F406175

General Info

Members Datasets Scaffolds Average Seq Length
321 233 642 210

Family's Representative Sequence

Representative Sequence 3300049591|Ga0501075_0338313|Ga0501075_0338313_214_918
Length 234
Sequence MESIALIDYGAGNLTSVRKAFAAVGAPIFTPRAPGDLRDVRALVVPGVGHFGVTRSLEAGWRDAILARLDAGALLFGICVGMQWLFAGSTEAPDVAGLGRLEGRCERLDECGGTLKVPHVGWNALSIVRPSRLLDSLTSGAYVYFTHSYAAPVTEATTATTGHGRDFAAVVEAGPVMGVQFHPEKSGEAGLTILRNFVRLVRDLPDEAALSGGPAARAQNDPAASASKGESRAR

Samples

Sample ID Description Type Environment
1 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
54 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
87 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
94 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
95 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
99 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
100 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
109 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
112 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
113 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
114 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
121 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
122 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
123 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
124 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
127 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
128 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
129 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
131 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
134 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
135 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
136 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
137 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
138 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
144 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
145 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
146 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
150 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
151 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
152 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
153 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
190 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
191 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
192 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
193 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
194 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
195 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
196 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
197 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
198 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
199 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
200 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
201 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
202 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
203 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
206 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
207 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
208 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
209 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
212 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
213 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
214 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
215 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
216 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
