteria | 2256 |
| 41 | Ga0070684_100004637 | 3300005535 | Bacteria | 10486 |
| 42 | Ga0068853_100035071 | 3300005539 | Bacteria | 4260 |
| 43 | Ga0068853_100086098 | 3300005539 | Bacteria | 2755 |
| 44 | Ga0070672_100012865 | 3300005543 | Bacteria | 5895 |
| 45 | Ga0070672_100019134 | 3300005543 | Bacteria | 4964 |
| 46 | Ga0070686_100002631 | 3300005544 | Bacteria | 9903 |
| 47 | Ga0070686_100075805 | 3300005544 | Bacteria | 2213 |
| 48 | Ga0070695_100021902 | 3300005545 | Bacteria | 3915 |
| 49 | Ga0070695_100209716 | 3300005545 | Bacteria | 1397 |
| 50 | Ga0070693_100011930 | 3300005547 | Bacteria | 4385 |
| 51 | Ga0070693_100012938 | 3300005547 | Unclassified | 4237 |
| 52 | Ga0070665_100000351 | 3300005548 | Bacteria | 69230 |
| 53 | Ga0070665_100027861 | 3300005548 | Bacteria | 5690 |
| 54 | Ga0070665_100070208 | 3300005548 | Bacteria | 3510 |
| 55 | Ga0070704_100126237 | 3300005549 | Bacteria | 1975 |
| 56 | Ga0070664_100382810 | 3300005564 | Bacteria | 1284 |
| 57 | Ga0070664_100449811 | 3300005564 | Bacteria | 1182 |
| 58 | Ga0068857_100004471 | 3300005577 | Bacteria | 11819 |
| 59 | Ga0068857_100026841 | 3300005577 | Bacteria | 5078 |
| 60 | Ga0068857_100199538 | 3300005577 | Bacteria | 1823 |
| 61 | Ga0068854_100103648 | 3300005578 | Bacteria | 2136 |
| 62 | Ga0068854_100108340 | 3300005578 | Bacteria | 2092 |
| 63 | Ga0068854_100145798 | 3300005578 | Bacteria | 1821 |
| 64 | Ga0070702_100000912 | 3300005615 | Bacteria | 11541 |
| 65 | Ga0070702_100012927 | 3300005615 | Bacteria | 4202 |
| 66 | Ga0070702_100242253 | 3300005615 | Bacteria | 1218 |
| 67 | Ga0068859_100123208 | 3300005617 | Bacteria | 2660 |
| 68 | Ga0068859_100213736 | 3300005617 | Bacteria | 2015 |
| 69 | Ga0068859_100229435 | 3300005617 | Bacteria | 1944 |
| 70 | Ga0068864_100190913 | 3300005618 | Bacteria | 1878 |
| 71 | Ga0068861_100031826 | 3300005719 | Bacteria | 3879 |
| 72 | Ga0068851_10003596 | 3300005834 | Bacteria | 6910 |
| 73 | Ga0068851_10081486 | 3300005834 | Bacteria | 1691 |
| 74 | Ga0068870_10002385 | 3300005840 | Bacteria | 7816 |
| 75 | Ga0068863_100070252 | 3300005841 | Bacteria | 3311 |
| 76 | Ga0068863_100169775 | 3300005841 | Unclassified | 2092 |
| 77 | Ga0068858_100117549 | 3300005842 | Unclassified | 2485 |
| 78 | Ga0068858_100121790 | 3300005842 | Bacteria | 2440 |
| 79 | Ga0068858_100126548 | 3300005842 | Bacteria | 2393 |
| 80 | Ga0068858_100132637 | 3300005842 | Bacteria | 2337 |
| 81 | Ga0068860_100054702 | 3300005843 | Bacteria | 3793 |
| 82 | Ga0068860_100069876 | 3300005843 | Unclassified | 3338 |
| 83 | Ga0068860_100477600 | 3300005843 | Bacteria | 1242 |
| 84 | Ga0068862_100002846 | 3300005844 | Bacteria | 15171 |
| 85 | Ga0068862_100095604 | 3300005844 | Bacteria | 2592 |
| 86 | Ga0068862_100434471 | 3300005844 | Bacteria | 1234 |
| 87 | Ga0081539_10001827 | 3300005985 | Bacteria | 33597 |
| 88 | Ga0097621_100005658 | 3300006237 | Bacteria | 8821 |
| 89 | Ga0097621_100030984 | 3300006237 | Bacteria | 4240 |
| 90 | Ga0068871_100071318 | 3300006358 | Bacteria | 2857 |
| 91 | Ga0075428_100008473 | 3300006844 | Bacteria | 11405 |
| 92 | Ga0075431_100030722 | 3300006847 | Bacteria | 5534 |
| 93 | Ga0075431_100320267 | 3300006847 | Unclassified | 1564 |
| 94 | Ga0075433_10014226 | 3300006852 | Bacteria | 6497 |
| 95 | Ga0075433_10054476 | 3300006852 | Bacteria | 3490 |
| 96 | Ga0075434_100009945 | 3300006871 | Bacteria | 8899 |
| 97 | Ga0075429_100066448 | 3300006880 | Unclassified | 3139 |
| 98 | Ga0068865_100021287 | 3300006881 | Bacteria | 4215 |
| 99 | Ga0075436_100091135 | 3300006914 | Bacteria | 2119 |
| 100 | Ga0097620_100123215 | 3300006931 | Bacteria | 2660 |
| 101 | Ga0097620_100213736 | 3300006931 | Bacteria | 2015 |
| 102 | Ga0097620_100229449 | 3300006931 | Bacteria | 1944 |
| 103 | Ga0097620_100632591 | 3300006931 | Bacteria | 1162 |
| 104 | Ga0075435_100001160 | 3300007076 | Bacteria | 16819 |
| 105 | Ga0105240_10054655 | 3300009093 | Bacteria | 5003 |
| 106 | Ga0105240_10059839 | 3300009093 | Bacteria | 4752 |
| 107 | Ga0111539_10003668 | 3300009094 | Bacteria | 20222 |
| 108 | Ga0111539_10046527 | 3300009094 | Bacteria | 5189 |
| 109 | Ga0111539_10488141 | 3300009094 | Bacteria | 1435 |
| 110 | Ga0114129_10059999 | 3300009147 | Bacteria | 5318 |
| 111 | Ga0114129_10221219 | 3300009147 | Bacteria | 2554 |
| 112 | Ga0114129_10542535 | 3300009147 | Unclassified | 1513 |
| 113 | Ga0105243_10045610 | 3300009148 | Bacteria | 3445 |
| 114 | Ga0105242_10079558 | 3300009176 | Bacteria | 2737 |
| 115 | Ga0105242_10335779 | 3300009176 | Bacteria | 1391 |
| 116 | Ga0105248_10035292 | 3300009177 | Bacteria | 5594 |
| 117 | Ga0105248_10072879 | 3300009177 | Bacteria | 3860 |
| 118 | Ga0105248_10079503 | 3300009177 | Bacteria | 3685 |
| 119 | Ga0105237_10000264 | 3300009545 | Bacteria | 73957 |
| 120 | Ga0105237_10153032 | 3300009545 | Bacteria | 2303 |
| 121 | Ga0105238_10027419 | 3300009551 | Bacteria | 5804 |
| 122 | Ga0105249_10001951 | 3300009553 | Bacteria | 17896 |
| 123 | Ga0105249_10007691 | 3300009553 | Bacteria | 9390 |
| 124 | Ga0105239_10172341 | 3300010375 | Bacteria | 2420 |
| 125 | Ga0157373_10046217 | 3300013100 | Unclassified | 3106 |
| 126 | Ga0157378_10430108 | 3300013297 | Bacteria | 1306 |
| 127 | Ga0163162_10072903 | 3300013306 | Bacteria | 3489 |
