F406303

General Info

Members Datasets Scaffolds Average Seq Length
322 222 322 332

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10197935|Ga0070666_101979352
Length 365
Sequence MQNSAEHLGPGPIGDDDTPAFARLADLASARVGGRTLDASDDFFAPRSNLLKPQPPIFVPGKFTSRGKWMDGWESRRKRTPGHDWCVIRLGLRGAVRGVDVDTSFFVGNHPSQCSIDALDHARPLTPSIAGRLGAPWVTILDRSPLNGNSHNYFAIDAGGANRADGSPPAAQPGPAWTHLRLNIYPDGGVARFRAYGDVILDWTDLATTRRSVDLASIRNGGRVIAASDMHFGAVGNMLMPDRAANMGDGWETRRRRGPGHDWAVVRLGAPGLLTRIEIDTNHFKGNYPDRATVEGCLVPSNEVAAMDIAGWFPVLPETKLRAHHRHLFSRELLPSGPVSHVRLNIFPDGGVSRLRVHGIVAPAR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
138 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
139 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
140 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
143 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
146 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
147 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
154 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
161 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
164 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
194 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
195 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
196 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
197 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
198 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
199 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
200 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
201 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
215 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
216 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
217 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
218 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
219 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
220 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
221 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.48
Nodule 0
Rhizoplane 2.8
Rhizosphere 94.41
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2891936 2162886007 Unclassified 3434
2 JGI24744J21845_10010659 3300002077 Bacteria 1882
3 JGI24751J29686_10000010 3300002459 Bacteria 124816
4 Ga0065165_1002490 3300005262 Bacteria 15444
5 Ga0065704_10005815 3300005289 Bacteria 2753
6 Ga0065715_10000428 3300005293 Bacteria 13809
7 Ga0065715_10141237 3300005293 Bacteria 1851
8 Ga0065707_10162539 3300005295 Bacteria 1551
9 Ga0070676_10049292 3300005328 Bacteria 2465
10 Ga0070690_100010451 3300005330 Bacteria 5403
11 Ga0070670_100000172 3300005331 Bacteria 58670
12 Ga0070670_100001104 3300005331 Bacteria 21445
13 Ga0070670_100024053 3300005331 Bacteria 5240
14 Ga0070666_10002969 3300005335 Bacteria 10287
15 Ga0070666_10167939 3300005335 Bacteria 1536
16 Ga0070666_10197935 3300005335 Bacteria 1413
17 Ga0070682_100001017 3300005337 Bacteria 16243
18 Ga0068868_100111046 3300005338 Bacteria 2228
19 Ga0068868_100267717 3300005338 Bacteria 1443
20 Ga0070687_100004547 3300005343 Bacteria 5542
21 Ga0070687_100072647 3300005343 Bacteria 1852
22 Ga0070692_10058412 3300005345 Unclassified 2026
23 Ga0070668_100000444 3300005347 Bacteria 27368
24 Ga0070669_100004745 3300005353 Bacteria 9800
25 Ga0070669_100013244 3300005353 Bacteria 5862
26 Ga0070675_100249148 3300005354 Bacteria 1554
27 Ga0070671_100085981 3300005355 Bacteria 2631
28 Ga0070674_100016582 3300005356 Bacteria 4618
29 Ga0070688_100109139 3300005365 Bacteria 1837
30 Ga0070659_100007802 3300005366 Bacteria 7786
31 Ga0070659_100056305 3300005366 Bacteria 3101
32 Ga0070667_100405323 3300005367 Bacteria 1242
33 Ga0070701_10020120 3300005438 Bacteria 3164
34 Ga0070705_100003079 3300005440 Bacteria 8207
35 Ga0070700_100039749 3300005441 Bacteria 2875
36 Ga0070694_100011976 3300005444 Bacteria 5383
37 Ga0070662_100120723 3300005457 Bacteria 2008
38 Ga0068867_100047274 3300005459 Bacteria 3163
39 Ga0070685_10002474 3300005466 Bacteria 9489
40 Ga0070699_100125875 3300005518 Bacteria 2256
41 Ga0070684_100004637 3300005535 Bacteria 10486
42 Ga0068853_100035071 3300005539 Bacteria 4260
43 Ga0068853_100086098 3300005539 Bacteria 2755
44 Ga0070672_100012865 3300005543 Bacteria 5895
45 Ga0070672_100019134 3300005543 Bacteria 4964
46 Ga0070686_100002631 3300005544 Bacteria 9903
47 Ga0070686_100075805 3300005544 Bacteria 2213
48 Ga0070695_100021902 3300005545 Bacteria 3915
49 Ga0070695_100209716 3300005545 Bacteria 1397
50 Ga0070693_100011930 3300005547 Bacteria 4385
51 Ga0070693_100012938 3300005547 Unclassified 4237
52 Ga0070665_100000351 3300005548 Bacteria 69230
53 Ga0070665_100027861 3300005548 Bacteria 5690
54 Ga0070665_100070208 3300005548 Bacteria 3510
55 Ga0070704_100126237 3300005549 Bacteria 1975
56 Ga0070664_100382810 3300005564 Bacteria 1284
57 Ga0070664_100449811 3300005564 Bacteria 1182
58 Ga0068857_100004471 3300005577 Bacteria 11819
59 Ga0068857_100026841 3300005577 Bacteria 5078
60 Ga0068857_100199538 3300005577 Bacteria 1823
61 Ga0068854_100103648 3300005578 Bacteria 2136
62 Ga0068854_100108340 3300005578 Bacteria 2092
63 Ga0068854_100145798 3300005578 Bacteria 1821
64 Ga0070702_100000912 3300005615 Bacteria 11541
65 Ga0070702_100012927 3300005615 Bacteria 4202
66 Ga0070702_100242253 3300005615 Bacteria 1218
67 Ga0068859_100123208 3300005617 Bacteria 2660
68 Ga0068859_100213736 3300005617 Bacteria 2015
69 Ga0068859_100229435 3300005617 Bacteria 1944
70 Ga0068864_100190913 3300005618 Bacteria 1878
71 Ga0068861_100031826 3300005719 Bacteria 3879
72 Ga0068851_10003596 3300005834 Bacteria 6910
73 Ga0068851_10081486 3300005834 Bacteria 1691
74 Ga0068870_10002385 3300005840 Bacteria 7816
75 Ga0068863_100070252 3300005841 Bacteria 3311
76 Ga0068863_100169775 3300005841 Unclassified 2092
77 Ga0068858_100117549 3300005842 Unclassified 2485
78 Ga0068858_100121790 3300005842 Bacteria 2440
79 Ga0068858_100126548 3300005842 Bacteria 2393