217 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
218 2643221583 Caulobacter sp. Root655 Isolate Unclassified
219 2643221584 Caulobacter sp. Root656 Isolate Unclassified
220 2643221640 Caulobacter sp. Root342 Isolate Unclassified
221 2643221642 Caulobacter sp. Root343 Isolate Unclassified
222 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
223 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
224 2818991435 Caulobacter henricii 536 Isolate Unclassified
225 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
226 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
227 2849560528 Caulobacter zeae 410 Isolate Unclassified
228 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
229 2851153111 Caulobacter radicis 736 Isolate Unclassified
230 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
231 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
232 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
233 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.83
Metatranscriptomes 0
Isolates 7.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.23
Nodule 0
Rhizoplane 2.49
Rhizosphere 64.17
Stem 0
Stem Tuber 0
Unclassified 1.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501075_0338313 3300049591 Bacteria 1147
2 Ga0055526_1033776 3300003771 Bacteria 1413
3 Ga0055524_1013584 3300003775 Bacteria 3066
4 Ga0055524_1017322 3300003775 Bacteria 2545
5 Ga0055536_1020881 3300003781 Bacteria 2007
6 Ga0055536_1020897 3300003781 Bacteria 2006
7 Ga0055528_1029009 3300003790 Bacteria 1511
8 Ga0055530_10001146 3300003791 Bacteria 20621
9 Ga0055530_10005439 3300003791 Bacteria 6057
10 Ga0055530_10017581 3300003791 Bacteria 2236
11 Ga0055531_10011924 3300003794 Bacteria 4137
12 Ga0055531_10021018 3300003794 Bacteria 2552
13 Ga0055531_10048772 3300003794 Bacteria 1138
14 Ga0055543_1008487 3300004625 Bacteria 2272
15 Ga0065165_1001756 3300005262 Bacteria 21578
16 Ga0065165_1002572 3300005262 Bacteria 14970
17 Ga0065712_10080523 3300005290 Bacteria 3096
18 Ga0070658_10391762 3300005327 Bacteria 1192
19 Ga0070670_100331003 3300005331 Bacteria 1336
20 Ga0070668_100026896 3300005347 Bacteria 4367
21 Ga0070669_100001157 3300005353 Bacteria 19280
22 Ga0070669_100091996 3300005353 Bacteria 2276
23 Ga0070675_100409468 3300005354 Bacteria 1211
24 Ga0070671_100001426 3300005355 Bacteria 17856
25 Ga0070674_100024251 3300005356 Bacteria 3935
26 Ga0070667_100070084 3300005367 Bacteria 2984
27 Ga0070701_10246317 3300005438 Bacteria 1077
28 Ga0070705_100132614 3300005440 Unclassified 1627
29 Ga0068853_100026588 3300005539 Bacteria 4860
30 Ga0070665_100022468 3300005548 Bacteria 6348
31 Ga0070665_101202051 3300005548 Bacteria 769
32 Ga0068855_100379672 3300005563 Bacteria 1552
33 Ga0068855_100382652 3300005563 Bacteria 1545
34 Ga0068854_100015841 3300005578 Bacteria 5009
35 Ga0068859_100001326 3300005617 Bacteria 25257
36 Ga0068859_100974463 3300005617 Bacteria 931
37 Ga0068861_100143118 3300005719 Bacteria 1954
38 Ga0068863_100003500 3300005841 Bacteria 15493
39 Ga0068858_100013425 3300005842 Bacteria 7729
40 Ga0068860_100054499 3300005843 Bacteria 3801
41 Ga0068862_100044057 3300005844 Bacteria 3806
42 Ga0068862_100195317 3300005844 Bacteria 1823
43 Ga0081455_10160604 3300005937 Bacteria 1723
44 Ga0075368_10006381 3300006042 Bacteria 4117
45 Ga0075364_10000415 3300006051 Bacteria 21345
46 Ga0075367_10001666 3300006178 Bacteria 9689
47 Ga0075367_10160643 3300006178 Bacteria 1397
48 Ga0075369_10023913 3300006186 Bacteria 2529
49 Ga0075369_10025791 3300006186 Bacteria 2446
50 Ga0075366_10112065 3300006195 Bacteria 1641