| 128 | Ga0157372_10368188 | 3300013307 | Bacteria | 1674 |
| 129 | Ga0157375_10062300 | 3300013308 | Bacteria | 3706 |
| 130 | Ga0163163_10000172 | 3300014325 | Bacteria | 67754 |
| 131 | Ga0163163_10181568 | 3300014325 | Bacteria | 2151 |
| 132 | Ga0157380_10008320 | 3300014326 | Bacteria | 7395 |
| 133 | Ga0157380_10013385 | 3300014326 | Bacteria | 5979 |
| 134 | Ga0157380_10079432 | 3300014326 | Bacteria | 2679 |
| 135 | Ga0157380_10521856 | 3300014326 | Unclassified | 1159 |
| 136 | Ga0157377_10009350 | 3300014745 | Bacteria | 4805 |
| 137 | Ga0157379_10030360 | 3300014968 | Bacteria | 4811 |
| 138 | Ga0207697_10000087 | 3300025315 | Bacteria | 41336 |
| 139 | Ga0207656_10012051 | 3300025321 | Bacteria | 3281 |
| 140 | Ga0207688_10002523 | 3300025901 | Bacteria | 9871 |
| 141 | Ga0207688_10204466 | 3300025901 | Bacteria | 1185 |
| 142 | Ga0207680_10078891 | 3300025903 | Bacteria | 2063 |
| 143 | Ga0207647_10009523 | 3300025904 | Bacteria | 6897 |
| 144 | Ga0207645_10000687 | 3300025907 | Bacteria | 28066 |
| 145 | Ga0207643_10006127 | 3300025908 | Bacteria | 6433 |
| 146 | Ga0207695_10120177 | 3300025913 | Bacteria | 2596 |
| 147 | Ga0207671_10001408 | 3300025914 | Bacteria | 27992 |
| 148 | Ga0207693_10095906 | 3300025915 | Bacteria | 2325 |
| 149 | Ga0207662_10018722 | 3300025918 | Bacteria | 3933 |
| 150 | Ga0207662_10093692 | 3300025918 | Bacteria | 1851 |
| 151 | Ga0207657_10103884 | 3300025919 | Bacteria | 2355 |
| 152 | Ga0207681_10028029 | 3300025923 | Bacteria | 3646 |
| 153 | Ga0207694_10026028 | 3300025924 | Bacteria | 4449 |
| 154 | Ga0207694_10042113 | 3300025924 | Bacteria | 3521 |
| 155 | Ga0207650_10000001 | 3300025925 | Bacteria | 1545726 |
| 156 | Ga0207706_10003592 | 3300025933 | Bacteria | 14811 |
| 157 | Ga0207706_10039843 | 3300025933 | Bacteria | 4165 |
| 158 | Ga0207706_10355036 | 3300025933 | Bacteria | 1274 |
| 159 | Ga0207706_10359730 | 3300025933 | Bacteria | 1265 |
| 160 | Ga0207686_10053694 | 3300025934 | Bacteria | 2521 |
| 161 | Ga0207709_10005752 | 3300025935 | Bacteria | 7003 |
| 162 | Ga0207669_10025638 | 3300025937 | Bacteria | 3191 |
| 163 | Ga0207669_10132009 | 3300025937 | Bacteria | 1718 |
| 164 | Ga0207691_10002827 | 3300025940 | Bacteria | 16911 |
| 165 | Ga0207691_10107965 | 3300025940 | Bacteria | 2477 |
| 166 | Ga0207691_10161139 | 3300025940 | Bacteria | 1968 |
| 167 | Ga0207711_10050880 | 3300025941 | Bacteria | 3547 |
| 168 | Ga0207711_10082160 | 3300025941 | Bacteria | 2816 |
| 169 | Ga0207711_10232376 | 3300025941 | Bacteria | 1689 |
| 170 | Ga0207689_10020102 | 3300025942 | Bacteria | 5622 |
| 171 | Ga0207667_10054525 | 3300025949 | Bacteria | 4205 |
| 172 | Ga0207712_10005418 | 3300025961 | Bacteria | 8051 |
| 173 | Ga0207712_10039760 | 3300025961 | Bacteria | 3224 |
| 174 | Ga0207640_10018492 | 3300025981 | Bacteria | 4097 |
| 175 | Ga0207640_10043227 | 3300025981 | Bacteria | 2879 |
| 176 | Ga0207658_10045750 | 3300025986 | Bacteria | 3192 |
| 177 | Ga0207677_10011384 | 3300026023 | Bacteria | 5070 |
| 178 | Ga0207703_10105232 | 3300026035 | Bacteria | 2398 |
| 179 | Ga0207703_10153438 | 3300026035 | Unclassified | 2010 |
| 180 | Ga0207708_10012873 | 3300026075 | Bacteria | 6240 |
| 181 | Ga0207708_10024302 | 3300026075 | Bacteria | 4583 |
| 182 | Ga0207702_10199503 | 3300026078 | Bacteria | 1854 |
| 183 | Ga0207641_10151226 | 3300026088 | Unclassified | 2102 |
| 184 | Ga0207648_10025319 | 3300026089 | Bacteria | 5288 |
| 185 | Ga0207676_10119786 | 3300026095 | Bacteria | 2217 |
| 186 | Ga0207676_10202756 | 3300026095 | Bacteria | 1754 |
| 187 | Ga0207674_10005242 | 3300026116 | Bacteria | 15432 |
| 188 | Ga0207674_10022334 | 3300026116 | Bacteria | 6794 |
| 189 | Ga0207674_10135909 | 3300026116 | Bacteria | 2420 |
| 190 | Ga0207675_100006707 | 3300026118 | Bacteria | 10886 |
| 191 | Ga0207675_100033008 | 3300026118 | Bacteria | 4823 |
| 192 | Ga0207698_10100248 | 3300026142 | Bacteria | 2398 |
| 193 | Ga0207428_10030144 | 3300027907 | Unclassified | 4487 |
| 194 | Ga0268266_10000653 | 3300028379 | Bacteria | 46973 |
| 195 | Ga0268266_10007630 | 3300028379 | Bacteria | 9731 |
| 196 | Ga0268265_10006088 | 3300028380 | Bacteria | 8191 |
| 197 | Ga0268264_10045652 | 3300028381 | Plasmid | 3638 |
| 198 | Ga0268264_10318261 | 3300028381 | Bacteria | 1470 |
| 199 | Ga0268264_10494456 | 3300028381 | Bacteria | 1192 |
| 200 | Ga0265338_10026813 | 3300028800 | Bacteria | 5799 |
| 201 | Ga0307408_100037335 | 3300031548 | Bacteria | 3421 |
| 202 | Ga0307508_10007195 | 3300031616 | Bacteria | 10362 |
| 203 | Ga0307405_10032560 | 3300031731 | Bacteria | 3082 |
| 204 | Ga0307405_10124370 | 3300031731 | Bacteria | 1771 |
| 205 | Ga0307413_10002275 | 3300031824 | Bacteria | 7760 |
| 206 | Ga0307413_10095989 | 3300031824 | Bacteria | 1945 |
| 207 | Ga0307410_10012270 | 3300031852 | Bacteria | 4946 |
| 208 | Ga0307407_10012140 | 3300031903 | Bacteria | 4130 |
| 209 | Ga0307412_10004400 | 3300031911 | Bacteria | 7851 |
| 210 | Ga0307409_100022376 | 3300031995 | Bacteria | 4357 |
| 211 | Ga0307409_100436524 | 3300031995 | Bacteria | 1260 |
| 212 | Ga0307416_100015007 | 3300032002 | Bacteria | 5333 |
| 213 | Ga0307416_100025129 | 3300032002 | Bacteria | 4362 |
| 214 | Ga0307416_100051469 | 3300032002 | Bacteria | 3290 |
| 215 | Ga0307416_100097645 | 3300032002 | Bacteria | 2545 |