80 Ga0068858_100132637 3300005842 Bacteria 2337
81 Ga0068860_100054702 3300005843 Bacteria 3793
82 Ga0068860_100069876 3300005843 Unclassified 3338
83 Ga0068860_100477600 3300005843 Bacteria 1242
84 Ga0068862_100002846 3300005844 Bacteria 15171
85 Ga0068862_100095604 3300005844 Bacteria 2592
86 Ga0068862_100434471 3300005844 Bacteria 1234
87 Ga0081539_10001827 3300005985 Bacteria 33597
88 Ga0097621_100005658 3300006237 Bacteria 8821
89 Ga0097621_100030984 3300006237 Bacteria 4240
90 Ga0068871_100071318 3300006358 Bacteria 2857
91 Ga0075428_100008473 3300006844 Bacteria 11405
92 Ga0075431_100030722 3300006847 Bacteria 5534
93 Ga0075431_100320267 3300006847 Unclassified 1564
94 Ga0075433_10014226 3300006852 Bacteria 6497
95 Ga0075433_10054476 3300006852 Bacteria 3490
96 Ga0075434_100009945 3300006871 Bacteria 8899
97 Ga0075429_100066448 3300006880 Unclassified 3139
98 Ga0068865_100021287 3300006881 Bacteria 4215
99 Ga0075436_100091135 3300006914 Bacteria 2119
100 Ga0097620_100123215 3300006931 Bacteria 2660
101 Ga0097620_100213736 3300006931 Bacteria 2015
102 Ga0097620_100229449 3300006931 Bacteria 1944
103 Ga0097620_100632591 3300006931 Bacteria 1162
104 Ga0075435_100001160 3300007076 Bacteria 16819
105 Ga0105240_10054655 3300009093 Bacteria 5003
106 Ga0105240_10059839 3300009093 Bacteria 4752
107 Ga0111539_10003668 3300009094 Bacteria 20222
108 Ga0111539_10046527 3300009094 Bacteria 5189
109 Ga0111539_10488141 3300009094 Bacteria 1435
110 Ga0114129_10059999 3300009147 Bacteria 5318
111 Ga0114129_10221219 3300009147 Bacteria 2554
112 Ga0114129_10542535 3300009147 Unclassified 1513
113 Ga0105243_10045610 3300009148 Bacteria 3445
114 Ga0105242_10079558 3300009176 Bacteria 2737
115 Ga0105242_10335779 3300009176 Bacteria 1391
116 Ga0105248_10035292 3300009177 Bacteria 5594
117 Ga0105248_10072879 3300009177 Bacteria 3860
118 Ga0105248_10079503 3300009177 Bacteria 3685
119 Ga0105237_10000264 3300009545 Bacteria 73957
120 Ga0105237_10153032 3300009545 Bacteria 2303
121 Ga0105238_10027419 3300009551 Bacteria 5804
122 Ga0105249_10001951 3300009553 Bacteria 17896
123 Ga0105249_10007691 3300009553 Bacteria 9390
124 Ga0105239_10172341 3300010375 Bacteria 2420
125 Ga0157373_10046217 3300013100 Unclassified 3106
126 Ga0157378_10430108 3300013297 Bacteria 1306
127 Ga0163162_10072903 3300013306 Bacteria 3489
128 Ga0157372_10368188 3300013307 Bacteria 1674
129 Ga0157375_10062300 3300013308 Bacteria 3706
130 Ga0163163_10000172 3300014325 Bacteria 67754
131 Ga0163163_10181568 3300014325 Bacteria 2151
132 Ga0157380_10008320 3300014326 Bacteria 7395
133 Ga0157380_10013385 3300014326 Bacteria 5979
134 Ga0157380_10079432 3300014326 Bacteria 2679
135 Ga0157380_10521856 3300014326 Unclassified 1159
136 Ga0157377_10009350 3300014745 Bacteria 4805
137 Ga0157379_10030360 3300014968 Bacteria 4811
138 Ga0207697_10000087 3300025315 Bacteria 41336
139 Ga0207656_10012051 3300025321 Bacteria 3281
140 Ga0207688_10002523 3300025901 Bacteria 9871
141 Ga0207688_10204466 3300025901 Bacteria 1185
142 Ga0207680_10078891 3300025903 Bacteria 2063
143 Ga0207647_10009523 3300025904 Bacteria 6897
144 Ga0207645_10000687 3300025907 Bacteria 28066
145 Ga0207643_10006127 3300025908 Bacteria 6433
146 Ga0207695_10120177 3300025913 Bacteria 2596
147 Ga0207671_10001408 3300025914 Bacteria 27992
148 Ga0207693_10095906 3300025915 Bacteria 2325
149 Ga0207662_10018722 3300025918 Bacteria 3933
150 Ga0207662_10093692 3300025918 Bacteria 1851
151 Ga0207657_10103884 3300025919 Bacteria 2355
152 Ga0207681_10028029 3300025923 Bacteria 3646
153 Ga0207694_10026028 3300025924 Bacteria 4449
154 Ga0207694_10042113 3300025924 Bacteria 3521
155 Ga0207650_10000001 3300025925 Bacteria 1545726
156 Ga0207706_10003592 3300025933 Bacteria 14811
157 Ga0207706_10039843 3300025933 Bacteria 4165
158 Ga0207706_10355036 3300025933 Bacteria 1274
159 Ga0207706_10359730 3300025933 Bacteria 1265
160 Ga0207686_10053694 3300025934 Bacteria 2521
161 Ga0207709_10005752 3300025935 Bacteria 7003
162 Ga0207669_10025638 3300025937 Bacteria 3191
163 Ga0207669_10132009 3300025937 Bacteria 1718
164 Ga0207691_10002827 3300025940 Bacteria 16911
165 Ga0207691_10107965 3300025940 Bacteria 2477
166 Ga0207691_10161139 3300025940 Bacteria 1968
167 Ga0207711_10050880 3300025941 Bacteria 3547
168 Ga0207711_10082160 3300025941 Bacteria 2816
169 Ga0207711_10232376 3300025941 Bacteria 1689
170 Ga0207689_10020102 3300025942 Bacteria 5622
171 Ga0207667_10054525 3300025949 Bacteria 4205
172 Ga0207712_10005418 3300025961 Bacteria 8051
173 Ga0207712_10039760 3300025961 Bacteria 3224
174 Ga0207640_10018492 3300025981 Bacteria 4097
175 Ga0207640_10043227 3300025981 Bacteria 2879
176 Ga0207658_10045750 3300025986 Bacteria 3192
177 Ga0207677_10011384 3300026023 Bacteria 5070
178 Ga0207703_10105232 3300026035 Bacteria 2398
179 Ga0207703_10153438 3300026035 Unclassified 2010
180 Ga0207708_10012873 3300026075 Bacteria 6240
181 Ga0207708_10024302 3300026075 Bacteria 4583
182 Ga0207702_10199503 3300026078 Bacteria 1854
183 Ga0207641_10151226 3300026088 Unclassified 2102
184 Ga0207648_10025319 3300026089 Bacteria 5288
185 Ga0207676_10119786 3300026095 Bacteria 2217
186 Ga0207676_10202756 3300026095 Bacteria 1754
187 Ga0207674_10005242 3300026116 Bacteria 15432
188 Ga0207674_10022334 3300026116 Bacteria 6794
189 Ga0207674_10135909 3300026116 Bacteria 2420
190 Ga0207675_100006707 3300026118 Bacteria 10886
191 Ga0207675_100033008 3300026118 Bacteria 4823
192 Ga0207698_10100248 3300026142 Bacteria 2398
193 Ga0207428_10030144 3300027907 Unclassified 4487
194 Ga0268266_10000653 3300028379 Bacteria 46973
195 Ga0268266_10007630 3300028379 Bacteria 9731
196 Ga0268265_10006088 3300028380 Bacteria 8191
197 Ga0268264_10045652 3300028381 Plasmid 3638
198 Ga0268264_10318261 3300028381 Bacteria 1470
199 Ga0268264_10494456 3300028381 Bacteria 1192
200 Ga0265338_10026813 3300028800 Bacteria 5799