51 Ga0075370_10111022 3300006353 Bacteria 1592
52 Ga0075370_10192661 3300006353 Bacteria 1201
53 Ga0075370_10540378 3300006353 Bacteria 704
54 Ga0075433_10018321 3300006852 Bacteria 5817
55 Ga0097620_100001326 3300006931 Bacteria 25257
56 Ga0097620_100974456 3300006931 Bacteria 931
57 Ga0105240_10003768 3300009093 Bacteria 23424
58 Ga0105240_10264272 3300009093 Bacteria 1984
59 Ga0105240_11284634 3300009093 Bacteria 772
60 Ga0111539_10092918 3300009094 Bacteria 3544
61 Ga0105241_10334030 3300009174 Bacteria 1311
62 Ga0105242_10678367 3300009176 Bacteria 1005
63 Ga0105242_11381698 3300009176 Bacteria 731
64 Ga0105248_10000746 3300009177 Bacteria 36566
65 Ga0105248_10038201 3300009177 Bacteria 5373
66 Ga0105248_10391353 3300009177 Bacteria 1565
67 Ga0105237_10506402 3300009545 Bacteria 1214
68 Ga0105249_11107864 3300009553 Bacteria 862
69 Ga0157375_10250062 3300013308 Bacteria 1933
70 Ga0163163_10008395 3300014325 Bacteria 9173
71 Ga0163163_10726841 3300014325 Bacteria 1056
72 Ga0157380_10028962 3300014326 Bacteria 4229
73 Ga0157379_10003580 3300014968 Bacteria 13164
74 Ga0157379_10161237 3300014968 Bacteria 2024
75 Ga0157379_10320311 3300014968 Bacteria 1415
76 Ga0157376_10126614 3300014969 Bacteria 2273
77 Ga0213876_10031537 3300021384 Bacteria 2796
78 Ga0209026_1001508 3300025250 Bacteria 10187
79 Ga0209148_1013339 3300025254 Bacteria 1481
80 Ga0209565_1000172 3300025263 Bacteria 84264
81 Ga0209673_1000451 3300025273 Bacteria 69853
82 Ga0209673_1076629 3300025273 Bacteria 778
83 Ga0209675_1002737 3300025291 Bacteria 8828
84 Ga0209676_1000257 3300025292 Bacteria 112662
85 Ga0209676_1000316 3300025292 Bacteria 94380
86 Ga0209564_1002755 3300025295 Bacteria 13209
87 Ga0209564_1049836 3300025295 Bacteria 1032
88 Ga0209758_1002904 3300025297 Bacteria 16541
89 Ga0209758_1004749 3300025297 Bacteria 11026
90 Ga0209758_1059545 3300025297 Bacteria 1270
91 Ga0209050_1000053 3300025298 Bacteria 349521
92 Ga0209050_1001072 3300025298 Bacteria 33540
93 Ga0209050_1001742 3300025298 Bacteria 21662
94 Ga0209256_1005059 3300025299 Bacteria 7845
95 Ga0209256_1009231 3300025299 Bacteria 4366
96 Ga0209256_1020143 3300025299 Bacteria 2094
97 Ga0209051_1001158 3300025303 Bacteria 23974
98 Ga0209257_1000192 3300025304 Bacteria 151851
99 Ga0209257_1000419 3300025304 Bacteria 81956
100 Ga0209257_1000541 3300025304 Bacteria 64943
101 Ga0209257_1023531 3300025304 Bacteria 2163
102 Ga0207695_10001168 3300025913 Bacteria 45314
103 Ga0207695_10191631 3300025913 Bacteria 1962
104 Ga0207681_10100327 3300025923 Bacteria 2086
105 Ga0207694_10009138 3300025924 Bacteria 7481
106 Ga0207650_10014453 3300025925 Bacteria 5488
107 Ga0207659_10470765 3300025926 Bacteria 1060
108 Ga0207644_10017992 3300025931 Bacteria 4778
109 Ga0207706_10219679 3300025933 Bacteria 1664
110 Ga0207711_10005910 3300025941 Bacteria 10337
111 Ga0207668_10126017 3300025972 Bacteria 1947
112 Ga0207640_10021064 3300025981 Bacteria 3879
113 Ga0207640_10654389 3300025981 Bacteria 896
114 Ga0207658_10047399 3300025986 Bacteria 3145
115 Ga0207658_10400691 3300025986 Bacteria 1206
116 Ga0207703_10013736 3300026035 Bacteria 6312
117 Ga0207639_10031715 3300026041 Bacteria 3886
118 Ga0207678_10142959 3300026067 Bacteria 2042
119 Ga0207678_10353343 3300026067 Bacteria 1268
120 Ga0207641_10031831 3300026088 Bacteria 4376
121 Ga0207675_100007871 3300026118 Bacteria 10056
122 Ga0209974_10039810 3300027876 Bacteria 1563
123 Ga0207428_10429800 3300027907 Bacteria 964
124 Ga0268266_10042003 3300028379 Bacteria 3904
125 Ga0268265_10007523 3300028380 Bacteria 7353
126 Ga0268265_10295874 3300028380 Bacteria 1455