| 216 | Ga0307414_10037827 | 3300032004 | Bacteria | 3234 |
| 217 | Ga0307411_10006725 | 3300032005 | Bacteria | 5780 |
| 218 | Ga0307411_10048627 | 3300032005 | Unclassified | 2750 |
| 219 | Ga0307415_100003439 | 3300032126 | Bacteria | 8055 |
| 220 | Ga0307415_100007170 | 3300032126 | Bacteria | 6077 |
| 221 | Ga0373959_0005433 | 3300034820 | Bacteria | 2088 |
| 222 | Ga0373929_0000553 | 3300035085 | Bacteria | 7202 |
| 223 | Ga0373940_0051430 | 3300035088 | Bacteria | 1158 |
| 224 | Ga0373952_0002056 | 3300035092 | Bacteria | 3623 |
| 225 | Ga0373932_0003135 | 3300035112 | Bacteria | 4026 |
| 226 | Ga0373939_0001444 | 3300035114 | Bacteria | 5752 |
| 227 | Ga0373960_0002783 | 3300035121 | Bacteria | 3961 |
| 228 | Ga0373955_0000640 | 3300035172 | Bacteria | 14958 |
| 229 | Ga0373942_0002249 | 3300035207 | Bacteria | 4734 |
| 230 | Ga0373961_0005819 | 3300035241 | Bacteria | 2961 |
| 231 | Ga0373962_0031237 | 3300035242 | Bacteria | 1460 |
| 232 | Ga0373924_0031043 | 3300035410 | Bacteria | 2146 |
| 233 | Ga0373931_0038463 | 3300035691 | Bacteria | 2502 |
| 234 | Ga0373935_0019258 | 3300035692 | Bacteria | 4163 |
| 235 | Ga0373927_0000419 | 3300035695 | Bacteria | 32608 |
| 236 | Ga0373927_0184236 | 3300035695 | Bacteria | 1370 |
| 237 | Ga0373927_0223067 | 3300035695 | Bacteria | 1238 |
| 238 | Ga0373925_0013435 | 3300037068 | Bacteria | 5926 |
| 239 | Ga0373925_0038478 | 3300037068 | Bacteria | 3537 |
| 240 | Ga0439457_049780 | 3300042014 | Bacteria | 940 |
| 241 | Ga0439460_0030572 | 3300042461 | Bacteria | 1532 |
| 242 | Ga0466965_0094085 | 3300044683 | Bacteria | 1527 |
| 243 | Ga0451576_0006871 | 3300045051 | Bacteria | 13784 |
| 244 | Ga0451576_0065554 | 3300045051 | Bacteria | 3781 |
| 245 | Ga0495603_0093997 | 3300046455 | Bacteria | 1752 |
| 246 | Ga0495629_0028912 | 3300046459 | Bacteria | 3935 |
| 247 | Ga0495629_0204216 | 3300046459 | Bacteria | 1366 |
| 248 | Ga0495638_0000953 | 3300046460 | Bacteria | 29358 |
| 249 | Ga0495605_0001474 | 3300046474 | Bacteria | 15363 |
| 250 | Ga0495583_0012759 | 3300046506 | Bacteria | 4732 |
| 251 | Ga0495630_0098562 | 3300046517 | Bacteria | 2211 |
| 252 | Ga0495631_0012885 | 3300046518 | Bacteria | 4071 |
| 253 | Ga0495632_0013526 | 3300046519 | Bacteria | 4654 |
| 254 | Ga0495586_0003006 | 3300046535 | Bacteria | 9094 |
| 255 | Ga0495609_0008203 | 3300046538 | Bacteria | 5126 |
| 256 | Ga0495668_0003159 | 3300046616 | Bacteria | 12699 |
| 257 | Ga0495625_0005331 | 3300046660 | Bacteria | 11778 |
| 258 | Ga0495657_0084752 | 3300046675 | Bacteria | 2044 |
| 259 | Ga0495623_0145679 | 3300046679 | Bacteria | 1405 |
| 260 | Ga0495658_0172067 | 3300046683 | Bacteria | 1341 |
| 261 | Ga0495670_0003394 | 3300046691 | Bacteria | 7829 |
| 262 | Ga0495660_0032206 | 3300046810 | Bacteria | 2944 |
| 263 | Ga0495674_0233067 | 3300047319 | Bacteria | 1519 |
| 264 | Ga0495674_0274571 | 3300047319 | Bacteria | 1382 |
| 265 | Ga0495672_0002520 | 3300047320 | Bacteria | 16725 |
| 266 | Ga0495684_0303851 | 3300047471 | Bacteria | 1145 |
| 267 | Ga0495602_0028061 | 3300048088 | Bacteria | 5396 |
| 268 | Ga0496102_0374832 | 3300048905 | Bacteria | 1339 |
| 269 | Ga0496103_0070617 | 3300048906 | Bacteria | 2185 |
| 270 | Ga0496105_0098815 | 3300048908 | Bacteria | 2410 |
| 271 | Ga0496106_0135288 | 3300048909 | Bacteria | 1935 |
| 272 | Ga0496108_0020168 | 3300048911 | Bacteria | 5479 |
| 273 | Ga0496110_0337308 | 3300048913 | Bacteria | 1373 |
| 274 | Ga0496113_0057966 | 3300048916 | Unclassified | 2913 |
| 275 | Ga0496114_0000001 | 3300048917 | Bacteria | 893286 |
| 276 | Ga0496114_0167920 | 3300048917 | Bacteria | 1911 |
| 277 | Ga0501039_0048567 | 3300049575 | Bacteria | 3281 |
| 278 | Ga0501048_0056525 | 3300049582 | Bacteria | 2784 |
| 279 | Ga0501067_0008695 | 3300049583 | Bacteria | 5624 |
| 280 | Ga0501071_0177129 | 3300049587 | Bacteria | 1597 |
| 281 | Ga0501072_0026569 | 3300049588 | Bacteria | 4514 |
| 282 | Ga0501073_0254692 | 3300049589 | Bacteria | 1212 |
| 283 | Ga0501075_0001557 | 3300049591 | Bacteria | 14966 |
| 284 | Ga0501207_030057 | 3300049654 | Bacteria | 909 |
| 285 | Ga0501216_001161 | 3300049660 | Bacteria | 3473 |
| 286 | Ga0501216_005325 | 3300049660 | Bacteria | 1935 |
| 287 | Ga0501217_001305 | 3300049661 | Bacteria | 4636 |
| 288 | Ga0501223_001853 | 3300049663 | Bacteria | 4775 |
| 289 | Ga0501227_001351 | 3300049665 | Bacteria | 5506 |
| 290 | Ga0501235_001539 | 3300049669 | Unclassified | 4940 |
| 291 | Ga0501253_015277 | 3300049683 | Bacteria | 1258 |
| 292 | Ga0501221_026781 | 3300049704 | Bacteria | 1174 |
| 293 | Ga0501225_0003274 | 3300049705 | Unclassified | 4943 |
| 294 | Ga0501080_0013981 | 3300049742 | Bacteria | 7388 |
| 295 | Ga0501045_0141775 | 3300049824 | Bacteria | 1787 |
| 296 | Ga0501212_013710 | 3300049851 | Bacteria | 1192 |
| 297 | nmdc:mga05p37_1832_c1 | 3300050507 | Bacteria | 24795 |
| 298 | nmdc:mga05p37_30948_c2 | 3300050507 | Unclassified | 1760 |
| 299 | nmdc:mga05p37_313400_c1 | 3300050507 | Bacteria | 1859 |
| 300 | nmdc:mga09592_272039_c1 | 3300050508 | Bacteria | 1469 |
| 301 | nmdc:mga09592_341549_c1 | 3300050508 | Unclassified | 1296 |
| 302 | nmdc:mga06r32_59759_c1 | 3300050510 | Bacteria | 3667 |
| 303 | nmdc:mga08y16_136621_c1 | 3300050511 | Bacteria | 2548 |
| 304 | nmdc:mga08y16_2019_c1 | 3300050511 | Bacteria | 20757 |