201 Ga0307408_100037335 3300031548 Bacteria 3421
202 Ga0307508_10007195 3300031616 Bacteria 10362
203 Ga0307405_10032560 3300031731 Bacteria 3082
204 Ga0307405_10124370 3300031731 Bacteria 1771
205 Ga0307413_10002275 3300031824 Bacteria 7760
206 Ga0307413_10095989 3300031824 Bacteria 1945
207 Ga0307410_10012270 3300031852 Bacteria 4946
208 Ga0307407_10012140 3300031903 Bacteria 4130
209 Ga0307412_10004400 3300031911 Bacteria 7851
210 Ga0307409_100022376 3300031995 Bacteria 4357
211 Ga0307409_100436524 3300031995 Bacteria 1260
212 Ga0307416_100015007 3300032002 Bacteria 5333
213 Ga0307416_100025129 3300032002 Bacteria 4362
214 Ga0307416_100051469 3300032002 Bacteria 3290
215 Ga0307416_100097645 3300032002 Bacteria 2545
216 Ga0307414_10037827 3300032004 Bacteria 3234
217 Ga0307411_10006725 3300032005 Bacteria 5780
218 Ga0307411_10048627 3300032005 Unclassified 2750
219 Ga0307415_100003439 3300032126 Bacteria 8055
220 Ga0307415_100007170 3300032126 Bacteria 6077
221 Ga0373959_0005433 3300034820 Bacteria 2088
222 Ga0373929_0000553 3300035085 Bacteria 7202
223 Ga0373940_0051430 3300035088 Bacteria 1158
224 Ga0373952_0002056 3300035092 Bacteria 3623
225 Ga0373932_0003135 3300035112 Bacteria 4026
226 Ga0373939_0001444 3300035114 Bacteria 5752
227 Ga0373960_0002783 3300035121 Bacteria 3961
228 Ga0373955_0000640 3300035172 Bacteria 14958
229 Ga0373942_0002249 3300035207 Bacteria 4734
230 Ga0373961_0005819 3300035241 Bacteria 2961
231 Ga0373962_0031237 3300035242 Bacteria 1460
232 Ga0373924_0031043 3300035410 Bacteria 2146
233 Ga0373931_0038463 3300035691 Bacteria 2502
234 Ga0373935_0019258 3300035692 Bacteria 4163
235 Ga0373927_0000419 3300035695 Bacteria 32608
236 Ga0373927_0184236 3300035695 Bacteria 1370
237 Ga0373927_0223067 3300035695 Bacteria 1238
238 Ga0373925_0013435 3300037068 Bacteria 5926
239 Ga0373925_0038478 3300037068 Bacteria 3537
240 Ga0439457_049780 3300042014 Bacteria 940
241 Ga0439460_0030572 3300042461 Bacteria 1532
242 Ga0466965_0094085 3300044683 Bacteria 1527
243 Ga0451576_0006871 3300045051 Bacteria 13784
244 Ga0451576_0065554 3300045051 Bacteria 3781
245 Ga0495603_0093997 3300046455 Bacteria 1752
246 Ga0495629_0028912 3300046459 Bacteria 3935
247 Ga0495629_0204216 3300046459 Bacteria 1366
248 Ga0495638_0000953 3300046460 Bacteria 29358
249 Ga0495605_0001474 3300046474 Bacteria 15363
250 Ga0495583_0012759 3300046506 Bacteria 4732
251 Ga0495630_0098562 3300046517 Bacteria 2211
252 Ga0495631_0012885 3300046518 Bacteria 4071
253 Ga0495632_0013526 3300046519 Bacteria 4654
254 Ga0495586_0003006 3300046535 Bacteria 9094
255 Ga0495609_0008203 3300046538 Bacteria 5126
256 Ga0495668_0003159 3300046616 Bacteria 12699
257 Ga0495625_0005331 3300046660 Bacteria 11778
258 Ga0495657_0084752 3300046675 Bacteria 2044
259 Ga0495623_0145679 3300046679 Bacteria 1405
260 Ga0495658_0172067 3300046683 Bacteria 1341
261 Ga0495670_0003394 3300046691 Bacteria 7829
262 Ga0495660_0032206 3300046810 Bacteria 2944
263 Ga0495674_0233067 3300047319 Bacteria 1519
264 Ga0495674_0274571 3300047319 Bacteria 1382
265 Ga0495672_0002520 3300047320 Bacteria 16725
266 Ga0495684_0303851 3300047471 Bacteria 1145
267 Ga0495602_0028061 3300048088 Bacteria 5396
268 Ga0496102_0374832 3300048905 Bacteria 1339
269 Ga0496103_0070617 3300048906 Bacteria 2185
270 Ga0496105_0098815 3300048908 Bacteria 2410
271 Ga0496106_0135288 3300048909 Bacteria 1935
272 Ga0496108_0020168 3300048911 Bacteria 5479
273 Ga0496110_0337308 3300048913 Bacteria 1373
274 Ga0496113_0057966 3300048916 Unclassified 2913
275 Ga0496114_0000001 3300048917 Bacteria 893286
276 Ga0496114_0167920 3300048917 Bacteria 1911
277 Ga0501039_0048567 3300049575 Bacteria 3281
278 Ga0501048_0056525 3300049582 Bacteria 2784
279 Ga0501067_0008695 3300049583 Bacteria 5624
280 Ga0501071_0177129 3300049587 Bacteria 1597
281 Ga0501072_0026569 3300049588 Bacteria 4514
282 Ga0501073_0254692 3300049589 Bacteria 1212
283 Ga0501075_0001557 3300049591 Bacteria 14966
284 Ga0501207_030057 3300049654 Bacteria 909
285 Ga0501216_001161 3300049660 Bacteria 3473
286 Ga0501216_005325 3300049660 Bacteria 1935
287 Ga0501217_001305 3300049661 Bacteria 4636
288 Ga0501223_001853 3300049663 Bacteria 4775
289 Ga0501227_001351 3300049665 Bacteria 5506
290 Ga0501235_001539 3300049669 Unclassified 4940
291 Ga0501253_015277 3300049683 Bacteria 1258
292 Ga0501221_026781 3300049704 Bacteria 1174
293 Ga0501225_0003274 3300049705 Unclassified 4943
294 Ga0501080_0013981 3300049742 Bacteria 7388
295 Ga0501045_0141775 3300049824 Bacteria 1787
296 Ga0501212_013710 3300049851 Bacteria 1192
297 nmdc:mga05p37_1832_c1 3300050507 Bacteria 24795
298 nmdc:mga05p37_30948_c2 3300050507 Unclassified 1760
299 nmdc:mga05p37_313400_c1 3300050507 Bacteria 1859
300 nmdc:mga09592_272039_c1 3300050508 Bacteria 1469
301 nmdc:mga09592_341549_c1 3300050508 Unclassified 1296
302 nmdc:mga06r32_59759_c1 3300050510 Bacteria 3667
303 nmdc:mga08y16_136621_c1 3300050511 Bacteria 2548
304 nmdc:mga08y16_2019_c1 3300050511 Bacteria 20757
305 nmdc:mga08y16_361133_c1 3300050511 Bacteria 1491
306 nmdc:mga0n895_60870_c1 3300050512 Bacteria 3726
307 nmdc:mga0n895_680309_c1 3300050512 Bacteria 1026
308 nmdc:mga0rr50_100397_c1 3300050513 Bacteria 2273
309 nmdc:mga0rr50_14829_c1 3300050513 Bacteria 5127
310 nmdc:mga08x19_17440_c2 3300050514 Bacteria 2146
311 nmdc:mga0a205_114572_c1 3300050515 Bacteria 2594
312 nmdc:mga0a205_53118_c1 3300050515 Bacteria 3910
313 Ga0495601_0117860 3300053077 Bacteria 1723
314 Ga0500557_003467 3300053105 Bacteria 3135
315 Ga0500569_007398 3300053109 Bacteria 2462
316 Ga0500594_0001767 3300053118 Bacteria 4704
317 Ga0500608_032830 3300053122 Bacteria 2468
318 Ga0500577_0026989 3300053142 Bacteria 1961
319 Ga0500588_0013233 3300053146 Bacteria 2066
320 Ga0500622_0000821 3300053156 Bacteria 26574
321 Ga0590075_015836 3300059424 Bacteria 1852
322 Ga0501082_0001539 3300060353 Bacteria 20295