127 Ga0268264_10134015 3300028381 Bacteria 2200
128 Ga0265337_1012066 3300028556 Bacteria 2950
129 Ga0307517_10122857 3300028786 Bacteria 1910
130 Ga0307515_10136703 3300028794 Bacteria 2659
131 Ga0307515_10235930 3300028794 Bacteria 1610
132 Ga0265338_10013313 3300028800 Bacteria 9296
133 Ga0265327_10002865 3300031251 Bacteria 17361
134 Ga0307513_10000053 3300031456 Bacteria 149356
135 Ga0307513_10539524 3300031456 Bacteria 880
136 Ga0265314_10102472 3300031711 Bacteria 1837
137 Ga0316576_10006145 3300031727 Bacteria 7440
138 Ga0316576_10459551 3300031727 Bacteria 939
139 Ga0316578_10065685 3300031728 Bacteria 2142
140 Ga0316577_10340828 3300031733 Bacteria 850
141 Ga0307409_100529277 3300031995 Bacteria 1153
142 Ga0307411_10069626 3300032005 Bacteria 2377
143 Ga0316585_10085390 3300032137 Bacteria 1030
144 Ga0373940_0148635 3300035088 Bacteria 745
145 Ga0373936_0025853 3300035113 Bacteria 2297
146 Ga0316574_0385627 3300035398 Bacteria 883
147 Ga0373927_0000111 3300035695 Bacteria 62031
148 Ga0373927_0222770 3300035695 Bacteria 1239
149 Ga0373947_0114079 3300035725 Bacteria 1711
150 Ga0316582_0426011 3300036647 Bacteria 914
151 Ga0316584_0394763 3300036712 Bacteria 986
152 Ga0395905_0414192 3300037471 Bacteria 1243
153 Ga0436365_1818853 3300039437 Bacteria 4407
154 Ga0439461_0045828 3300041410 Bacteria 957
155 Ga0439465_0023892 3300041413 Bacteria 1925
156 Ga0451853_3145100 3300041512 Bacteria 1548
157 Ga0439441_011066 3300042001 Bacteria 1525
158 Ga0439435_0021701 3300042436 Bacteria 1669
159 Ga0439459_0001583 3300042438 Bacteria 3386
160 Ga0450893_0013903 3300042532 Bacteria 1345
161 Ga0466965_0088394 3300044683 Bacteria 1574
162 Ga0466965_0101971 3300044683 Bacteria 1468
163 Ga0466968_0294975 3300044735 Bacteria 779
164 Ga0451576_0010859 3300045051 Bacteria 10423
165 Ga0495627_000982 3300046453 Bacteria 19454
166 Ga0495592_0154041 3300046454 Bacteria 1587
167 Ga0495590_0003316 3300046457 Bacteria 6591
168 Ga0495638_0000987 3300046460 Bacteria 28615
169 Ga0495638_0005412 3300046460 Bacteria 9502
170 Ga0495638_0008109 3300046460 Bacteria 7470
171 Ga0495638_0018542 3300046460 Bacteria 4620
172 Ga0495638_0073350 3300046460 Bacteria 2089
173 Ga0495650_0000168 3300046471 Bacteria 145714
174 Ga0495650_0044959 3300046471 Bacteria 1862
175 Ga0495607_0129855 3300046501 Bacteria 1312
176 Ga0495583_0000003 3300046506 Bacteria 709273
177 Ga0495606_0019013 3300046507 Bacteria 5130
178 Ga0495606_0067325 3300046507 Bacteria 2268
179 Ga0495610_0000304 3300046512 Bacteria 51895
180 Ga0495610_0000327 3300046512 Bacteria 50683
181 Ga0495610_0006741 3300046512 Bacteria 7802
182 Ga0495616_0002651 3300046513 Bacteria 11747
183 Ga0495620_0013548 3300046515 Bacteria 4172
184 Ga0495631_0070113 3300046518 Bacteria 1515
185 Ga0495632_0008092 3300046519 Bacteria 6509
186 Ga0495632_0156965 3300046519 Bacteria 1049
187 Ga0495637_0005325 3300046520 Bacteria 6581
188 Ga0495643_0120168 3300046522 Bacteria 1328
189 Ga0495644_0167333 3300046523 Bacteria 844
190 Ga0495648_0000107 3300046524 Bacteria 104376
191 Ga0495648_0066732 3300046524 Bacteria 2108
192 Ga0495648_0140056 3300046524 Bacteria 1274
193 Ga0495648_0173119 3300046524 Bacteria 1104
194 Ga0495654_0000085 3300046530 Bacteria 107010
195 Ga0495609_0161569 3300046538 Bacteria 949
196 Ga0495621_0085626 3300046539 Bacteria 1181
197 Ga0495597_0067789 3300046542 Bacteria 1543
198 Ga0495668_0000746 3300046616 Bacteria 38674
199 Ga0495668_0040468 3300046616 Bacteria 2598
200 Ga0495668_0086953 3300046616 Bacteria 1714
201 Ga0495668_0145181 3300046616 Bacteria 1299
202 Ga0495625_0000767 3300046660 Bacteria 44760