| 305 | nmdc:mga08y16_361133_c1 | 3300050511 | Bacteria | 1491 |
| 306 | nmdc:mga0n895_60870_c1 | 3300050512 | Bacteria | 3726 |
| 307 | nmdc:mga0n895_680309_c1 | 3300050512 | Bacteria | 1026 |
| 308 | nmdc:mga0rr50_100397_c1 | 3300050513 | Bacteria | 2273 |
| 309 | nmdc:mga0rr50_14829_c1 | 3300050513 | Bacteria | 5127 |
| 310 | nmdc:mga08x19_17440_c2 | 3300050514 | Bacteria | 2146 |
| 311 | nmdc:mga0a205_114572_c1 | 3300050515 | Bacteria | 2594 |
| 312 | nmdc:mga0a205_53118_c1 | 3300050515 | Bacteria | 3910 |
| 313 | Ga0495601_0117860 | 3300053077 | Bacteria | 1723 |
| 314 | Ga0500557_003467 | 3300053105 | Bacteria | 3135 |
| 315 | Ga0500569_007398 | 3300053109 | Bacteria | 2462 |
| 316 | Ga0500594_0001767 | 3300053118 | Bacteria | 4704 |
| 317 | Ga0500608_032830 | 3300053122 | Bacteria | 2468 |
| 318 | Ga0500577_0026989 | 3300053142 | Bacteria | 1961 |
| 319 | Ga0500588_0013233 | 3300053146 | Bacteria | 2066 |
| 320 | Ga0500622_0000821 | 3300053156 | Bacteria | 26574 |
| 321 | Ga0590075_015836 | 3300059424 | Bacteria | 1852 |
| 322 | Ga0501082_0001539 | 3300060353 | Bacteria | 20295 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046675 | Ga0495657_0084752 | Ga0495657_0084752_1171_2016 | 267 |
| 2 | 3300049654 | Ga0501207_030057 | Ga0501207_030057_36_851 | 270 |
| 3 | 3300005549 | Ga0070704_100126237 | Ga0070704_1001262373 | 273 |
| 4 | 3300048916 | Ga0496113_0057966 | Ga0496113_0057966_2061_2903 | 274 |
| 5 | 3300049824 | Ga0501045_0141775 | Ga0501045_0141775_923_1765 | 277 |
| 6 | 3300013308 | Ga0157375_10062300 | Ga0157375_100623005 | 278 |
| 7 | 3300042014 | Ga0439457_049780 | Ga0439457_049780_60_917 | 278 |
| 8 | 3300050512 | nmdc:mga0n895_680309_c1 | nmdc:mga0n895_680309_c1_170_1012 | 278 |
| 9 | 3300005338 | Ga0068868_100267717 | Ga0068868_1002677171 | 309 |
| 10 | 3300048905 | Ga0496102_0374832 | Ga0496102_0374832_200_1207 | 311 |
| 11 | 3300028800 | Ga0265338_10026813 | Ga0265338_100268135 | 313 |
| 12 | 3300002077 | JGI24744J21845_10010659 | JGI24744J21845_100106592 | 316 |
| 13 | 3300005293 | Ga0065715_10141237 | Ga0065715_101412372 | 316 |
| 14 | 3300005331 | Ga0070670_100024053 | Ga0070670_1000240532 | 316 |
| 15 | 3300025315 | Ga0207697_10000087 | Ga0207697_1000008724 | 316 |
| 16 | 3300025901 | Ga0207688_10002523 | Ga0207688_100025235 | 316 |
| 17 | 3300026023 | Ga0207677_10011384 | Ga0207677_100113842 | 316 |
| 18 | 3300005330 | Ga0070690_100010451 | Ga0070690_1000104513 | 317 |
| 19 | 3300005335 | Ga0070666_10002969 | Ga0070666_100029694 | 317 |
| 20 | 3300005343 | Ga0070687_100072647 | Ga0070687_1000726472 | 317 |
| 21 | 3300005544 | Ga0070686_100002631 | Ga0070686_1000026312 | 317 |
| 22 | 3300005578 | Ga0068854_100103648 | Ga0068854_1001036482 | 317 |
| 23 | 3300005578 | Ga0068854_100145798 | Ga0068854_1001457982 | 317 |
| 24 | 3300007076 | Ga0075435_100001160 | Ga0075435_10000116017 | 317 |
| 25 | 3300009093 | Ga0105240_10054655 | Ga0105240_100546552 | 317 |
| 26 | 3300009093 | Ga0105240_10059839 | Ga0105240_100598393 | 317 |
| 27 | 3300009177 | Ga0105248_10079503 | Ga0105248_100795032 | 317 |
| 28 | 3300025913 | Ga0207695_10120177 | Ga0207695_101201771 | 317 |
| 29 | 3300025918 | Ga0207662_10093692 | Ga0207662_100936922 | 317 |
| 30 | 3300025933 | Ga0207706_10355036 | Ga0207706_103550361 | 317 |
| 31 | 3300025981 | Ga0207640_10043227 | Ga0207640_100432271 | 317 |
| 32 | 3300034820 | Ga0373959_0005433 | Ga0373959_0005433_38_1000 | 317 |
| 33 | 3300035085 | Ga0373929_0000553 | Ga0373929_0000553_23_985 | 317 |
| 34 | 3300035088 | Ga0373940_0051430 | Ga0373940_0051430_92_1054 | 317 |
| 35 | 3300035092 | Ga0373952_0002056 | Ga0373952_0002056_876_1838 | 317 |
| 36 | 3300035112 | Ga0373932_0003135 | Ga0373932_0003135_82_1044 | 317 |
| 37 | 3300035114 | Ga0373939_0001444 | Ga0373939_0001444_193_1155 | 317 |
| 38 | 3300035121 | Ga0373960_0002783 | Ga0373960_0002783_2948_3910 | 317 |
| 39 | 3300035207 | Ga0373942_0002249 | Ga0373942_0002249_1125_2087 | 317 |
| 40 | 3300035242 | Ga0373962_0031237 | Ga0373962_0031237_193_1155 | 317 |
| 41 | 3300035691 | Ga0373931_0038463 | Ga0373931_0038463_1487_2449 | 317 |
| 42 | 3300045051 | Ga0451576_0006871 | Ga0451576_0006871_6659_7621 | 317 |
| 43 | 3300048906 | Ga0496103_0070617 | Ga0496103_0070617_939_1901 | 317 |
| 44 | 3300050513 | nmdc:mga0rr50_100397_c1 | nmdc:mga0rr50_100397_c1_600_1562 | 317 |
| 45 | 3300050513 | nmdc:mga0rr50_14829_c1 | nmdc:mga0rr50_14829_c1_84_1046 | 317 |
| 46 | 3300005466 | Ga0070685_10002474 | Ga0070685_100024746 | 318 |
| 47 | 3300005548 | Ga0070665_100000351 | Ga0070665_10000035136 | 318 |
| 48 | 3300006844 | Ga0075428_100008473 | Ga0075428_1000084733 | 318 |
| 49 | 3300009094 | Ga0111539_10046527 | Ga0111539_100465276 | 318 |
| 50 | 3300009147 | Ga0114129_10059999 | Ga0114129_100599993 | 318 |
| 51 | 3300028379 | Ga0268266_10000653 | Ga0268266_1000065311 | 318 |
| 52 | 3300046679 | Ga0495623_0145679 | Ga0495623_0145679_217_1224 | 318 |
| 53 | 3300048088 | Ga0495602_0028061 | Ga0495602_0028061_1021_2028 | 318 |
| 54 | 3300050511 | nmdc:mga08y16_136621_c1 | nmdc:mga08y16_136621_c1_680_1675 | 318 |
| 55 | 3300053122 | Ga0500608_032830 | Ga0500608_032830_39_1109 | 318 |
| 56 | 3300005262 | Ga0065165_1002490 | Ga0065165_10024907 | 319 |
| 57 | 3300005331 | Ga0070670_100001104 | Ga0070670_10000110411 | 319 |