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046675 Ga0495657_0084752 Ga0495657_0084752_1171_2016 267
2 3300049654 Ga0501207_030057 Ga0501207_030057_36_851 270
3 3300005549 Ga0070704_100126237 Ga0070704_1001262373 273
4 3300048916 Ga0496113_0057966 Ga0496113_0057966_2061_2903 274
5 3300049824 Ga0501045_0141775 Ga0501045_0141775_923_1765 277
6 3300013308 Ga0157375_10062300 Ga0157375_100623005 278
7 3300042014 Ga0439457_049780 Ga0439457_049780_60_917 278
8 3300050512 nmdc:mga0n895_680309_c1 nmdc:mga0n895_680309_c1_170_1012 278
9 3300005338 Ga0068868_100267717 Ga0068868_1002677171 309
10 3300048905 Ga0496102_0374832 Ga0496102_0374832_200_1207 311
11 3300028800 Ga0265338_10026813 Ga0265338_100268135 313
12 3300002077 JGI24744J21845_10010659 JGI24744J21845_100106592 316
13 3300005293 Ga0065715_10141237 Ga0065715_101412372 316
14 3300005331 Ga0070670_100024053 Ga0070670_1000240532 316
15 3300025315 Ga0207697_10000087 Ga0207697_1000008724 316
16 3300025901 Ga0207688_10002523 Ga0207688_100025235 316
17 3300026023 Ga0207677_10011384 Ga0207677_100113842 316
18 3300005330 Ga0070690_100010451 Ga0070690_1000104513 317
19 3300005335 Ga0070666_10002969 Ga0070666_100029694 317
20 3300005343 Ga0070687_100072647 Ga0070687_1000726472 317
21 3300005544 Ga0070686_100002631 Ga0070686_1000026312 317
22 3300005578 Ga0068854_100103648 Ga0068854_1001036482 317
23 3300005578 Ga0068854_100145798 Ga0068854_1001457982 317
24 3300007076 Ga0075435_100001160 Ga0075435_10000116017 317
25 3300009093 Ga0105240_10054655 Ga0105240_100546552 317
26 3300009093 Ga0105240_10059839 Ga0105240_100598393 317
27 3300009177 Ga0105248_10079503 Ga0105248_100795032 317
28 3300025913 Ga0207695_10120177 Ga0207695_101201771 317
29 3300025918 Ga0207662_10093692 Ga0207662_100936922 317
30 3300025933 Ga0207706_10355036 Ga0207706_103550361 317
31 3300025981 Ga0207640_10043227 Ga0207640_100432271 317
32 3300034820 Ga0373959_0005433 Ga0373959_0005433_38_1000 317
33 3300035085 Ga0373929_0000553 Ga0373929_0000553_23_985 317
34 3300035088 Ga0373940_0051430 Ga0373940_0051430_92_1054 317
35 3300035092 Ga0373952_0002056 Ga0373952_0002056_876_1838 317
36 3300035112 Ga0373932_0003135 Ga0373932_0003135_82_1044 317
37 3300035114 Ga0373939_0001444 Ga0373939_0001444_193_1155 317
38 3300035121 Ga0373960_0002783 Ga0373960_0002783_2948_3910 317
39 3300035207 Ga0373942_0002249 Ga0373942_0002249_1125_2087 317
40 3300035242 Ga0373962_0031237 Ga0373962_0031237_193_1155 317
41 3300035691 Ga0373931_0038463 Ga0373931_0038463_1487_2449 317
42 3300045051 Ga0451576_0006871 Ga0451576_0006871_6659_7621 317
43 3300048906 Ga0496103_0070617 Ga0496103_0070617_939_1901 317
44 3300050513 nmdc:mga0rr50_100397_c1 nmdc:mga0rr50_100397_c1_600_1562 317
45 3300050513 nmdc:mga0rr50_14829_c1 nmdc:mga0rr50_14829_c1_84_1046 317
46 3300005466 Ga0070685_10002474 Ga0070685_100024746 318
47 3300005548 Ga0070665_100000351 Ga0070665_10000035136 318
48 3300006844 Ga0075428_100008473 Ga0075428_1000084733 318
49 3300009094 Ga0111539_10046527 Ga0111539_100465276 318
50 3300009147 Ga0114129_10059999 Ga0114129_100599993 318
51 3300028379 Ga0268266_10000653 Ga0268266_1000065311 318
52 3300046679 Ga0495623_0145679 Ga0495623_0145679_217_1224 318
53 3300048088 Ga0495602_0028061 Ga0495602_0028061_1021_2028 318
54 3300050511 nmdc:mga08y16_136621_c1 nmdc:mga08y16_136621_c1_680_1675 318
55 3300053122 Ga0500608_032830 Ga0500608_032830_39_1109 318
56 3300005262 Ga0065165_1002490 Ga0065165_10024907 319
57 3300005331 Ga0070670_100001104 Ga0070670_10000110411 319
58 3300005459 Ga0068867_100047274 Ga0068867_1000472743 319
59 3300005618 Ga0068864_100190913 Ga0068864_1001909132 319
60 3300028381 Ga0268264_10494456 Ga0268264_104944561 319
61 3300044683 Ga0466965_0094085 Ga0466965_0094085_301_1323 319
62 3300046460 Ga0495638_0000953 Ga0495638_0000953_7889_8911 319
63 3300046474 Ga0495605_0001474 Ga0495605_0001474_2309_3331 319
64 3300046506 Ga0495583_0012759 Ga0495583_0012759_97_1119 319
65 3300046518 Ga0495631_0012885 Ga0495631_0012885_1488_2510 319
66 3300046519 Ga0495632_0013526 Ga0495632_0013526_13_1035 319
67 3300046538 Ga0495609_0008203 Ga0495609_0008203_2719_3741 319
68 3300046616 Ga0495668_0003159 Ga0495668_0003159_7876_8898 319
69 3300046660 Ga0495625_0005331 Ga0495625_0005331_4417_5439 319
70 3300046691 Ga0495670_0003394 Ga0495670_0003394_2920_3942 319
71 3300046810 Ga0495660_0032206 Ga0495660_0032206_706_1728 319
72 3300053105 Ga0500557_003467 Ga0500557_003467_932_1954 319
73 3300053109 Ga0500569_007398 Ga0500569_007398_805_1827 319
74 3300053118 Ga0500594_0001767 Ga0500594_0001767_2213_3235 319
75 3300053142 Ga0500577_0026989 Ga0500577_0026989_802_1824 319
76 3300053146 Ga0500588_0013233 Ga0500588_0013233_85_1107 319
77 3300005355 Ga0070671_100085981 Ga0070671_1000859812 320
78 3300005356 Ga0070674_100016582 Ga0070674_1000165823 320
79 3300005548 Ga0070665_100027861 Ga0070665_1000278614 320
80 3300005842 Ga0068858_100126548 Ga0068858_1001265482 320