203 Ga0495625_0196249 3300046660 Bacteria 1334
204 Ga0495625_0287220 3300046660 Bacteria 1056
205 Ga0495625_0350946 3300046660 Bacteria 932
206 Ga0495625_0498868 3300046660 Bacteria 744
207 Ga0495659_0160662 3300046664 Bacteria 907
208 Ga0495669_0012797 3300046684 Bacteria 3572
209 Ga0495669_0066881 3300046684 Bacteria 1633
210 Ga0495670_0247813 3300046691 Bacteria 949
211 Ga0495671_0042803 3300046692 Bacteria 2275
212 Ga0495589_0009441 3300046794 Bacteria 5074
213 Ga0495660_0011449 3300046810 Bacteria 5145
214 Ga0495674_0268400 3300047319 Bacteria 1401
215 Ga0495672_0002338 3300047320 Bacteria 17564
216 Ga0495672_0051550 3300047320 Bacteria 2423
217 Ga0495687_118306 3300047443 Bacteria 961
218 Ga0495677_0043314 3300047445 Bacteria 1650
219 Ga0495679_017081 3300047446 Bacteria 2606
220 Ga0495673_0000341 3300047469 Bacteria 59080
221 Ga0495673_0001139 3300047469 Bacteria 22773
222 Ga0495673_0122765 3300047469 Bacteria 1027
223 Ga0495681_0032016 3300047470 Bacteria 2652
224 Ga0495686_0000747 3300047472 Bacteria 43114
225 Ga0495686_0010888 3300047472 Bacteria 6440
226 Ga0495686_0021718 3300047472 Bacteria 4257
227 Ga0495686_0042001 3300047472 Bacteria 2909
228 Ga0496101_0393959 3300048904 Bacteria 1090
229 Ga0496104_0230005 3300048907 Bacteria 1766
230 Ga0496107_0001612 3300048910 Bacteria 14060
231 Ga0496107_0094999 3300048910 Bacteria 2181
232 Ga0496114_0168862 3300048917 Bacteria 1906
233 Ga0496114_0363676 3300048917 Bacteria 1280
234 Ga0496115_0004645 3300048918 Bacteria 9939
235 Ga0496115_0329592 3300048918 Bacteria 1247
236 Ga0496121_0012501 3300048924 Bacteria 9245
237 Ga0496124_0016862 3300048927 Bacteria 6922
238 Ga0496125_0022477 3300048928 Bacteria 5855
239 Ga0496126_0004417 3300048929 Bacteria 16835
240 Ga0495678_013151 3300049459 Bacteria 3896
241 Ga0501033_0019625 3300049570 Bacteria 5109
242 Ga0501034_0053454 3300049571 Bacteria 4066
243 Ga0501036_0885492 3300049572 Bacteria 733
244 Ga0501037_0038513 3300049573 Bacteria 3522
245 Ga0501038_0375796 3300049574 Bacteria 1103
246 Ga0501042_0067381 3300049578 Unclassified 2559
247 Ga0501047_0035352 3300049581 Bacteria 4827
248 Ga0501068_0417977 3300049584 Bacteria 866
249 Ga0501071_0028258 3300049587 Bacteria 3951
250 Ga0501072_0039391 3300049588 Bacteria 3711
251 Ga0501074_0133844 3300049590 Unclassified 1773
252 Ga0501075_0184737 3300049591 Unclassified 1590
253 Ga0501075_0304530 3300049591 Bacteria 1214
254 Ga0501077_0153936 3300049593 Unclassified 1459
255 Ga0501238_001252 3300049671 Bacteria 2912
256 Ga0501079_0329229 3300049741 Bacteria 1196
257 Ga0501080_0246869 3300049742 Bacteria 1628
258 Ga0501044_0007941 3300049823 Bacteria 11664
259 Ga0501044_0012534 3300049823 Bacteria 9183
260 Ga0501045_0035835 3300049824 Bacteria 3603
261 nmdc:mga00v17_494_c1 3300050491 Bacteria 22171
262 nmdc:mga0k408_126576_c1 3300050493 Bacteria 1516
263 nmdc:mga0k408_26405_c1 3300050493 Bacteria 3292
264 nmdc:mga06z11_143944_c1 3300050494 Bacteria 1349
265 nmdc:mga07m45_73803_c1 3300050496 Bacteria 1943
266 nmdc:mga05p37_566641_c1 3300050507 Bacteria 1289
267 nmdc:mga08y16_57983_c1 3300050511 Bacteria 4046
268 nmdc:mga08y16_81635_c1 3300050511 Bacteria 3370
269 nmdc:mga0a205_3604_c1 3300050515 Bacteria 13861
270 nmdc:mga0sz30_15197_c2 3300050516 Bacteria 2738
271 nmdc:mga0sz30_2040_c1 3300050516 Bacteria 7217
272 Ga0500578_0000015 3300053086 Bacteria 179217
273 Ga0500644_0009374 3300053088 Bacteria 2616
274 Ga0500583_0169218 3300053092 Bacteria 1088
275 Ga0500554_001481 3300053102 Bacteria 4540
276 Ga0500555_015089 3300053103 Bacteria 2228
277 Ga0500556_0001513 3300053104 Bacteria 9589
278 Ga0500594_0000554 3300053118 Bacteria 8088
279 Ga0500595_026153 3300053119 Bacteria 2013
280 Ga0500608_000011 3300053122 Bacteria 92215
281 Ga0500608_083191 3300053122 Bacteria 1507
282 Ga0500618_000159 3300053125 Bacteria 56114
283 Ga0500559_0000009 3300053136 Bacteria 174153
284 Ga0500559_0002111 3300053136 Bacteria 10582
285 Ga0500559_0013358 3300053136 Bacteria 3478
286 Ga0500564_000225 3300053138 Bacteria 15768
287 Ga0500577_0006096 3300053142 Bacteria 3299
288 Ga0500588_0033261 3300053146 Bacteria 1503
289 Ga0500616_0079696 3300053153 Bacteria 1648
290 Ga0500616_0096566 3300053153 Bacteria 1452
291 Ga0500622_0000346 3300053156 Bacteria 45265
292 Ga0500622_0005914 3300053156 Bacteria 7210
293 Ga0500622_0012444 3300053156 Bacteria 4607
294 Ga0500627_0002760 3300053158 Bacteria 5278
295 Ga0500611_001653 3300053727 Bacteria 2510
296 Ga0500645_004109 3300053730 Bacteria 5687
297 Ga0500609_000839 3300053731 Bacteria 4617
298 Ga0501084_0025523 3300054114 Bacteria 4929
299 2511122279 2510917020 Bacteria 5657507
300 2585149783 2582581279 Bacteria 4980720
301 2585151206 2582581280 Bacteria 5994497
302 2585197077 2582581293 Bacteria 5907401
303 2587920001 2585428106 Bacteria 5179711
304 2643747631 2643221545 Bacteria 5083237
305 2643781968 2643221552 Bacteria 5708754
306 2643924102 2643221583 Bacteria 5218014
307 2643931938 2643221584 Bacteria 5511711
308 2644223367 2643221640 Bacteria 5258820
309 2644237109 2643221642 Bacteria 5357871
310 2644506987 2643221691 Bacteria 5093099
311 2792460800 2791355048 Bacteria 5832535
312 2819538283 2818991435 Bacteria 5433759
313 2819647147 2818991454 Bacteria 5563326
314 2843745541 2843744320 Bacteria 5659202
315 2849561155 2849560528 Bacteria 5393480
316 2849576136 2849573788 Bacteria 5421256
317 2851157190 2851153111 Bacteria 5542585
318 2857505743 2857504554 Bacteria 5369913
319 2884965559 2884960567 Bacteria 5437054
320 2898332849 2898329390 Bacteria 5168154
321 2928532143 2928531327 Bacteria 5101314
322 Ga0501075_0338313
323 Ga0055526_1033776
324 Ga0055524_1013584
325 Ga0055524_1017322
326 Ga0055536_1020881
327 Ga0055536_1020897
328 Ga0055528_1029009
329 Ga0055530_10001146
330 Ga0055530_10005439
331 Ga0055530_10017581
332 Ga0055531_10011924
333 Ga0055531_10021018
334 Ga0055531_10048772
335 Ga0055543_1008487
336 Ga0065165_1001756
337 Ga0065165_1002572
338 Ga0065712_10080523
339 Ga0070658_10391762
340 Ga0070670_100331003
341 Ga0070668_100026896
342 Ga0070669_100001157
343 Ga0070669_100091996
344 Ga0070675_100409468
345 Ga0070671_100001426
346 Ga0070674_100024251
347 Ga0070667_100070084
348 Ga0070701_10246317
349 Ga0070705_100132614
350 Ga0068853_100026588
351 Ga0070665_100022468
352 Ga0070665_101202051
353 Ga0068855_100379672
354 Ga0068855_100382652
355 Ga0068854_100015841
356 Ga0068859_100001326
357 Ga0068859_100974463
358 Ga0068861_100143118
359 Ga0068863_100003500
360 Ga0068858_100013425
361 Ga0068860_100054499
362 Ga0068862_100044057
363 Ga0068862_100195317
364 Ga0081455_10160604
365 Ga0075368_10006381
366 Ga0075364_10000415
367 Ga0075367_10001666
368 Ga0075367_10160643
369 Ga0075369_10023913
370 Ga0075369_10025791
371 Ga0075366_10112065
372 Ga0075370_10111022
373 Ga0075370_10192661
374 Ga0075370_10540378
375 Ga0075433_10018321
376 Ga0097620_100001326
377 Ga0097620_100974456
378 Ga0105240_10003768
379 Ga0105240_10264272
380 Ga0105240_11284634
381 Ga0111539_10092918
382 Ga0105241_10334030
383 Ga0105242_10678367
384 Ga0105242_11381698
385 Ga0105248_10000746
386 Ga0105248_10038201
387 Ga0105248_10391353
388 Ga0105237_10506402
389 Ga0105249_11107864
390 Ga0157375_10250062
391 Ga0163163_10008395
392 Ga0163163_10726841
393 Ga0157380_10028962
394 Ga0157379_10003580
395 Ga0157379_10161237
396 Ga0157379_10320311
397 Ga0157376_10126614
398 Ga0213876_10031537
399 Ga0209026_1001508
400 Ga0209148_1013339
401 Ga0209565_1000172
402 Ga0209673_1000451
403 Ga0209673_1076629
404 Ga0209675_1002737
405 Ga0209676_1000257
406 Ga0209676_1000316
407 Ga0209564_1002755
408 Ga0209564_1049836
409 Ga0209758_1002904
410 Ga0209758_1004749
411 Ga0209758_1059545
412 Ga0209050_1000053
413 Ga0209050_1001072
414 Ga0209050_1001742
415 Ga0209256_1005059
416 Ga0209256_1009231
417 Ga0209256_1020143
418 Ga0209051_1001158
419 Ga0209257_1000192
420 Ga0209257_1000419
421 Ga0209257_1000541
422 Ga0209257_1023531
423 Ga0207695_10001168
424 Ga0207695_10191631
425 Ga0207681_10100327
426 Ga0207694_10009138
427 Ga0207650_10014453
428 Ga0207659_10470765
429 Ga0207644_10017992
430 Ga0207706_10219679
431 Ga0207711_10005910
432 Ga0207668_10126017
433 Ga0207640_10021064
434 Ga0207640_10654389
435 Ga0207658_10047399
436 Ga0207658_10400691
437 Ga0207703_10013736
438 Ga0207639_10031715
439 Ga0207678_10142959
440 Ga0207678_10353343
441 Ga0207641_10031831
442 Ga0207675_100007871
443 Ga0209974_10039810
444 Ga0207428_10429800
445 Ga0268266_10042003
446 Ga0268265_10007523
447 Ga0268265_10295874
448 Ga0268264_10134015
449 Ga0265337_1012066
450 Ga0307517_10122857
451 Ga0307515_10136703
452 Ga0307515_10235930
453 Ga0265338_10013313
454 Ga0265327_10002865
455 Ga0307513_10000053
456 Ga0307513_10539524
457 Ga0265314_10102472
458 Ga0316576_10006145
459 Ga0316576_10459551
460 Ga0316578_10065685
461 Ga0316577_10340828
462 Ga0307409_100529277
463 Ga0307411_10069626
464 Ga0316585_10085390
465 Ga0373940_0148635
466 Ga0373936_0025853
467 Ga0316574_0385627
468 Ga0373927_0000111
469 Ga0373927_0222770
470 Ga0373947_0114079
471 Ga0316582_0426011
472 Ga0316584_0394763
473 Ga0395905_0414192
474 Ga0436365_1818853
475 Ga0439461_0045828
476 Ga0439465_0023892
477 Ga0451853_3145100
478 Ga0439441_011066
479 Ga0439435_0021701
480 Ga0439459_0001583
481 Ga0450893_0013903
482 Ga0466965_0088394
483 Ga0466965_0101971
484 Ga0466968_0294975
485 Ga0451576_0010859
486 Ga0495627_000982
487 Ga0495592_0154041
488 Ga0495590_0003316
489 Ga0495638_0000987
490 Ga0495638_0005412
491 Ga0495638_0008109
492 Ga0495638_0018542
493 Ga0495638_0073350
494 Ga0495650_0000168
495 Ga0495650_0044959
496 Ga0495607_0129855
497 Ga0495583_0000003
498 Ga0495606_0019013
499 Ga0495606_0067325
500 Ga0495610_0000304
501 Ga0495610_0000327
502 Ga0495610_0006741
503 Ga0495616_0002651
504 Ga0495620_0013548
505 Ga0495631_0070113
506 Ga0495632_0008092
507 Ga0495632_0156965
508 Ga0495637_0005325
509 Ga0495643_0120168
510 Ga0495644_0167333
511 Ga0495648_0000107
512 Ga0495648_0066732
513 Ga0495648_0140056
514 Ga0495648_0173119
515 Ga0495654_0000085
516 Ga0495609_0161569
517 Ga0495621_0085626
518 Ga0495597_0067789
519 Ga0495668_0000746
520 Ga0495668_0040468
521 Ga0495668_0086953
522 Ga0495668_0145181
523 Ga0495625_0000767
524 Ga0495625_0196249
525 Ga0495625_0287220
526 Ga0495625_0350946
527 Ga0495625_0498868
528 Ga0495659_0160662
529 Ga0495669_0012797
530 Ga0495669_0066881
531 Ga0495670_0247813
532 Ga0495671_0042803
533 Ga0495589_0009441
534 Ga0495660_0011449
535 Ga0495674_0268400
536 Ga0495672_0002338
537 Ga0495672_0051550
538 Ga0495687_118306
539 Ga0495677_0043314
540 Ga0495679_017081
541 Ga0495673_0000341
542 Ga0495673_0001139
543 Ga0495673_0122765
544 Ga0495681_0032016
545 Ga0495686_0000747
546 Ga0495686_0010888
547 Ga0495686_0021718
548 Ga0495686_0042001
549 Ga0496101_0393959
550 Ga0496104_0230005
551 Ga0496107_0001612
552 Ga0496107_0094999
553 Ga0496114_0168862
554 Ga0496114_0363676
555 Ga0496115_0004645
556 Ga0496115_0329592
557 Ga0496121_0012501
558 Ga0496124_0016862
559 Ga0496125_0022477
560 Ga0496126_0004417
561 Ga0495678_013151
562 Ga0501033_0019625
563 Ga0501034_0053454
564 Ga0501036_0885492
565 Ga0501037_0038513
566 Ga0501038_0375796
567 Ga0501042_0067381
568 Ga0501047_0035352
569 Ga0501068_0417977
570 Ga0501071_0028258
571 Ga0501072_0039391
572 Ga0501074_0133844
573 Ga0501075_0184737
574 Ga0501075_0304530
575 Ga0501077_0153936
576 Ga0501238_001252
577 Ga0501079_0329229
578 Ga0501080_0246869
579 Ga0501044_0007941
580 Ga0501044_0012534
581 Ga0501045_0035835
582 nmdc:mga00v17_494_c1
583 nmdc:mga0k408_126576_c1
584 nmdc:mga0k408_26405_c1
585 nmdc:mga06z11_143944_c1
586 nmdc:mga07m45_73803_c1
587 nmdc:mga05p37_566641_c1
588 nmdc:mga08y16_57983_c1
589 nmdc:mga08y16_81635_c1
590 nmdc:mga0a205_3604_c1
591 nmdc:mga0sz30_15197_c2
592 nmdc:mga0sz30_2040_c1
593 Ga0500578_0000015
594 Ga0500644_0009374
595 Ga0500583_0169218
596 Ga0500554_001481
597 Ga0500555_015089
598 Ga0500556_0001513
599 Ga0500594_0000554
600 Ga0500595_026153
601 Ga0500608_000011
602 Ga0500608_083191
603 Ga0500618_000159
604 Ga0500559_0000009
605 Ga0500559_0002111
606 Ga0500559_0013358
607 Ga0500564_000225
608 Ga0500577_0006096
609 Ga0500588_0033261
610 Ga0500616_0079696
611 Ga0500616_0096566
612 Ga0500622_0000346
613 Ga0500622_0005914
614 Ga0500622_0012444
615 Ga0500627_0002760
616 Ga0500611_001653
617 Ga0500645_004109
618 Ga0500609_000839
619 Ga0501084_0025523
620 2511122279
621 2585149783
622 2585151206
623 2585197077
624 2587920001
625 2643747631
626 2643781968
627 2643924102
628 2643931938
629 2644223367
630 2644237109
631 2644506987
632 2792460800
633 2819538283
634 2819647147
635 2843745541
636 2849561155
637 2849576136
638 2851157190
639 2857505743
640 2884965559
641 2898332849
642 2928532143

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

5

201

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wjz-assembly3.cif.gz_D crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity 0.9354 3 210
2wjz-assembly1.cif.gz_B crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity 0.9322 3 210
4gud-assembly2.cif.gz_B crystal structure of amidotransferase hish from vibrio cholerae 0.9273 1 210
7ac8-assembly3.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9223 3 210
1ka9-assembly1.cif.gz_H imidazole glycerol phosphate synthase 0.9205 3 212
ID Description Score Start End Superfamily
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9544 4 211 3.40.50.880
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9449 4 211 3.40.50.880
af_Q2FUU1_1_190_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9356 4 202 3.40.50.880
2wjzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9322 3 210 3.40.50.880
af_P9WMM1_1_205_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.931 2 211 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A258DBC4-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH 0.9984 15 213 GO:0000105
GO:0000107
GO:0004359
GO:0006541
GO:0016829
AF-P58788-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9904 3 213 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0016829
AF-A0A839F7Y1-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.99 3 213 GO:0000105
GO:0000107
GO:0005737
GO:0006541
GO:0016787
GO:0016829
AF-A0A258DBC4-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH 0.9885 15 213 GO:0000105
GO:0000107
GO:0004359
GO:0006541
GO:0016829
AF-A0A4Q3FG20-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH 0.9874 50 213 GO:0000105
GO:0000107
GO:0004359
GO:0006541
GO:0016829

Map