| 58 | 3300005459 | Ga0068867_100047274 | Ga0068867_1000472743 | 319 |
| 59 | 3300005618 | Ga0068864_100190913 | Ga0068864_1001909132 | 319 |
| 60 | 3300028381 | Ga0268264_10494456 | Ga0268264_104944561 | 319 |
| 61 | 3300044683 | Ga0466965_0094085 | Ga0466965_0094085_301_1323 | 319 |
| 62 | 3300046460 | Ga0495638_0000953 | Ga0495638_0000953_7889_8911 | 319 |
| 63 | 3300046474 | Ga0495605_0001474 | Ga0495605_0001474_2309_3331 | 319 |
| 64 | 3300046506 | Ga0495583_0012759 | Ga0495583_0012759_97_1119 | 319 |
| 65 | 3300046518 | Ga0495631_0012885 | Ga0495631_0012885_1488_2510 | 319 |
| 66 | 3300046519 | Ga0495632_0013526 | Ga0495632_0013526_13_1035 | 319 |
| 67 | 3300046538 | Ga0495609_0008203 | Ga0495609_0008203_2719_3741 | 319 |
| 68 | 3300046616 | Ga0495668_0003159 | Ga0495668_0003159_7876_8898 | 319 |
| 69 | 3300046660 | Ga0495625_0005331 | Ga0495625_0005331_4417_5439 | 319 |
| 70 | 3300046691 | Ga0495670_0003394 | Ga0495670_0003394_2920_3942 | 319 |
| 71 | 3300046810 | Ga0495660_0032206 | Ga0495660_0032206_706_1728 | 319 |
| 72 | 3300053105 | Ga0500557_003467 | Ga0500557_003467_932_1954 | 319 |
| 73 | 3300053109 | Ga0500569_007398 | Ga0500569_007398_805_1827 | 319 |
| 74 | 3300053118 | Ga0500594_0001767 | Ga0500594_0001767_2213_3235 | 319 |
| 75 | 3300053142 | Ga0500577_0026989 | Ga0500577_0026989_802_1824 | 319 |
| 76 | 3300053146 | Ga0500588_0013233 | Ga0500588_0013233_85_1107 | 319 |
| 77 | 3300005355 | Ga0070671_100085981 | Ga0070671_1000859812 | 320 |
| 78 | 3300005356 | Ga0070674_100016582 | Ga0070674_1000165823 | 320 |
| 79 | 3300005548 | Ga0070665_100027861 | Ga0070665_1000278614 | 320 |
| 80 | 3300005842 | Ga0068858_100126548 | Ga0068858_1001265482 | 320 |
| 81 | 3300009177 | Ga0105248_10072879 | Ga0105248_100728792 | 320 |
| 82 | 3300025937 | Ga0207669_10025638 | Ga0207669_100256383 | 320 |
| 83 | 3300025941 | Ga0207711_10082160 | Ga0207711_100821603 | 320 |
| 84 | 3300028379 | Ga0268266_10007630 | Ga0268266_100076309 | 320 |
| 85 | 3300035410 | Ga0373924_0031043 | Ga0373924_0031043_1119_2108 | 320 |
| 86 | 3300037068 | Ga0373925_0038478 | Ga0373925_0038478_2512_3501 | 320 |
| 87 | 3300046683 | Ga0495658_0172067 | Ga0495658_0172067_148_1137 | 320 |
| 88 | 3300047319 | Ga0495674_0274571 | Ga0495674_0274571_149_1138 | 320 |
| 89 | 3300048917 | Ga0496114_0167920 | Ga0496114_0167920_583_1572 | 320 |
| 90 | 3300053077 | Ga0495601_0117860 | Ga0495601_0117860_505_1494 | 320 |
| 91 | 3300059424 | Ga0590075_015836 | Ga0590075_015836_284_1288 | 320 |
| 92 | 3300031824 | Ga0307413_10095989 | Ga0307413_100959892 | 321 |
| 93 | 3300031995 | Ga0307409_100436524 | Ga0307409_1004365241 | 321 |
| 94 | 3300032002 | Ga0307416_100015007 | Ga0307416_1000150072 | 321 |
| 95 | 3300035695 | Ga0373927_0000419 | Ga0373927_0000419_9308_10336 | 321 |
| 96 | 3300037068 | Ga0373925_0013435 | Ga0373925_0013435_433_1461 | 321 |
| 97 | 3300049660 | Ga0501216_001161 | Ga0501216_001161_2451_3419 | 321 |
| 98 | 3300049661 | Ga0501217_001305 | Ga0501217_001305_3307_4275 | 321 |
| 99 | 3300049663 | Ga0501223_001853 | Ga0501223_001853_936_1904 | 321 |
| 100 | 3300049665 | Ga0501227_001351 | Ga0501227_001351_643_1611 | 321 |
| 101 | 3300049669 | Ga0501235_001539 | Ga0501235_001539_138_1106 | 321 |
| 102 | 3300049683 | Ga0501253_015277 | Ga0501253_015277_173_1141 | 321 |
| 103 | 3300049705 | Ga0501225_0003274 | Ga0501225_0003274_55_1023 | 321 |
| 104 | 3300049851 | Ga0501212_013710 | Ga0501212_013710_72_1040 | 321 |
| 105 | 3300053156 | Ga0500622_0000821 | Ga0500622_0000821_7661_8683 | 321 |
| 106 | 3300049583 | Ga0501067_0008695 | Ga0501067_0008695_2446_3435 | 323 |
| 107 | 3300049591 | Ga0501075_0001557 | Ga0501075_0001557_569_1558 | 323 |
| 108 | 3300049742 | Ga0501080_0013981 | Ga0501080_0013981_1141_2130 | 323 |
| 109 | 3300060353 | Ga0501082_0001539 | Ga0501082_0001539_12128_13117 | 323 |
| 110 | 3300014326 | Ga0157380_10521856 | Ga0157380_105218562 | 324 |
| 111 | 3300025933 | Ga0207706_10359730 | Ga0207706_103597301 | 324 |
| 112 | 3300035695 | Ga0373927_0184236 | Ga0373927_0184236_349_1341 | 324 |
| 113 | 3300046535 | Ga0495586_0003006 | Ga0495586_0003006_7399_8391 | 324 |
| 114 | 3300005337 | Ga0070682_100001017 | Ga0070682_1000010178 | 325 |
| 115 | 3300005440 | Ga0070705_100003079 | Ga0070705_1000030794 | 325 |
| 116 | 3300005547 | Ga0070693_100011930 | Ga0070693_1000119304 | 325 |
| 117 | 3300005615 | Ga0070702_100012927 | Ga0070702_1000129273 | 325 |
| 118 | 3300005617 | Ga0068859_100123208 | Ga0068859_1001232082 | 325 |
| 119 | 3300005834 | Ga0068851_10003596 | Ga0068851_100035962 | 325 |
| 120 | 3300005842 | Ga0068858_100121790 | Ga0068858_1001217904 | 325 |
| 121 | 3300006931 | Ga0097620_100123215 | Ga0097620_1001232152 | 325 |
| 122 | 3300009545 | Ga0105237_10000264 | Ga0105237_1000026411 | 325 |
| 123 | 3300025321 | Ga0207656_10012051 | Ga0207656_100120513 | 325 |
| 124 | 3300025914 | Ga0207671_10001408 | Ga0207671_1000140812 | 325 |
| 125 | 3300047320 | Ga0495672_0002520 | Ga0495672_0002520_8558_9541 | 325 |
| 126 | 3300009094 | Ga0111539_10488141 | Ga0111539_104881412 | 326 |
| 127 | 3300035172 | Ga0373955_0000640 | Ga0373955_0000640_9879_10871 | 326 |
| 128 | 3300046517 | Ga0495630_0098562 | Ga0495630_0098562_823_1815 | 326 |
| 129 | 3300047319 | Ga0495674_0233067 | Ga0495674_0233067_85_1077 | 326 |