81 3300009177 Ga0105248_10072879 Ga0105248_100728792 320
82 3300025937 Ga0207669_10025638 Ga0207669_100256383 320
83 3300025941 Ga0207711_10082160 Ga0207711_100821603 320
84 3300028379 Ga0268266_10007630 Ga0268266_100076309 320
85 3300035410 Ga0373924_0031043 Ga0373924_0031043_1119_2108 320
86 3300037068 Ga0373925_0038478 Ga0373925_0038478_2512_3501 320
87 3300046683 Ga0495658_0172067 Ga0495658_0172067_148_1137 320
88 3300047319 Ga0495674_0274571 Ga0495674_0274571_149_1138 320
89 3300048917 Ga0496114_0167920 Ga0496114_0167920_583_1572 320
90 3300053077 Ga0495601_0117860 Ga0495601_0117860_505_1494 320
91 3300059424 Ga0590075_015836 Ga0590075_015836_284_1288 320
92 3300031824 Ga0307413_10095989 Ga0307413_100959892 321
93 3300031995 Ga0307409_100436524 Ga0307409_1004365241 321
94 3300032002 Ga0307416_100015007 Ga0307416_1000150072 321
95 3300035695 Ga0373927_0000419 Ga0373927_0000419_9308_10336 321
96 3300037068 Ga0373925_0013435 Ga0373925_0013435_433_1461 321
97 3300049660 Ga0501216_001161 Ga0501216_001161_2451_3419 321
98 3300049661 Ga0501217_001305 Ga0501217_001305_3307_4275 321
99 3300049663 Ga0501223_001853 Ga0501223_001853_936_1904 321
100 3300049665 Ga0501227_001351 Ga0501227_001351_643_1611 321
101 3300049669 Ga0501235_001539 Ga0501235_001539_138_1106 321
102 3300049683 Ga0501253_015277 Ga0501253_015277_173_1141 321
103 3300049705 Ga0501225_0003274 Ga0501225_0003274_55_1023 321
104 3300049851 Ga0501212_013710 Ga0501212_013710_72_1040 321
105 3300053156 Ga0500622_0000821 Ga0500622_0000821_7661_8683 321
106 3300049583 Ga0501067_0008695 Ga0501067_0008695_2446_3435 323
107 3300049591 Ga0501075_0001557 Ga0501075_0001557_569_1558 323
108 3300049742 Ga0501080_0013981 Ga0501080_0013981_1141_2130 323
109 3300060353 Ga0501082_0001539 Ga0501082_0001539_12128_13117 323
110 3300014326 Ga0157380_10521856 Ga0157380_105218562 324
111 3300025933 Ga0207706_10359730 Ga0207706_103597301 324
112 3300035695 Ga0373927_0184236 Ga0373927_0184236_349_1341 324
113 3300046535 Ga0495586_0003006 Ga0495586_0003006_7399_8391 324
114 3300005337 Ga0070682_100001017 Ga0070682_1000010178 325
115 3300005440 Ga0070705_100003079 Ga0070705_1000030794 325
116 3300005547 Ga0070693_100011930 Ga0070693_1000119304 325
117 3300005615 Ga0070702_100012927 Ga0070702_1000129273 325
118 3300005617 Ga0068859_100123208 Ga0068859_1001232082 325
119 3300005834 Ga0068851_10003596 Ga0068851_100035962 325
120 3300005842 Ga0068858_100121790 Ga0068858_1001217904 325
121 3300006931 Ga0097620_100123215 Ga0097620_1001232152 325
122 3300009545 Ga0105237_10000264 Ga0105237_1000026411 325
123 3300025321 Ga0207656_10012051 Ga0207656_100120513 325
124 3300025914 Ga0207671_10001408 Ga0207671_1000140812 325
125 3300047320 Ga0495672_0002520 Ga0495672_0002520_8558_9541 325
126 3300009094 Ga0111539_10488141 Ga0111539_104881412 326
127 3300035172 Ga0373955_0000640 Ga0373955_0000640_9879_10871 326
128 3300046517 Ga0495630_0098562 Ga0495630_0098562_823_1815 326
129 3300047319 Ga0495674_0233067 Ga0495674_0233067_85_1077 326
130 3300047471 Ga0495684_0303851 Ga0495684_0303851_52_1044 326
131 3300050511 nmdc:mga08y16_361133_c1 nmdc:mga08y16_361133_c1_365_1375 326
132 3300025919 Ga0207657_10103884 Ga0207657_101038842 328
133 3300025986 Ga0207658_10045750 Ga0207658_100457502 328
134 3300026089 Ga0207648_10025319 Ga0207648_100253193 328
135 3300031616 Ga0307508_10007195 Ga0307508_100071958 328
136 3300031731 Ga0307405_10124370 Ga0307405_101243702 328
137 3300032002 Ga0307416_100051469 Ga0307416_1000514693 328
138 3300032005 Ga0307411_10048627 Ga0307411_100486273 328
139 3300032126 Ga0307415_100007170 Ga0307415_1000071705 328
140 3300035241 Ga0373961_0005819 Ga0373961_0005819_1263_2276 328
141 3300035692 Ga0373935_0019258 Ga0373935_0019258_1496_2518 328
142 3300048908 Ga0496105_0098815 Ga0496105_0098815_1274_2317 328
143 3300048917 Ga0496114_0000001 Ga0496114_0000001_36717_37760 328
144 3300049588 Ga0501072_0026569 Ga0501072_0026569_3015_4022 328
145 3300049589 Ga0501073_0254692 Ga0501073_0254692_131_1138 328
146 3300049660 Ga0501216_005325 Ga0501216_005325_281_1270 328
147 3300049704 Ga0501221_026781 Ga0501221_026781_135_1124 328
148 3300005328 Ga0070676_10049292 Ga0070676_100492924 329
149 3300005335 Ga0070666_10167939 Ga0070666_101679392 329
150 3300005335 Ga0070666_10197935 Ga0070666_101979352 329
151 3300005338 Ga0068868_100111046 Ga0068868_1001110462 329
152 3300005343 Ga0070687_100004547 Ga0070687_1000045474 329
153 3300005347 Ga0070668_100000444 Ga0070668_10000044420 329
154 3300005353 Ga0070669_100004745 Ga0070669_1000047454 329
155 3300005353 Ga0070669_100013244 Ga0070669_1000132443 329
156 3300005365 Ga0070688_100109139 Ga0070688_1001091392 329
157 3300005366 Ga0070659_100007802 Ga0070659_1000078026 329
158 3300005367 Ga0070667_100405323 Ga0070667_1004053231 329
159 3300005438 Ga0070701_10020120 Ga0070701_100201202 329
160 3300005441 Ga0070700_100039749 Ga0070700_1000397493 329
161 3300005457 Ga0070662_100120723 Ga0070662_1001207232 329
162 3300005535 Ga0070684_100004637 Ga0070684_1000046378 329
163 3300005539 Ga0068853_100086098 Ga0068853_1000860982 329
164 3300005543 Ga0070672_100012865 Ga0070672_1000128652 329
165 3300005543 Ga0070672_100019134 Ga0070672_1000191344 329
166 3300005548 Ga0070665_100070208 Ga0070665_1000702083 329
167 3300005564 Ga0070664_100449811 Ga0070664_1004498111 329
168 3300005577 Ga0068857_100004471 Ga0068857_10000447112 329
169 3300005577 Ga0068857_100026841 Ga0068857_1000268412 329
170 3300005719 Ga0068861_100031826 Ga0068861_1000318264 329
171 3300005834 Ga0068851_10081486 Ga0068851_100814862 329
172 3300005840 Ga0068870_10002385 Ga0068870_100023856 329
173 3300005841 Ga0068863_100070252 Ga0068863_1000702523 329
174 3300005843 Ga0068860_100477600 Ga0068860_1004776002 329
175 3300005844 Ga0068862_100002846 Ga0068862_1000028463 329
176 3300005844 Ga0068862_100095604 Ga0068862_1000956043 329
177 3300006237 Ga0097621_100030984 Ga0097621_1000309842 329
178 3300006847 Ga0075431_100320267 Ga0075431_1003202672 329
179 3300006852 Ga0075433_10014226 Ga0075433_100142262 329
180 3300006852 Ga0075433_10054476 Ga0075433_100544764 329
181 3300006871 Ga0075434_100009945 Ga0075434_1000099459 329
182 3300006880 Ga0075429_100066448 Ga0075429_1000664483 329
183 3300006881 Ga0068865_100021287 Ga0068865_1000212874 329
184 3300006931 Ga0097620_100632591 Ga0097620_1006325911 329
185 3300009147 Ga0114129_10221219 Ga0114129_102212192 329
186 3300009147 Ga0114129_10542535 Ga0114129_105425352 329
187 3300009177 Ga0105248_10035292 Ga0105248_100352923 329
188 3300009553 Ga0105249_10001951 Ga0105249_1000195110 329
189 3300013306 Ga0163162_10072903 Ga0163162_100729032 329
190 3300013307 Ga0157372_10368188 Ga0157372_103681882 329
191 3300014325 Ga0163163_10181568 Ga0163163_101815682 329
192 3300014326 Ga0157380_10008320 Ga0157380_100083203 329
193 3300014326 Ga0157380_10013385 Ga0157380_100133855 329
194 3300014326 Ga0157380_10079432 Ga0157380_100794322 329
195 3300014745 Ga0157377_10009350 Ga0157377_100093504 329
196 3300014968 Ga0157379_10030360 Ga0157379_100303603 329
197 3300025903 Ga0207680_10078891 Ga0207680_100788912 329
198 3300025907 Ga0207645_10000687 Ga0207645_1000068720 329
199 3300025908 Ga0207643_10006127 Ga0207643_100061273 329
200 3300025915 Ga0207693_10095906 Ga0207693_100959064 329
201 3300025918 Ga0207662_10018722 Ga0207662_100187223 329
202 3300025923 Ga0207681_10028029 Ga0207681_100280294 329
203 3300025933 Ga0207706_10003592 Ga0207706_100035928 329
204 3300025933 Ga0207706_10039843 Ga0207706_100398433 329
205 3300025937 Ga0207669_10132009 Ga0207669_101320092 329
206 3300025940 Ga0207691_10002827 Ga0207691_1000282713 329
207 3300025940 Ga0207691_10107965 Ga0207691_101079652 329
208 3300025940 Ga0207691_10161139 Ga0207691_101611392 329
209 3300025941 Ga0207711_10232376 Ga0207711_102323762 329
210 3300025942 Ga0207689_10020102 Ga0207689_100201023 329
211 3300025949 Ga0207667_10054525 Ga0207667_100545253 329
212 3300025961 Ga0207712_10005418 Ga0207712_100054189 329
213 3300026035 Ga0207703_10105232 Ga0207703_101052322 329
214 3300026075 Ga0207708_10024302 Ga0207708_100243022 329
215 3300026078 Ga0207702_10199503 Ga0207702_101995032 329
216 3300026095 Ga0207676_10202756 Ga0207676_102027562 329
217 3300026116 Ga0207674_10005242 Ga0207674_1000524211 329
218 3300026116 Ga0207674_10022334 Ga0207674_100223343 329
219 3300026118 Ga0207675_100006707 Ga0207675_1000067078 329
220 3300026118 Ga0207675_100033008 Ga0207675_1000330082 329
221 3300026142 Ga0207698_10100248 Ga0207698_101002481 329
222 3300028380 Ga0268265_10006088 Ga0268265_100060882 329
223 3300031548 Ga0307408_100037335 Ga0307408_1000373354 329
224 3300031731 Ga0307405_10032560 Ga0307405_100325602 329
225 3300031824 Ga0307413_10002275 Ga0307413_100022755 329
226 3300031852 Ga0307410_10012270 Ga0307410_100122703 329
227 3300031903 Ga0307407_10012140 Ga0307407_100121402 329
228 3300031911 Ga0307412_10004400 Ga0307412_100044004 329
229 3300031995 Ga0307409_100022376 Ga0307409_1000223764 329
230 3300032002 Ga0307416_100025129 Ga0307416_1000251294 329
231 3300032002 Ga0307416_100097645 Ga0307416_1000976451 329
232 3300032004 Ga0307414_10037827 Ga0307414_100378272 329
233 3300032005 Ga0307411_10006725 Ga0307411_100067253 329
234 3300032126 Ga0307415_100003439 Ga0307415_1000034396 329
235 3300035695 Ga0373927_0223067 Ga0373927_0223067_174_1190 329
236 3300042461 Ga0439460_0030572 Ga0439460_0030572_151_1170 329
237 3300045051 Ga0451576_0065554 Ga0451576_0065554_802_1818 329
238 3300046455 Ga0495603_0093997 Ga0495603_0093997_460_1509 329
239 3300046459 Ga0495629_0028912 Ga0495629_0028912_983_2032 329
240 3300046459 Ga0495629_0204216 Ga0495629_0204216_41_1057 329
241 3300048909 Ga0496106_0135288 Ga0496106_0135288_456_1517 329
242 3300048911 Ga0496108_0020168 Ga0496108_0020168_448_1545 329
243 3300049575 Ga0501039_0048567 Ga0501039_0048567_994_2016 329
244 3300049582 Ga0501048_0056525 Ga0501048_0056525_185_1207 329
245 3300049587 Ga0501071_0177129 Ga0501071_0177129_302_1324 329
246 3300050507 nmdc:mga05p37_1832_c1 nmdc:mga05p37_1832_c1_14214_15236 329
247 3300050507 nmdc:mga05p37_30948_c2 nmdc:mga05p37_30948_c2_547_1563 329
248 3300050507 nmdc:mga05p37_313400_c1 nmdc:mga05p37_313400_c1_684_1694 329
249 3300050508 nmdc:mga09592_272039_c1 nmdc:mga09592_272039_c1_236_1246 329
250 3300050508 nmdc:mga09592_341549_c1 nmdc:mga09592_341549_c1_141_1172 329
251 3300050512 nmdc:mga0n895_60870_c1 nmdc:mga0n895_60870_c1_1302_2318 329
252 3300050515 nmdc:mga0a205_53118_c1 nmdc:mga0a205_53118_c1_847_1863 329
253 3300005345 Ga0070692_10058412 Ga0070692_100584123 330
254 3300005544 Ga0070686_100075805 Ga0070686_1000758052 330
255 3300005842 Ga0068858_100132637 Ga0068858_1001326374 330
256 3300006847 Ga0075431_100030722 Ga0075431_1000307223 330
257 3300050510 nmdc:mga06r32_59759_c1 nmdc:mga06r32_59759_c1_966_1982 330
258 2162886007 SwRhRL2b_contig_2891936 SwRhRL2b_0869.00008040 331
259 3300002459 JGI24751J29686_10000010 JGI24751J29686_1000001036 331
260 3300005289 Ga0065704_10005815 Ga0065704_100058154 331
261 3300005293 Ga0065715_10000428 Ga0065715_100004289 331
262 3300005295 Ga0065707_10162539 Ga0065707_101625392 331
263 3300005331 Ga0070670_100000172 Ga0070670_10000017216 331
264 3300005354 Ga0070675_100249148 Ga0070675_1002491482 331
265 3300005366 Ga0070659_100056305 Ga0070659_1000563054 331
266 3300005444 Ga0070694_100011976 Ga0070694_1000119766 331
267 3300005518 Ga0070699_100125875 Ga0070699_1001258752 331
268 3300005539 Ga0068853_100035071 Ga0068853_1000350715 331
269 3300005545 Ga0070695_100021902 Ga0070695_1000219025 331
270 3300005545 Ga0070695_100209716 Ga0070695_1002097162 331
271 3300005547 Ga0070693_100012938 Ga0070693_1000129384 331
272 3300005564 Ga0070664_100382810 Ga0070664_1003828101 331
273 3300005577 Ga0068857_100199538 Ga0068857_1001995383 331
274 3300005578 Ga0068854_100108340 Ga0068854_1001083403 331
275 3300005615 Ga0070702_100000912 Ga0070702_1000009125 331
276 3300005615 Ga0070702_100242253 Ga0070702_1002422531 331
277 3300005617 Ga0068859_100213736 Ga0068859_1002137362 331
278 3300005617 Ga0068859_100229435 Ga0068859_1002294352 331
279 3300005841 Ga0068863_100169775 Ga0068863_1001697752 331
280 3300005842 Ga0068858_100117549 Ga0068858_1001175493 331
281 3300005843 Ga0068860_100054702 Ga0068860_1000547025 331
282 3300005843 Ga0068860_100069876 Ga0068860_1000698763 331
283 3300005844 Ga0068862_100434471 Ga0068862_1004344712 331
284 3300005985 Ga0081539_10001827 Ga0081539_100018273 331
285 3300006237 Ga0097621_100005658 Ga0097621_1000056582 331
286 3300006358 Ga0068871_100071318 Ga0068871_1000713183 331
287 3300006914 Ga0075436_100091135 Ga0075436_1000911352 331
288 3300006931 Ga0097620_100213736 Ga0097620_1002137362 331
289 3300006931 Ga0097620_100229449 Ga0097620_1002294492 331
290 3300009094 Ga0111539_10003668 Ga0111539_1000366810 331
291 3300009148 Ga0105243_10045610 Ga0105243_100456101 331
292 3300009176 Ga0105242_10079558 Ga0105242_100795584 331
293 3300009176 Ga0105242_10335779 Ga0105242_103357792 331
294 3300009545 Ga0105237_10153032 Ga0105237_101530324 331
295 3300009551 Ga0105238_10027419 Ga0105238_100274193 331
296 3300009553 Ga0105249_10007691 Ga0105249_100076919 331
297 3300010375 Ga0105239_10172341 Ga0105239_101723414 331
298 3300013100 Ga0157373_10046217 Ga0157373_100462172 331
299 3300013297 Ga0157378_10430108 Ga0157378_104301081 331
300 3300014325 Ga0163163_10000172 Ga0163163_1000017217 331
301 3300025901 Ga0207688_10204466 Ga0207688_102044661 331
302 3300025904 Ga0207647_10009523 Ga0207647_100095233 331
303 3300025924 Ga0207694_10026028 Ga0207694_100260284 331
304 3300025924 Ga0207694_10042113 Ga0207694_100421134 331
305 3300025925 Ga0207650_10000001 Ga0207650_10000001476 331
306 3300025934 Ga0207686_10053694 Ga0207686_100536942 331
307 3300025935 Ga0207709_10005752 Ga0207709_100057521 331
308 3300025941 Ga0207711_10050880 Ga0207711_100508805 331
309 3300025961 Ga0207712_10039760 Ga0207712_100397604 331
310 3300025981 Ga0207640_10018492 Ga0207640_100184922 331
311 3300026035 Ga0207703_10153438 Ga0207703_101534383 331
312 3300026075 Ga0207708_10012873 Ga0207708_100128735 331
313 3300026088 Ga0207641_10151226 Ga0207641_101512262 331
314 3300026095 Ga0207676_10119786 Ga0207676_101197864 331
315 3300026116 Ga0207674_10135909 Ga0207674_101359093 331
316 3300027907 Ga0207428_10030144 Ga0207428_100301442 331
317 3300028381 Ga0268264_10045652 Ga0268264_100456524 331
318 3300028381 Ga0268264_10318261 Ga0268264_103182611 331
319 3300048913 Ga0496110_0337308 Ga0496110_0337308_92_1087 331
320 3300050511 nmdc:mga08y16_2019_c1 nmdc:mga08y16_2019_c1_634_1629 331
321 3300050514 nmdc:mga08x19_17440_c2 nmdc:mga08x19_17440_c2_128_1123 331
322 3300050515 nmdc:mga0a205_114572_c1 nmdc:mga0a205_114572_c1_1045_2040 331

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03561

Allantoicase

Allantoicase repeat

33

200

0.92

PF03561

Allantoicase

Allantoicase repeat

221

362

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sg3-assembly1.cif.gz_B structure of allantoicase 0.9053 5 327
1o59-assembly1.cif.gz_A crystal structure of allantoicase (yir029w) from saccharomyces cerevisiae at 2.40 a resolution 0.9037 5 328
1sg3-assembly1.cif.gz_A structure of allantoicase 0.9013 5 328
1sg3-assembly1.cif.gz_A structure of allantoicase 0.8445 5 328
1o59-assembly1.cif.gz_A crystal structure of allantoicase (yir029w) from saccharomyces cerevisiae at 2.40 a resolution 0.8441 5 328
ID Description Score Start End Superfamily
af_Q54VL5_6_180_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.9745 4 169 2.60.120.260
af_Q09913_185_341_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.9468 177 331 2.60.120.260
af_Q54VL5_182_341_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.9452 177 330 2.60.120.260
af_Q8N6M5_185_368_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.9172 168 330 2.60.120.260
af_Q5AD02_3_184_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.9156 4 169 2.60.120.260
ID Description Score Start End GO Terms
AF-A0A6F8XY06-F1-model_v4 Allantoicase domain-containing protein 0.9837 1 169 GO:0000256
GO:0004037
AF-A0A317HV08-F1-model_v4 Probable allantoicase (EC 3.5.3.4) (Allantoate amidinohydrolase) 0.9816 1 331 GO:0000256
GO:0004037
GO:0006144
AF-A0A7C7GQT0-F1-model_v4 Allantoicase (EC 3.5.3.4) 0.9779 6 169 GO:0000256
GO:0004037
AF-A0A7Z9SDE7-F1-model_v4 Allantoicase (EC 3.5.3.4) 0.9772 6 148 GO:0000256
GO:0004037
AF-A0A2V8PGD3-F1-model_v4 Allantoicase (EC 3.5.3.4) 0.9766 83 329 GO:0000256
GO:0004037

Feature Viewer

pLDDT pTM Quality
93.13 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map