| 130 | 3300047471 | Ga0495684_0303851 | Ga0495684_0303851_52_1044 | 326 |
| 131 | 3300050511 | nmdc:mga08y16_361133_c1 | nmdc:mga08y16_361133_c1_365_1375 | 326 |
| 132 | 3300025919 | Ga0207657_10103884 | Ga0207657_101038842 | 328 |
| 133 | 3300025986 | Ga0207658_10045750 | Ga0207658_100457502 | 328 |
| 134 | 3300026089 | Ga0207648_10025319 | Ga0207648_100253193 | 328 |
| 135 | 3300031616 | Ga0307508_10007195 | Ga0307508_100071958 | 328 |
| 136 | 3300031731 | Ga0307405_10124370 | Ga0307405_101243702 | 328 |
| 137 | 3300032002 | Ga0307416_100051469 | Ga0307416_1000514693 | 328 |
| 138 | 3300032005 | Ga0307411_10048627 | Ga0307411_100486273 | 328 |
| 139 | 3300032126 | Ga0307415_100007170 | Ga0307415_1000071705 | 328 |
| 140 | 3300035241 | Ga0373961_0005819 | Ga0373961_0005819_1263_2276 | 328 |
| 141 | 3300035692 | Ga0373935_0019258 | Ga0373935_0019258_1496_2518 | 328 |
| 142 | 3300048908 | Ga0496105_0098815 | Ga0496105_0098815_1274_2317 | 328 |
| 143 | 3300048917 | Ga0496114_0000001 | Ga0496114_0000001_36717_37760 | 328 |
| 144 | 3300049588 | Ga0501072_0026569 | Ga0501072_0026569_3015_4022 | 328 |
| 145 | 3300049589 | Ga0501073_0254692 | Ga0501073_0254692_131_1138 | 328 |
| 146 | 3300049660 | Ga0501216_005325 | Ga0501216_005325_281_1270 | 328 |
| 147 | 3300049704 | Ga0501221_026781 | Ga0501221_026781_135_1124 | 328 |
| 148 | 3300005328 | Ga0070676_10049292 | Ga0070676_100492924 | 329 |
| 149 | 3300005335 | Ga0070666_10167939 | Ga0070666_101679392 | 329 |
| 150 | 3300005335 | Ga0070666_10197935 | Ga0070666_101979352 | 329 |
| 151 | 3300005338 | Ga0068868_100111046 | Ga0068868_1001110462 | 329 |
| 152 | 3300005343 | Ga0070687_100004547 | Ga0070687_1000045474 | 329 |
| 153 | 3300005347 | Ga0070668_100000444 | Ga0070668_10000044420 | 329 |
| 154 | 3300005353 | Ga0070669_100004745 | Ga0070669_1000047454 | 329 |
| 155 | 3300005353 | Ga0070669_100013244 | Ga0070669_1000132443 | 329 |
| 156 | 3300005365 | Ga0070688_100109139 | Ga0070688_1001091392 | 329 |
| 157 | 3300005366 | Ga0070659_100007802 | Ga0070659_1000078026 | 329 |
| 158 | 3300005367 | Ga0070667_100405323 | Ga0070667_1004053231 | 329 |
| 159 | 3300005438 | Ga0070701_10020120 | Ga0070701_100201202 | 329 |
| 160 | 3300005441 | Ga0070700_100039749 | Ga0070700_1000397493 | 329 |
| 161 | 3300005457 | Ga0070662_100120723 | Ga0070662_1001207232 | 329 |
| 162 | 3300005535 | Ga0070684_100004637 | Ga0070684_1000046378 | 329 |
| 163 | 3300005539 | Ga0068853_100086098 | Ga0068853_1000860982 | 329 |
| 164 | 3300005543 | Ga0070672_100012865 | Ga0070672_1000128652 | 329 |
| 165 | 3300005543 | Ga0070672_100019134 | Ga0070672_1000191344 | 329 |
| 166 | 3300005548 | Ga0070665_100070208 | Ga0070665_1000702083 | 329 |
| 167 | 3300005564 | Ga0070664_100449811 | Ga0070664_1004498111 | 329 |
| 168 | 3300005577 | Ga0068857_100004471 | Ga0068857_10000447112 | 329 |
| 169 | 3300005577 | Ga0068857_100026841 | Ga0068857_1000268412 | 329 |
| 170 | 3300005719 | Ga0068861_100031826 | Ga0068861_1000318264 | 329 |
| 171 | 3300005834 | Ga0068851_10081486 | Ga0068851_100814862 | 329 |
| 172 | 3300005840 | Ga0068870_10002385 | Ga0068870_100023856 | 329 |
| 173 | 3300005841 | Ga0068863_100070252 | Ga0068863_1000702523 | 329 |
| 174 | 3300005843 | Ga0068860_100477600 | Ga0068860_1004776002 | 329 |
| 175 | 3300005844 | Ga0068862_100002846 | Ga0068862_1000028463 | 329 |
| 176 | 3300005844 | Ga0068862_100095604 | Ga0068862_1000956043 | 329 |
| 177 | 3300006237 | Ga0097621_100030984 | Ga0097621_1000309842 | 329 |
| 178 | 3300006847 | Ga0075431_100320267 | Ga0075431_1003202672 | 329 |
| 179 | 3300006852 | Ga0075433_10014226 | Ga0075433_100142262 | 329 |
| 180 | 3300006852 | Ga0075433_10054476 | Ga0075433_100544764 | 329 |
| 181 | 3300006871 | Ga0075434_100009945 | Ga0075434_1000099459 | 329 |
| 182 | 3300006880 | Ga0075429_100066448 | Ga0075429_1000664483 | 329 |
| 183 | 3300006881 | Ga0068865_100021287 | Ga0068865_1000212874 | 329 |
| 184 | 3300006931 | Ga0097620_100632591 | Ga0097620_1006325911 | 329 |
| 185 | 3300009147 | Ga0114129_10221219 | Ga0114129_102212192 | 329 |
| 186 | 3300009147 | Ga0114129_10542535 | Ga0114129_105425352 | 329 |
| 187 | 3300009177 | Ga0105248_10035292 | Ga0105248_100352923 | 329 |
| 188 | 3300009553 | Ga0105249_10001951 | Ga0105249_1000195110 | 329 |
| 189 | 3300013306 | Ga0163162_10072903 | Ga0163162_100729032 | 329 |
| 190 | 3300013307 | Ga0157372_10368188 | Ga0157372_103681882 | 329 |
| 191 | 3300014325 | Ga0163163_10181568 | Ga0163163_101815682 | 329 |
| 192 | 3300014326 | Ga0157380_10008320 | Ga0157380_100083203 | 329 |
| 193 | 3300014326 | Ga0157380_10013385 | Ga0157380_100133855 | 329 |
| 194 | 3300014326 | Ga0157380_10079432 | Ga0157380_100794322 | 329 |
| 195 | 3300014745 | Ga0157377_10009350 | Ga0157377_100093504 | 329 |
| 196 | 3300014968 | Ga0157379_10030360 | Ga0157379_100303603 | 329 |
| 197 | 3300025903 | Ga0207680_10078891 | Ga0207680_100788912 | 329 |
| 198 | 3300025907 | Ga0207645_10000687 | Ga0207645_1000068720 | 329 |
| 199 | 3300025908 | Ga0207643_10006127 | Ga0207643_100061273 | 329 |
| 200 | 3300025915 | Ga0207693_10095906 | Ga0207693_100959064 | 329 |
| 201 | 3300025918 | Ga0207662_10018722 | Ga0207662_100187223 | 329 |
| 202 | 3300025923 | Ga0207681_10028029 | Ga0207681_100280294 | 329 |
| 203 | 3300025933 | Ga0207706_10003592 | Ga0207706_100035928 | 329 |
| 204 | 3300025933 | Ga0207706_10039843 | Ga0207706_100398433 | 329 |
| 205 | 3300025937 | Ga0207669_10132009 | Ga0207669_101320092 | 329 |
| 206 | 3300025940 | Ga0207691_10002827 | Ga0207691_1000282713 | 329 |
| 207 | 3300025940 | Ga0207691_10107965 | Ga0207691_101079652 | 329 |
| 208 | 3300025940 | Ga0207691_10161139 | Ga0207691_101611392 | 329 |
| 209 | 3300025941 | Ga0207711_10232376 | Ga0207711_102323762 | 329 |
| 210 | 3300025942 | Ga0207689_10020102 | Ga0207689_100201023 | 329 |
| 211 | 3300025949 | Ga0207667_10054525 | Ga0207667_100545253 | 329 |
| 212 | 3300025961 | Ga0207712_10005418 | Ga0207712_100054189 | 329 |
| 213 | 3300026035 | Ga0207703_10105232 | Ga0207703_101052322 | 329 |
| 214 | 3300026075 | Ga0207708_10024302 | Ga0207708_100243022 | 329 |
| 215 | 3300026078 | Ga0207702_10199503 | Ga0207702_101995032 | 329 |
| 216 | 3300026095 | Ga0207676_10202756 | Ga0207676_102027562 | 329 |
| 217 | 3300026116 | Ga0207674_10005242 | Ga0207674_1000524211 | 329 |
| 218 | 3300026116 | Ga0207674_10022334 | Ga0207674_100223343 | 329 |
| 219 | 3300026118 | Ga0207675_100006707 | Ga0207675_1000067078 | 329 |
| 220 | 3300026118 | Ga0207675_100033008 | Ga0207675_1000330082 | 329 |
| 221 | 3300026142 | Ga0207698_10100248 | Ga0207698_101002481 | 329 |
| 222 | 3300028380 | Ga0268265_10006088 | Ga0268265_100060882 | 329 |
| 223 | 3300031548 | Ga0307408_100037335 | Ga0307408_1000373354 | 329 |
| 224 | 3300031731 | Ga0307405_10032560 | Ga0307405_100325602 | 329 |
| 225 | 3300031824 | Ga0307413_10002275 | Ga0307413_100022755 | 329 |
| 226 | 3300031852 | Ga0307410_10012270 | Ga0307410_100122703 | 329 |
| 227 | 3300031903 | Ga0307407_10012140 | Ga0307407_100121402 | 329 |
| 228 | 3300031911 | Ga0307412_10004400 | Ga0307412_100044004 | 329 |
| 229 | 3300031995 | Ga0307409_100022376 | Ga0307409_1000223764 | 329 |
| 230 | 3300032002 | Ga0307416_100025129 | Ga0307416_1000251294 | 329 |
| 231 | 3300032002 | Ga0307416_100097645 | Ga0307416_1000976451 | 329 |
| 232 | 3300032004 | Ga0307414_10037827 | Ga0307414_100378272 | 329 |
| 233 | 3300032005 | Ga0307411_10006725 | Ga0307411_100067253 | 329 |
| 234 | 3300032126 | Ga0307415_100003439 | Ga0307415_1000034396 | 329 |
| 235 | 3300035695 | Ga0373927_0223067 | Ga0373927_0223067_174_1190 | 329 |
| 236 | 3300042461 | Ga0439460_0030572 | Ga0439460_0030572_151_1170 | 329 |
| 237 | 3300045051 | Ga0451576_0065554 | Ga0451576_0065554_802_1818 | 329 |
| 238 | 3300046455 | Ga0495603_0093997 | Ga0495603_0093997_460_1509 | 329 |
| 239 | 3300046459 | Ga0495629_0028912 | Ga0495629_0028912_983_2032 | 329 |
| 240 | 3300046459 | Ga0495629_0204216 | Ga0495629_0204216_41_1057 | 329 |
| 241 | 3300048909 | Ga0496106_0135288 | Ga0496106_0135288_456_1517 | 329 |
| 242 | 3300048911 | Ga0496108_0020168 | Ga0496108_0020168_448_1545 | 329 |
| 243 | 3300049575 | Ga0501039_0048567 | Ga0501039_0048567_994_2016 | 329 |
| 244 | 3300049582 | Ga0501048_0056525 | Ga0501048_0056525_185_1207 | 329 |
| 245 | 3300049587 | Ga0501071_0177129 | Ga0501071_0177129_302_1324 | 329 |
| 246 | 3300050507 | nmdc:mga05p37_1832_c1 | nmdc:mga05p37_1832_c1_14214_15236 | 329 |
| 247 | 3300050507 | nmdc:mga05p37_30948_c2 | nmdc:mga05p37_30948_c2_547_1563 | 329 |
| 248 | 3300050507 | nmdc:mga05p37_313400_c1 | nmdc:mga05p37_313400_c1_684_1694 | 329 |
| 249 | 3300050508 | nmdc:mga09592_272039_c1 | nmdc:mga09592_272039_c1_236_1246 | 329 |
| 250 | 3300050508 | nmdc:mga09592_341549_c1 | nmdc:mga09592_341549_c1_141_1172 | 329 |
| 251 | 3300050512 | nmdc:mga0n895_60870_c1 | nmdc:mga0n895_60870_c1_1302_2318 | 329 |
| 252 | 3300050515 | nmdc:mga0a205_53118_c1 | nmdc:mga0a205_53118_c1_847_1863 | 329 |
| 253 | 3300005345 | Ga0070692_10058412 | Ga0070692_100584123 | 330 |
| 254 | 3300005544 | Ga0070686_100075805 | Ga0070686_1000758052 | 330 |
| 255 | 3300005842 | Ga0068858_100132637 | Ga0068858_1001326374 | 330 |
| 256 | 3300006847 | Ga0075431_100030722 | Ga0075431_1000307223 | 330 |
| 257 | 3300050510 | nmdc:mga06r32_59759_c1 | nmdc:mga06r32_59759_c1_966_1982 | 330 |
| 258 | 2162886007 | SwRhRL2b_contig_2891936 | SwRhRL2b_0869.00008040 | 331 |
| 259 | 3300002459 | JGI24751J29686_10000010 | JGI24751J29686_1000001036 | 331 |
| 260 | 3300005289 | Ga0065704_10005815 | Ga0065704_100058154 | 331 |
| 261 | 3300005293 | Ga0065715_10000428 | Ga0065715_100004289 | 331 |
| 262 | 3300005295 | Ga0065707_10162539 | Ga0065707_101625392 | 331 |
| 263 | 3300005331 | Ga0070670_100000172 | Ga0070670_10000017216 | 331 |
| 264 | 3300005354 | Ga0070675_100249148 | Ga0070675_1002491482 | 331 |
| 265 | 3300005366 | Ga0070659_100056305 | Ga0070659_1000563054 | 331 |
| 266 | 3300005444 | Ga0070694_100011976 | Ga0070694_1000119766 | 331 |
| 267 | 3300005518 | Ga0070699_100125875 | Ga0070699_1001258752 | 331 |
| 268 | 3300005539 | Ga0068853_100035071 | Ga0068853_1000350715 | 331 |
| 269 | 3300005545 | Ga0070695_100021902 | Ga0070695_1000219025 | 331 |
| 270 | 3300005545 | Ga0070695_100209716 | Ga0070695_1002097162 | 331 |
| 271 | 3300005547 | Ga0070693_100012938 | Ga0070693_1000129384 | 331 |
| 272 | 3300005564 | Ga0070664_100382810 | Ga0070664_1003828101 | 331 |
| 273 | 3300005577 | Ga0068857_100199538 | Ga0068857_1001995383 | 331 |
| 274 | 3300005578 | Ga0068854_100108340 | Ga0068854_1001083403 | 331 |
| 275 | 3300005615 | Ga0070702_100000912 | Ga0070702_1000009125 | 331 |
| 276 | 3300005615 | Ga0070702_100242253 | Ga0070702_1002422531 | 331 |
| 277 | 3300005617 | Ga0068859_100213736 | Ga0068859_1002137362 | 331 |
| 278 | 3300005617 | Ga0068859_100229435 | Ga0068859_1002294352 | 331 |
| 279 | 3300005841 | Ga0068863_100169775 | Ga0068863_1001697752 | 331 |
| 280 | 3300005842 | Ga0068858_100117549 | Ga0068858_1001175493 | 331 |
| 281 | 3300005843 | Ga0068860_100054702 | Ga0068860_1000547025 | 331 |
| 282 | 3300005843 | Ga0068860_100069876 | Ga0068860_1000698763 | 331 |
| 283 | 3300005844 | Ga0068862_100434471 | Ga0068862_1004344712 | 331 |
| 284 | 3300005985 | Ga0081539_10001827 | Ga0081539_100018273 | 331 |
| 285 | 3300006237 | Ga0097621_100005658 | Ga0097621_1000056582 | 331 |
| 286 | 3300006358 | Ga0068871_100071318 | Ga0068871_1000713183 | 331 |
| 287 | 3300006914 | Ga0075436_100091135 | Ga0075436_1000911352 | 331 |
| 288 | 3300006931 | Ga0097620_100213736 | Ga0097620_1002137362 | 331 |
| 289 | 3300006931 | Ga0097620_100229449 | Ga0097620_1002294492 | 331 |
| 290 | 3300009094 | Ga0111539_10003668 | Ga0111539_1000366810 | 331 |
| 291 | 3300009148 | Ga0105243_10045610 | Ga0105243_100456101 | 331 |
| 292 | 3300009176 | Ga0105242_10079558 | Ga0105242_100795584 | 331 |
| 293 | 3300009176 | Ga0105242_10335779 | Ga0105242_103357792 | 331 |
| 294 | 3300009545 | Ga0105237_10153032 | Ga0105237_101530324 | 331 |
| 295 | 3300009551 | Ga0105238_10027419 | Ga0105238_100274193 | 331 |
| 296 | 3300009553 | Ga0105249_10007691 | Ga0105249_100076919 | 331 |
| 297 | 3300010375 | Ga0105239_10172341 | Ga0105239_101723414 | 331 |
| 298 | 3300013100 | Ga0157373_10046217 | Ga0157373_100462172 | 331 |
| 299 | 3300013297 | Ga0157378_10430108 | Ga0157378_104301081 | 331 |
| 300 | 3300014325 | Ga0163163_10000172 | Ga0163163_1000017217 | 331 |
| 301 | 3300025901 | Ga0207688_10204466 | Ga0207688_102044661 | 331 |
| 302 | 3300025904 | Ga0207647_10009523 | Ga0207647_100095233 | 331 |
| 303 | 3300025924 | Ga0207694_10026028 | Ga0207694_100260284 | 331 |
| 304 | 3300025924 | Ga0207694_10042113 | Ga0207694_100421134 | 331 |
| 305 | 3300025925 | Ga0207650_10000001 | Ga0207650_10000001476 | 331 |
| 306 | 3300025934 | Ga0207686_10053694 | Ga0207686_100536942 | 331 |
| 307 | 3300025935 | Ga0207709_10005752 | Ga0207709_100057521 | 331 |
| 308 | 3300025941 | Ga0207711_10050880 | Ga0207711_100508805 | 331 |
| 309 | 3300025961 | Ga0207712_10039760 | Ga0207712_100397604 | 331 |
| 310 | 3300025981 | Ga0207640_10018492 | Ga0207640_100184922 | 331 |
| 311 | 3300026035 | Ga0207703_10153438 | Ga0207703_101534383 | 331 |
| 312 | 3300026075 | Ga0207708_10012873 | Ga0207708_100128735 | 331 |
| 313 | 3300026088 | Ga0207641_10151226 | Ga0207641_101512262 | 331 |
| 314 | 3300026095 | Ga0207676_10119786 | Ga0207676_101197864 | 331 |
| 315 | 3300026116 | Ga0207674_10135909 | Ga0207674_101359093 | 331 |
| 316 | 3300027907 | Ga0207428_10030144 | Ga0207428_100301442 | 331 |
| 317 | 3300028381 | Ga0268264_10045652 | Ga0268264_100456524 | 331 |
| 318 | 3300028381 | Ga0268264_10318261 | Ga0268264_103182611 | 331 |
| 319 | 3300048913 | Ga0496110_0337308 | Ga0496110_0337308_92_1087 | 331 |
| 320 | 3300050511 | nmdc:mga08y16_2019_c1 | nmdc:mga08y16_2019_c1_634_1629 | 331 |
| 321 | 3300050514 | nmdc:mga08x19_17440_c2 | nmdc:mga08x19_17440_c2_128_1123 | 331 |
| 322 | 3300050515 | nmdc:mga0a205_114572_c1 | nmdc:mga0a205_114572_c1_1045_2040 | 331 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1sg3-assembly1.cif.gz_B | structure of allantoicase | 0.9053 | 5 | 327 |
| 1o59-assembly1.cif.gz_A | crystal structure of allantoicase (yir029w) from saccharomyces cerevisiae at 2.40 a resolution | 0.9037 | 5 | 328 |
| 1sg3-assembly1.cif.gz_A | structure of allantoicase | 0.9013 | 5 | 328 |
| 1sg3-assembly1.cif.gz_A | structure of allantoicase | 0.8445 | 5 | 328 |
| 1o59-assembly1.cif.gz_A | crystal structure of allantoicase (yir029w) from saccharomyces cerevisiae at 2.40 a resolution | 0.8441 | 5 | 328 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54VL5_6_180_2.60.120.260 | Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like | 0.9745 | 4 | 169 | 2.60.120.260 |
| af_Q09913_185_341_2.60.120.260 | Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like | 0.9468 | 177 | 331 | 2.60.120.260 |
| af_Q54VL5_182_341_2.60.120.260 | Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like | 0.9452 | 177 | 330 | 2.60.120.260 |
| af_Q8N6M5_185_368_2.60.120.260 | Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like | 0.9172 | 168 | 330 | 2.60.120.260 |
| af_Q5AD02_3_184_2.60.120.260 | Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like | 0.9156 | 4 | 169 | 2.60.120.260 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6F8XY06-F1-model_v4 | Allantoicase domain-containing protein | 0.9837 | 1 | 169 |
GO:0000256
GO:0004037 |
| AF-A0A317HV08-F1-model_v4 | Probable allantoicase (EC 3.5.3.4) (Allantoate amidinohydrolase) | 0.9816 | 1 | 331 |
GO:0000256
GO:0004037 GO:0006144 |
| AF-A0A7C7GQT0-F1-model_v4 | Allantoicase (EC 3.5.3.4) | 0.9779 | 6 | 169 |
GO:0000256
GO:0004037 |
| AF-A0A7Z9SDE7-F1-model_v4 | Allantoicase (EC 3.5.3.4) | 0.9772 | 6 | 148 |
GO:0000256
GO:0004037 |
| AF-A0A2V8PGD3-F1-model_v4 | Allantoicase (EC 3.5.3.4) | 0.9766 | 83 | 329 |
GO:0000256
GO:0004037 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar