F406175
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 321 | 233 | 642 | 210 |
Family's Representative Sequence
| Representative Sequence | 3300049591|Ga0501075_0338313|Ga0501075_0338313_214_918 |
| Length | 234 |
| Sequence | MESIALIDYGAGNLTSVRKAFAAVGAPIFTPRAPGDLRDVRALVVPGVGHFGVTRSLEAGWRDAILARLDAGALLFGICVGMQWLFAGSTEAPDVAGLGRLEGRCERLDECGGTLKVPHVGWNALSIVRPSRLLDSLTSGAYVYFTHSYAAPVTEATTATTGHGRDFAAVVEAGPVMGVQFHPEKSGEAGLTILRNFVRLVRDLPDEAALSGGPAARAQNDPAASASKGESRAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 2 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 3 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 4 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 5 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 7 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 25 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 26 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 27 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 28 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 29 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 30 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 31 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 32 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 33 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 34 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 35 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 36 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 37 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 38 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 39 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 53 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 54 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 56 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 57 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 58 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 60 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 63 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 83 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 87 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 88 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 89 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 90 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 91 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 92 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 93 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 94 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 95 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 96 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 97 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 98 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 99 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 100 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 101 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 102 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 103 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 104 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 105 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 106 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 107 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 108 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 109 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 110 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 111 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 112 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 113 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 114 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 115 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 116 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 117 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 118 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 157 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 158 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 159 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 160 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 161 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 162 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 163 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 164 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 178 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 183 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 184 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 185 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 186 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 190 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 191 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 192 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 193 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 194 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 195 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 196 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 197 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 198 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 199 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 200 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 201 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 202 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 203 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 204 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 205 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 206 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 207 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 208 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 209 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 210 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 212 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 213 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 214 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 215 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 216 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 217 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 218 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 219 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 220 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 221 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 222 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 223 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 224 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 225 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 226 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 227 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 228 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 229 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 230 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 231 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 232 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 233 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.83 |
| Metatranscriptomes | 0 |
| Isolates | 7.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 25.23 |
| Nodule | 0 |
| Rhizoplane | 2.49 |
| Rhizosphere | 64.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501075_0338313 | 3300049591 | Bacteria | 1147 |
| 2 | Ga0055526_1033776 | 3300003771 | Bacteria | 1413 |
| 3 | Ga0055524_1013584 | 3300003775 | Bacteria | 3066 |
| 4 | Ga0055524_1017322 | 3300003775 | Bacteria | 2545 |
| 5 | Ga0055536_1020881 | 3300003781 | Bacteria | 2007 |
| 6 | Ga0055536_1020897 | 3300003781 | Bacteria | 2006 |
| 7 | Ga0055528_1029009 | 3300003790 | Bacteria | 1511 |
| 8 | Ga0055530_10001146 | 3300003791 | Bacteria | 20621 |
| 9 | Ga0055530_10005439 | 3300003791 | Bacteria | 6057 |
| 10 | Ga0055530_10017581 | 3300003791 | Bacteria | 2236 |
| 11 | Ga0055531_10011924 | 3300003794 | Bacteria | 4137 |
| 12 | Ga0055531_10021018 | 3300003794 | Bacteria | 2552 |
| 13 | Ga0055531_10048772 | 3300003794 | Bacteria | 1138 |
| 14 | Ga0055543_1008487 | 3300004625 | Bacteria | 2272 |
| 15 | Ga0065165_1001756 | 3300005262 | Bacteria | 21578 |
| 16 | Ga0065165_1002572 | 3300005262 | Bacteria | 14970 |
| 17 | Ga0065712_10080523 | 3300005290 | Bacteria | 3096 |
| 18 | Ga0070658_10391762 | 3300005327 | Bacteria | 1192 |
| 19 | Ga0070670_100331003 | 3300005331 | Bacteria | 1336 |
| 20 | Ga0070668_100026896 | 3300005347 | Bacteria | 4367 |
| 21 | Ga0070669_100001157 | 3300005353 | Bacteria | 19280 |
| 22 | Ga0070669_100091996 | 3300005353 | Bacteria | 2276 |
| 23 | Ga0070675_100409468 | 3300005354 | Bacteria | 1211 |
| 24 | Ga0070671_100001426 | 3300005355 | Bacteria | 17856 |
| 25 | Ga0070674_100024251 | 3300005356 | Bacteria | 3935 |
| 26 | Ga0070667_100070084 | 3300005367 | Bacteria | 2984 |
| 27 | Ga0070701_10246317 | 3300005438 | Bacteria | 1077 |
| 28 | Ga0070705_100132614 | 3300005440 | Unclassified | 1627 |
| 29 | Ga0068853_100026588 | 3300005539 | Bacteria | 4860 |
| 30 | Ga0070665_100022468 | 3300005548 | Bacteria | 6348 |
| 31 | Ga0070665_101202051 | 3300005548 | Bacteria | 769 |
| 32 | Ga0068855_100379672 | 3300005563 | Bacteria | 1552 |
| 33 | Ga0068855_100382652 | 3300005563 | Bacteria | 1545 |
| 34 | Ga0068854_100015841 | 3300005578 | Bacteria | 5009 |
| 35 | Ga0068859_100001326 | 3300005617 | Bacteria | 25257 |
| 36 | Ga0068859_100974463 | 3300005617 | Bacteria | 931 |
| 37 | Ga0068861_100143118 | 3300005719 | Bacteria | 1954 |
| 38 | Ga0068863_100003500 | 3300005841 | Bacteria | 15493 |
| 39 | Ga0068858_100013425 | 3300005842 | Bacteria | 7729 |
| 40 | Ga0068860_100054499 | 3300005843 | Bacteria | 3801 |
| 41 | Ga0068862_100044057 | 3300005844 | Bacteria | 3806 |
| 42 | Ga0068862_100195317 | 3300005844 | Bacteria | 1823 |
| 43 | Ga0081455_10160604 | 3300005937 | Bacteria | 1723 |
| 44 | Ga0075368_10006381 | 3300006042 | Bacteria | 4117 |
| 45 | Ga0075364_10000415 | 3300006051 | Bacteria | 21345 |
| 46 | Ga0075367_10001666 | 3300006178 | Bacteria | 9689 |
| 47 | Ga0075367_10160643 | 3300006178 | Bacteria | 1397 |
| 48 | Ga0075369_10023913 | 3300006186 | Bacteria | 2529 |
| 49 | Ga0075369_10025791 | 3300006186 | Bacteria | 2446 |
| 50 | Ga0075366_10112065 | 3300006195 | Bacteria | 1641 |
| 51 | Ga0075370_10111022 | 3300006353 | Bacteria | 1592 |
| 52 | Ga0075370_10192661 | 3300006353 | Bacteria | 1201 |
| 53 | Ga0075370_10540378 | 3300006353 | Bacteria | 704 |
| 54 | Ga0075433_10018321 | 3300006852 | Bacteria | 5817 |
| 55 | Ga0097620_100001326 | 3300006931 | Bacteria | 25257 |
| 56 | Ga0097620_100974456 | 3300006931 | Bacteria | 931 |
| 57 | Ga0105240_10003768 | 3300009093 | Bacteria | 23424 |
| 58 | Ga0105240_10264272 | 3300009093 | Bacteria | 1984 |
| 59 | Ga0105240_11284634 | 3300009093 | Bacteria | 772 |
| 60 | Ga0111539_10092918 | 3300009094 | Bacteria | 3544 |
| 61 | Ga0105241_10334030 | 3300009174 | Bacteria | 1311 |
| 62 | Ga0105242_10678367 | 3300009176 | Bacteria | 1005 |
| 63 | Ga0105242_11381698 | 3300009176 | Bacteria | 731 |
| 64 | Ga0105248_10000746 | 3300009177 | Bacteria | 36566 |
| 65 | Ga0105248_10038201 | 3300009177 | Bacteria | 5373 |
| 66 | Ga0105248_10391353 | 3300009177 | Bacteria | 1565 |
| 67 | Ga0105237_10506402 | 3300009545 | Bacteria | 1214 |
| 68 | Ga0105249_11107864 | 3300009553 | Bacteria | 862 |
| 69 | Ga0157375_10250062 | 3300013308 | Bacteria | 1933 |
| 70 | Ga0163163_10008395 | 3300014325 | Bacteria | 9173 |
| 71 | Ga0163163_10726841 | 3300014325 | Bacteria | 1056 |
| 72 | Ga0157380_10028962 | 3300014326 | Bacteria | 4229 |
| 73 | Ga0157379_10003580 | 3300014968 | Bacteria | 13164 |
| 74 | Ga0157379_10161237 | 3300014968 | Bacteria | 2024 |
| 75 | Ga0157379_10320311 | 3300014968 | Bacteria | 1415 |
| 76 | Ga0157376_10126614 | 3300014969 | Bacteria | 2273 |
| 77 | Ga0213876_10031537 | 3300021384 | Bacteria | 2796 |
| 78 | Ga0209026_1001508 | 3300025250 | Bacteria | 10187 |
| 79 | Ga0209148_1013339 | 3300025254 | Bacteria | 1481 |
| 80 | Ga0209565_1000172 | 3300025263 | Bacteria | 84264 |
| 81 | Ga0209673_1000451 | 3300025273 | Bacteria | 69853 |
| 82 | Ga0209673_1076629 | 3300025273 | Bacteria | 778 |
| 83 | Ga0209675_1002737 | 3300025291 | Bacteria | 8828 |
| 84 | Ga0209676_1000257 | 3300025292 | Bacteria | 112662 |
| 85 | Ga0209676_1000316 | 3300025292 | Bacteria | 94380 |
| 86 | Ga0209564_1002755 | 3300025295 | Bacteria | 13209 |
| 87 | Ga0209564_1049836 | 3300025295 | Bacteria | 1032 |
| 88 | Ga0209758_1002904 | 3300025297 | Bacteria | 16541 |
| 89 | Ga0209758_1004749 | 3300025297 | Bacteria | 11026 |
| 90 | Ga0209758_1059545 | 3300025297 | Bacteria | 1270 |
| 91 | Ga0209050_1000053 | 3300025298 | Bacteria | 349521 |
| 92 | Ga0209050_1001072 | 3300025298 | Bacteria | 33540 |
| 93 | Ga0209050_1001742 | 3300025298 | Bacteria | 21662 |
| 94 | Ga0209256_1005059 | 3300025299 | Bacteria | 7845 |
| 95 | Ga0209256_1009231 | 3300025299 | Bacteria | 4366 |
| 96 | Ga0209256_1020143 | 3300025299 | Bacteria | 2094 |
| 97 | Ga0209051_1001158 | 3300025303 | Bacteria | 23974 |
| 98 | Ga0209257_1000192 | 3300025304 | Bacteria | 151851 |
| 99 | Ga0209257_1000419 | 3300025304 | Bacteria | 81956 |
| 100 | Ga0209257_1000541 | 3300025304 | Bacteria | 64943 |
| 101 | Ga0209257_1023531 | 3300025304 | Bacteria | 2163 |
| 102 | Ga0207695_10001168 | 3300025913 | Bacteria | 45314 |
| 103 | Ga0207695_10191631 | 3300025913 | Bacteria | 1962 |
| 104 | Ga0207681_10100327 | 3300025923 | Bacteria | 2086 |
| 105 | Ga0207694_10009138 | 3300025924 | Bacteria | 7481 |
| 106 | Ga0207650_10014453 | 3300025925 | Bacteria | 5488 |
| 107 | Ga0207659_10470765 | 3300025926 | Bacteria | 1060 |
| 108 | Ga0207644_10017992 | 3300025931 | Bacteria | 4778 |
| 109 | Ga0207706_10219679 | 3300025933 | Bacteria | 1664 |
| 110 | Ga0207711_10005910 | 3300025941 | Bacteria | 10337 |
| 111 | Ga0207668_10126017 | 3300025972 | Bacteria | 1947 |
| 112 | Ga0207640_10021064 | 3300025981 | Bacteria | 3879 |
| 113 | Ga0207640_10654389 | 3300025981 | Bacteria | 896 |
| 114 | Ga0207658_10047399 | 3300025986 | Bacteria | 3145 |
| 115 | Ga0207658_10400691 | 3300025986 | Bacteria | 1206 |
| 116 | Ga0207703_10013736 | 3300026035 | Bacteria | 6312 |
| 117 | Ga0207639_10031715 | 3300026041 | Bacteria | 3886 |
| 118 | Ga0207678_10142959 | 3300026067 | Bacteria | 2042 |
| 119 | Ga0207678_10353343 | 3300026067 | Bacteria | 1268 |
| 120 | Ga0207641_10031831 | 3300026088 | Bacteria | 4376 |
| 121 | Ga0207675_100007871 | 3300026118 | Bacteria | 10056 |
| 122 | Ga0209974_10039810 | 3300027876 | Bacteria | 1563 |
| 123 | Ga0207428_10429800 | 3300027907 | Bacteria | 964 |
| 124 | Ga0268266_10042003 | 3300028379 | Bacteria | 3904 |
| 125 | Ga0268265_10007523 | 3300028380 | Bacteria | 7353 |
| 126 | Ga0268265_10295874 | 3300028380 | Bacteria | 1455 |
| 127 | Ga0268264_10134015 | 3300028381 | Bacteria | 2200 |
| 128 | Ga0265337_1012066 | 3300028556 | Bacteria | 2950 |
| 129 | Ga0307517_10122857 | 3300028786 | Bacteria | 1910 |
| 130 | Ga0307515_10136703 | 3300028794 | Bacteria | 2659 |
| 131 | Ga0307515_10235930 | 3300028794 | Bacteria | 1610 |
| 132 | Ga0265338_10013313 | 3300028800 | Bacteria | 9296 |
| 133 | Ga0265327_10002865 | 3300031251 | Bacteria | 17361 |
| 134 | Ga0307513_10000053 | 3300031456 | Bacteria | 149356 |
| 135 | Ga0307513_10539524 | 3300031456 | Bacteria | 880 |
| 136 | Ga0265314_10102472 | 3300031711 | Bacteria | 1837 |
| 137 | Ga0316576_10006145 | 3300031727 | Bacteria | 7440 |
| 138 | Ga0316576_10459551 | 3300031727 | Bacteria | 939 |
| 139 | Ga0316578_10065685 | 3300031728 | Bacteria | 2142 |
| 140 | Ga0316577_10340828 | 3300031733 | Bacteria | 850 |
| 141 | Ga0307409_100529277 | 3300031995 | Bacteria | 1153 |
| 142 | Ga0307411_10069626 | 3300032005 | Bacteria | 2377 |
| 143 | Ga0316585_10085390 | 3300032137 | Bacteria | 1030 |
| 144 | Ga0373940_0148635 | 3300035088 | Bacteria | 745 |
| 145 | Ga0373936_0025853 | 3300035113 | Bacteria | 2297 |
| 146 | Ga0316574_0385627 | 3300035398 | Bacteria | 883 |
| 147 | Ga0373927_0000111 | 3300035695 | Bacteria | 62031 |
| 148 | Ga0373927_0222770 | 3300035695 | Bacteria | 1239 |
| 149 | Ga0373947_0114079 | 3300035725 | Bacteria | 1711 |
| 150 | Ga0316582_0426011 | 3300036647 | Bacteria | 914 |
| 151 | Ga0316584_0394763 | 3300036712 | Bacteria | 986 |
| 152 | Ga0395905_0414192 | 3300037471 | Bacteria | 1243 |
| 153 | Ga0436365_1818853 | 3300039437 | Bacteria | 4407 |
| 154 | Ga0439461_0045828 | 3300041410 | Bacteria | 957 |
| 155 | Ga0439465_0023892 | 3300041413 | Bacteria | 1925 |
| 156 | Ga0451853_3145100 | 3300041512 | Bacteria | 1548 |
| 157 | Ga0439441_011066 | 3300042001 | Bacteria | 1525 |
| 158 | Ga0439435_0021701 | 3300042436 | Bacteria | 1669 |
| 159 | Ga0439459_0001583 | 3300042438 | Bacteria | 3386 |
| 160 | Ga0450893_0013903 | 3300042532 | Bacteria | 1345 |
| 161 | Ga0466965_0088394 | 3300044683 | Bacteria | 1574 |
| 162 | Ga0466965_0101971 | 3300044683 | Bacteria | 1468 |
| 163 | Ga0466968_0294975 | 3300044735 | Bacteria | 779 |
| 164 | Ga0451576_0010859 | 3300045051 | Bacteria | 10423 |
| 165 | Ga0495627_000982 | 3300046453 | Bacteria | 19454 |
| 166 | Ga0495592_0154041 | 3300046454 | Bacteria | 1587 |
| 167 | Ga0495590_0003316 | 3300046457 | Bacteria | 6591 |
| 168 | Ga0495638_0000987 | 3300046460 | Bacteria | 28615 |
| 169 | Ga0495638_0005412 | 3300046460 | Bacteria | 9502 |
| 170 | Ga0495638_0008109 | 3300046460 | Bacteria | 7470 |
| 171 | Ga0495638_0018542 | 3300046460 | Bacteria | 4620 |
| 172 | Ga0495638_0073350 | 3300046460 | Bacteria | 2089 |
| 173 | Ga0495650_0000168 | 3300046471 | Bacteria | 145714 |
| 174 | Ga0495650_0044959 | 3300046471 | Bacteria | 1862 |
| 175 | Ga0495607_0129855 | 3300046501 | Bacteria | 1312 |
| 176 | Ga0495583_0000003 | 3300046506 | Bacteria | 709273 |
| 177 | Ga0495606_0019013 | 3300046507 | Bacteria | 5130 |
| 178 | Ga0495606_0067325 | 3300046507 | Bacteria | 2268 |
| 179 | Ga0495610_0000304 | 3300046512 | Bacteria | 51895 |
| 180 | Ga0495610_0000327 | 3300046512 | Bacteria | 50683 |
| 181 | Ga0495610_0006741 | 3300046512 | Bacteria | 7802 |
| 182 | Ga0495616_0002651 | 3300046513 | Bacteria | 11747 |
| 183 | Ga0495620_0013548 | 3300046515 | Bacteria | 4172 |
| 184 | Ga0495631_0070113 | 3300046518 | Bacteria | 1515 |
| 185 | Ga0495632_0008092 | 3300046519 | Bacteria | 6509 |
| 186 | Ga0495632_0156965 | 3300046519 | Bacteria | 1049 |
| 187 | Ga0495637_0005325 | 3300046520 | Bacteria | 6581 |
| 188 | Ga0495643_0120168 | 3300046522 | Bacteria | 1328 |
| 189 | Ga0495644_0167333 | 3300046523 | Bacteria | 844 |
| 190 | Ga0495648_0000107 | 3300046524 | Bacteria | 104376 |
| 191 | Ga0495648_0066732 | 3300046524 | Bacteria | 2108 |
| 192 | Ga0495648_0140056 | 3300046524 | Bacteria | 1274 |
| 193 | Ga0495648_0173119 | 3300046524 | Bacteria | 1104 |
| 194 | Ga0495654_0000085 | 3300046530 | Bacteria | 107010 |
| 195 | Ga0495609_0161569 | 3300046538 | Bacteria | 949 |
| 196 | Ga0495621_0085626 | 3300046539 | Bacteria | 1181 |
| 197 | Ga0495597_0067789 | 3300046542 | Bacteria | 1543 |
| 198 | Ga0495668_0000746 | 3300046616 | Bacteria | 38674 |
| 199 | Ga0495668_0040468 | 3300046616 | Bacteria | 2598 |
| 200 | Ga0495668_0086953 | 3300046616 | Bacteria | 1714 |
| 201 | Ga0495668_0145181 | 3300046616 | Bacteria | 1299 |
| 202 | Ga0495625_0000767 | 3300046660 | Bacteria | 44760 |
| 203 | Ga0495625_0196249 | 3300046660 | Bacteria | 1334 |
| 204 | Ga0495625_0287220 | 3300046660 | Bacteria | 1056 |
| 205 | Ga0495625_0350946 | 3300046660 | Bacteria | 932 |
| 206 | Ga0495625_0498868 | 3300046660 | Bacteria | 744 |
| 207 | Ga0495659_0160662 | 3300046664 | Bacteria | 907 |
| 208 | Ga0495669_0012797 | 3300046684 | Bacteria | 3572 |
| 209 | Ga0495669_0066881 | 3300046684 | Bacteria | 1633 |
| 210 | Ga0495670_0247813 | 3300046691 | Bacteria | 949 |
| 211 | Ga0495671_0042803 | 3300046692 | Bacteria | 2275 |
| 212 | Ga0495589_0009441 | 3300046794 | Bacteria | 5074 |
| 213 | Ga0495660_0011449 | 3300046810 | Bacteria | 5145 |
| 214 | Ga0495674_0268400 | 3300047319 | Bacteria | 1401 |
| 215 | Ga0495672_0002338 | 3300047320 | Bacteria | 17564 |
| 216 | Ga0495672_0051550 | 3300047320 | Bacteria | 2423 |
| 217 | Ga0495687_118306 | 3300047443 | Bacteria | 961 |
| 218 | Ga0495677_0043314 | 3300047445 | Bacteria | 1650 |
| 219 | Ga0495679_017081 | 3300047446 | Bacteria | 2606 |
| 220 | Ga0495673_0000341 | 3300047469 | Bacteria | 59080 |
| 221 | Ga0495673_0001139 | 3300047469 | Bacteria | 22773 |
| 222 | Ga0495673_0122765 | 3300047469 | Bacteria | 1027 |
| 223 | Ga0495681_0032016 | 3300047470 | Bacteria | 2652 |
| 224 | Ga0495686_0000747 | 3300047472 | Bacteria | 43114 |
| 225 | Ga0495686_0010888 | 3300047472 | Bacteria | 6440 |
| 226 | Ga0495686_0021718 | 3300047472 | Bacteria | 4257 |
| 227 | Ga0495686_0042001 | 3300047472 | Bacteria | 2909 |
| 228 | Ga0496101_0393959 | 3300048904 | Bacteria | 1090 |
| 229 | Ga0496104_0230005 | 3300048907 | Bacteria | 1766 |
| 230 | Ga0496107_0001612 | 3300048910 | Bacteria | 14060 |
| 231 | Ga0496107_0094999 | 3300048910 | Bacteria | 2181 |
| 232 | Ga0496114_0168862 | 3300048917 | Bacteria | 1906 |
| 233 | Ga0496114_0363676 | 3300048917 | Bacteria | 1280 |
| 234 | Ga0496115_0004645 | 3300048918 | Bacteria | 9939 |
| 235 | Ga0496115_0329592 | 3300048918 | Bacteria | 1247 |
| 236 | Ga0496121_0012501 | 3300048924 | Bacteria | 9245 |
| 237 | Ga0496124_0016862 | 3300048927 | Bacteria | 6922 |
| 238 | Ga0496125_0022477 | 3300048928 | Bacteria | 5855 |
| 239 | Ga0496126_0004417 | 3300048929 | Bacteria | 16835 |
| 240 | Ga0495678_013151 | 3300049459 | Bacteria | 3896 |
| 241 | Ga0501033_0019625 | 3300049570 | Bacteria | 5109 |
| 242 | Ga0501034_0053454 | 3300049571 | Bacteria | 4066 |
| 243 | Ga0501036_0885492 | 3300049572 | Bacteria | 733 |
| 244 | Ga0501037_0038513 | 3300049573 | Bacteria | 3522 |
| 245 | Ga0501038_0375796 | 3300049574 | Bacteria | 1103 |
| 246 | Ga0501042_0067381 | 3300049578 | Unclassified | 2559 |
| 247 | Ga0501047_0035352 | 3300049581 | Bacteria | 4827 |
| 248 | Ga0501068_0417977 | 3300049584 | Bacteria | 866 |
| 249 | Ga0501071_0028258 | 3300049587 | Bacteria | 3951 |
| 250 | Ga0501072_0039391 | 3300049588 | Bacteria | 3711 |
| 251 | Ga0501074_0133844 | 3300049590 | Unclassified | 1773 |
| 252 | Ga0501075_0184737 | 3300049591 | Unclassified | 1590 |
| 253 | Ga0501075_0304530 | 3300049591 | Bacteria | 1214 |
| 254 | Ga0501077_0153936 | 3300049593 | Unclassified | 1459 |
| 255 | Ga0501238_001252 | 3300049671 | Bacteria | 2912 |
| 256 | Ga0501079_0329229 | 3300049741 | Bacteria | 1196 |
| 257 | Ga0501080_0246869 | 3300049742 | Bacteria | 1628 |
| 258 | Ga0501044_0007941 | 3300049823 | Bacteria | 11664 |
| 259 | Ga0501044_0012534 | 3300049823 | Bacteria | 9183 |
| 260 | Ga0501045_0035835 | 3300049824 | Bacteria | 3603 |
| 261 | nmdc:mga00v17_494_c1 | 3300050491 | Bacteria | 22171 |
| 262 | nmdc:mga0k408_126576_c1 | 3300050493 | Bacteria | 1516 |
| 263 | nmdc:mga0k408_26405_c1 | 3300050493 | Bacteria | 3292 |
| 264 | nmdc:mga06z11_143944_c1 | 3300050494 | Bacteria | 1349 |
| 265 | nmdc:mga07m45_73803_c1 | 3300050496 | Bacteria | 1943 |
| 266 | nmdc:mga05p37_566641_c1 | 3300050507 | Bacteria | 1289 |
| 267 | nmdc:mga08y16_57983_c1 | 3300050511 | Bacteria | 4046 |
| 268 | nmdc:mga08y16_81635_c1 | 3300050511 | Bacteria | 3370 |
| 269 | nmdc:mga0a205_3604_c1 | 3300050515 | Bacteria | 13861 |
| 270 | nmdc:mga0sz30_15197_c2 | 3300050516 | Bacteria | 2738 |
| 271 | nmdc:mga0sz30_2040_c1 | 3300050516 | Bacteria | 7217 |
| 272 | Ga0500578_0000015 | 3300053086 | Bacteria | 179217 |
| 273 | Ga0500644_0009374 | 3300053088 | Bacteria | 2616 |
| 274 | Ga0500583_0169218 | 3300053092 | Bacteria | 1088 |
| 275 | Ga0500554_001481 | 3300053102 | Bacteria | 4540 |
| 276 | Ga0500555_015089 | 3300053103 | Bacteria | 2228 |
| 277 | Ga0500556_0001513 | 3300053104 | Bacteria | 9589 |
| 278 | Ga0500594_0000554 | 3300053118 | Bacteria | 8088 |
| 279 | Ga0500595_026153 | 3300053119 | Bacteria | 2013 |
| 280 | Ga0500608_000011 | 3300053122 | Bacteria | 92215 |
| 281 | Ga0500608_083191 | 3300053122 | Bacteria | 1507 |
| 282 | Ga0500618_000159 | 3300053125 | Bacteria | 56114 |
| 283 | Ga0500559_0000009 | 3300053136 | Bacteria | 174153 |
| 284 | Ga0500559_0002111 | 3300053136 | Bacteria | 10582 |
| 285 | Ga0500559_0013358 | 3300053136 | Bacteria | 3478 |
| 286 | Ga0500564_000225 | 3300053138 | Bacteria | 15768 |
| 287 | Ga0500577_0006096 | 3300053142 | Bacteria | 3299 |
| 288 | Ga0500588_0033261 | 3300053146 | Bacteria | 1503 |
| 289 | Ga0500616_0079696 | 3300053153 | Bacteria | 1648 |
| 290 | Ga0500616_0096566 | 3300053153 | Bacteria | 1452 |
| 291 | Ga0500622_0000346 | 3300053156 | Bacteria | 45265 |
| 292 | Ga0500622_0005914 | 3300053156 | Bacteria | 7210 |
| 293 | Ga0500622_0012444 | 3300053156 | Bacteria | 4607 |
| 294 | Ga0500627_0002760 | 3300053158 | Bacteria | 5278 |
| 295 | Ga0500611_001653 | 3300053727 | Bacteria | 2510 |
| 296 | Ga0500645_004109 | 3300053730 | Bacteria | 5687 |
| 297 | Ga0500609_000839 | 3300053731 | Bacteria | 4617 |
| 298 | Ga0501084_0025523 | 3300054114 | Bacteria | 4929 |
| 299 | 2511122279 | 2510917020 | Bacteria | 5657507 |
| 300 | 2585149783 | 2582581279 | Bacteria | 4980720 |
| 301 | 2585151206 | 2582581280 | Bacteria | 5994497 |
| 302 | 2585197077 | 2582581293 | Bacteria | 5907401 |
| 303 | 2587920001 | 2585428106 | Bacteria | 5179711 |
| 304 | 2643747631 | 2643221545 | Bacteria | 5083237 |
| 305 | 2643781968 | 2643221552 | Bacteria | 5708754 |
| 306 | 2643924102 | 2643221583 | Bacteria | 5218014 |
| 307 | 2643931938 | 2643221584 | Bacteria | 5511711 |
| 308 | 2644223367 | 2643221640 | Bacteria | 5258820 |
| 309 | 2644237109 | 2643221642 | Bacteria | 5357871 |
| 310 | 2644506987 | 2643221691 | Bacteria | 5093099 |
| 311 | 2792460800 | 2791355048 | Bacteria | 5832535 |
| 312 | 2819538283 | 2818991435 | Bacteria | 5433759 |
| 313 | 2819647147 | 2818991454 | Bacteria | 5563326 |
| 314 | 2843745541 | 2843744320 | Bacteria | 5659202 |
| 315 | 2849561155 | 2849560528 | Bacteria | 5393480 |
| 316 | 2849576136 | 2849573788 | Bacteria | 5421256 |
| 317 | 2851157190 | 2851153111 | Bacteria | 5542585 |
| 318 | 2857505743 | 2857504554 | Bacteria | 5369913 |
| 319 | 2884965559 | 2884960567 | Bacteria | 5437054 |
| 320 | 2898332849 | 2898329390 | Bacteria | 5168154 |
| 321 | 2928532143 | 2928531327 | Bacteria | 5101314 |
| 322 | Ga0501075_0338313 | |||
| 323 | Ga0055526_1033776 | |||
| 324 | Ga0055524_1013584 | |||
| 325 | Ga0055524_1017322 | |||
| 326 | Ga0055536_1020881 | |||
| 327 | Ga0055536_1020897 | |||
| 328 | Ga0055528_1029009 | |||
| 329 | Ga0055530_10001146 | |||
| 330 | Ga0055530_10005439 | |||
| 331 | Ga0055530_10017581 | |||
| 332 | Ga0055531_10011924 | |||
| 333 | Ga0055531_10021018 | |||
| 334 | Ga0055531_10048772 | |||
| 335 | Ga0055543_1008487 | |||
| 336 | Ga0065165_1001756 | |||
| 337 | Ga0065165_1002572 | |||
| 338 | Ga0065712_10080523 | |||
| 339 | Ga0070658_10391762 | |||
| 340 | Ga0070670_100331003 | |||
| 341 | Ga0070668_100026896 | |||
| 342 | Ga0070669_100001157 | |||
| 343 | Ga0070669_100091996 | |||
| 344 | Ga0070675_100409468 | |||
| 345 | Ga0070671_100001426 | |||
| 346 | Ga0070674_100024251 | |||
| 347 | Ga0070667_100070084 | |||
| 348 | Ga0070701_10246317 | |||
| 349 | Ga0070705_100132614 | |||
| 350 | Ga0068853_100026588 | |||
| 351 | Ga0070665_100022468 | |||
| 352 | Ga0070665_101202051 | |||
| 353 | Ga0068855_100379672 | |||
| 354 | Ga0068855_100382652 | |||
| 355 | Ga0068854_100015841 | |||
| 356 | Ga0068859_100001326 | |||
| 357 | Ga0068859_100974463 | |||
| 358 | Ga0068861_100143118 | |||
| 359 | Ga0068863_100003500 | |||
| 360 | Ga0068858_100013425 | |||
| 361 | Ga0068860_100054499 | |||
| 362 | Ga0068862_100044057 | |||
| 363 | Ga0068862_100195317 | |||
| 364 | Ga0081455_10160604 | |||
| 365 | Ga0075368_10006381 | |||
| 366 | Ga0075364_10000415 | |||
| 367 | Ga0075367_10001666 | |||
| 368 | Ga0075367_10160643 | |||
| 369 | Ga0075369_10023913 | |||
| 370 | Ga0075369_10025791 | |||
| 371 | Ga0075366_10112065 | |||
| 372 | Ga0075370_10111022 | |||
| 373 | Ga0075370_10192661 | |||
| 374 | Ga0075370_10540378 | |||
| 375 | Ga0075433_10018321 | |||
| 376 | Ga0097620_100001326 | |||
| 377 | Ga0097620_100974456 | |||
| 378 | Ga0105240_10003768 | |||
| 379 | Ga0105240_10264272 | |||
| 380 | Ga0105240_11284634 | |||
| 381 | Ga0111539_10092918 | |||
| 382 | Ga0105241_10334030 | |||
| 383 | Ga0105242_10678367 | |||
| 384 | Ga0105242_11381698 | |||
| 385 | Ga0105248_10000746 | |||
| 386 | Ga0105248_10038201 | |||
| 387 | Ga0105248_10391353 | |||
| 388 | Ga0105237_10506402 | |||
| 389 | Ga0105249_11107864 | |||
| 390 | Ga0157375_10250062 | |||
| 391 | Ga0163163_10008395 | |||
| 392 | Ga0163163_10726841 | |||
| 393 | Ga0157380_10028962 | |||
| 394 | Ga0157379_10003580 | |||
| 395 | Ga0157379_10161237 | |||
| 396 | Ga0157379_10320311 | |||
| 397 | Ga0157376_10126614 | |||
| 398 | Ga0213876_10031537 | |||
| 399 | Ga0209026_1001508 | |||
| 400 | Ga0209148_1013339 | |||
| 401 | Ga0209565_1000172 | |||
| 402 | Ga0209673_1000451 | |||
| 403 | Ga0209673_1076629 | |||
| 404 | Ga0209675_1002737 | |||
| 405 | Ga0209676_1000257 | |||
| 406 | Ga0209676_1000316 | |||
| 407 | Ga0209564_1002755 | |||
| 408 | Ga0209564_1049836 | |||
| 409 | Ga0209758_1002904 | |||
| 410 | Ga0209758_1004749 | |||
| 411 | Ga0209758_1059545 | |||
| 412 | Ga0209050_1000053 | |||
| 413 | Ga0209050_1001072 | |||
| 414 | Ga0209050_1001742 | |||
| 415 | Ga0209256_1005059 | |||
| 416 | Ga0209256_1009231 | |||
| 417 | Ga0209256_1020143 | |||
| 418 | Ga0209051_1001158 | |||
| 419 | Ga0209257_1000192 | |||
| 420 | Ga0209257_1000419 | |||
| 421 | Ga0209257_1000541 | |||
| 422 | Ga0209257_1023531 | |||
| 423 | Ga0207695_10001168 | |||
| 424 | Ga0207695_10191631 | |||
| 425 | Ga0207681_10100327 | |||
| 426 | Ga0207694_10009138 | |||
| 427 | Ga0207650_10014453 | |||
| 428 | Ga0207659_10470765 | |||
| 429 | Ga0207644_10017992 | |||
| 430 | Ga0207706_10219679 | |||
| 431 | Ga0207711_10005910 | |||
| 432 | Ga0207668_10126017 | |||
| 433 | Ga0207640_10021064 | |||
| 434 | Ga0207640_10654389 | |||
| 435 | Ga0207658_10047399 | |||
| 436 | Ga0207658_10400691 | |||
| 437 | Ga0207703_10013736 | |||
| 438 | Ga0207639_10031715 | |||
| 439 | Ga0207678_10142959 | |||
| 440 | Ga0207678_10353343 | |||
| 441 | Ga0207641_10031831 | |||
| 442 | Ga0207675_100007871 | |||
| 443 | Ga0209974_10039810 | |||
| 444 | Ga0207428_10429800 | |||
| 445 | Ga0268266_10042003 | |||
| 446 | Ga0268265_10007523 | |||
| 447 | Ga0268265_10295874 | |||
| 448 | Ga0268264_10134015 | |||
| 449 | Ga0265337_1012066 | |||
| 450 | Ga0307517_10122857 | |||
| 451 | Ga0307515_10136703 | |||
| 452 | Ga0307515_10235930 | |||
| 453 | Ga0265338_10013313 | |||
| 454 | Ga0265327_10002865 | |||
| 455 | Ga0307513_10000053 | |||
| 456 | Ga0307513_10539524 | |||
| 457 | Ga0265314_10102472 | |||
| 458 | Ga0316576_10006145 | |||
| 459 | Ga0316576_10459551 | |||
| 460 | Ga0316578_10065685 | |||
| 461 | Ga0316577_10340828 | |||
| 462 | Ga0307409_100529277 | |||
| 463 | Ga0307411_10069626 | |||
| 464 | Ga0316585_10085390 | |||
| 465 | Ga0373940_0148635 | |||
| 466 | Ga0373936_0025853 | |||
| 467 | Ga0316574_0385627 | |||
| 468 | Ga0373927_0000111 | |||
| 469 | Ga0373927_0222770 | |||
| 470 | Ga0373947_0114079 | |||
| 471 | Ga0316582_0426011 | |||
| 472 | Ga0316584_0394763 | |||
| 473 | Ga0395905_0414192 | |||
| 474 | Ga0436365_1818853 | |||
| 475 | Ga0439461_0045828 | |||
| 476 | Ga0439465_0023892 | |||
| 477 | Ga0451853_3145100 | |||
| 478 | Ga0439441_011066 | |||
| 479 | Ga0439435_0021701 | |||
| 480 | Ga0439459_0001583 | |||
| 481 | Ga0450893_0013903 | |||
| 482 | Ga0466965_0088394 | |||
| 483 | Ga0466965_0101971 | |||
| 484 | Ga0466968_0294975 | |||
| 485 | Ga0451576_0010859 | |||
| 486 | Ga0495627_000982 | |||
| 487 | Ga0495592_0154041 | |||
| 488 | Ga0495590_0003316 | |||
| 489 | Ga0495638_0000987 | |||
| 490 | Ga0495638_0005412 | |||
| 491 | Ga0495638_0008109 | |||
| 492 | Ga0495638_0018542 | |||
| 493 | Ga0495638_0073350 | |||
| 494 | Ga0495650_0000168 | |||
| 495 | Ga0495650_0044959 | |||
| 496 | Ga0495607_0129855 | |||
| 497 | Ga0495583_0000003 | |||
| 498 | Ga0495606_0019013 | |||
| 499 | Ga0495606_0067325 | |||
| 500 | Ga0495610_0000304 | |||
| 501 | Ga0495610_0000327 | |||
| 502 | Ga0495610_0006741 | |||
| 503 | Ga0495616_0002651 | |||
| 504 | Ga0495620_0013548 | |||
| 505 | Ga0495631_0070113 | |||
| 506 | Ga0495632_0008092 | |||
| 507 | Ga0495632_0156965 | |||
| 508 | Ga0495637_0005325 | |||
| 509 | Ga0495643_0120168 | |||
| 510 | Ga0495644_0167333 | |||
| 511 | Ga0495648_0000107 | |||
| 512 | Ga0495648_0066732 | |||
| 513 | Ga0495648_0140056 | |||
| 514 | Ga0495648_0173119 | |||
| 515 | Ga0495654_0000085 | |||
| 516 | Ga0495609_0161569 | |||
| 517 | Ga0495621_0085626 | |||
| 518 | Ga0495597_0067789 | |||
| 519 | Ga0495668_0000746 | |||
| 520 | Ga0495668_0040468 | |||
| 521 | Ga0495668_0086953 | |||
| 522 | Ga0495668_0145181 | |||
| 523 | Ga0495625_0000767 | |||
| 524 | Ga0495625_0196249 | |||
| 525 | Ga0495625_0287220 | |||
| 526 | Ga0495625_0350946 | |||
| 527 | Ga0495625_0498868 | |||
| 528 | Ga0495659_0160662 | |||
| 529 | Ga0495669_0012797 | |||
| 530 | Ga0495669_0066881 | |||
| 531 | Ga0495670_0247813 | |||
| 532 | Ga0495671_0042803 | |||
| 533 | Ga0495589_0009441 | |||
| 534 | Ga0495660_0011449 | |||
| 535 | Ga0495674_0268400 | |||
| 536 | Ga0495672_0002338 | |||
| 537 | Ga0495672_0051550 | |||
| 538 | Ga0495687_118306 | |||
| 539 | Ga0495677_0043314 | |||
| 540 | Ga0495679_017081 | |||
| 541 | Ga0495673_0000341 | |||
| 542 | Ga0495673_0001139 | |||
| 543 | Ga0495673_0122765 | |||
| 544 | Ga0495681_0032016 | |||
| 545 | Ga0495686_0000747 | |||
| 546 | Ga0495686_0010888 | |||
| 547 | Ga0495686_0021718 | |||
| 548 | Ga0495686_0042001 | |||
| 549 | Ga0496101_0393959 | |||
| 550 | Ga0496104_0230005 | |||
| 551 | Ga0496107_0001612 | |||
| 552 | Ga0496107_0094999 | |||
| 553 | Ga0496114_0168862 | |||
| 554 | Ga0496114_0363676 | |||
| 555 | Ga0496115_0004645 | |||
| 556 | Ga0496115_0329592 | |||
| 557 | Ga0496121_0012501 | |||
| 558 | Ga0496124_0016862 | |||
| 559 | Ga0496125_0022477 | |||
| 560 | Ga0496126_0004417 | |||
| 561 | Ga0495678_013151 | |||
| 562 | Ga0501033_0019625 | |||
| 563 | Ga0501034_0053454 | |||
| 564 | Ga0501036_0885492 | |||
| 565 | Ga0501037_0038513 | |||
| 566 | Ga0501038_0375796 | |||
| 567 | Ga0501042_0067381 | |||
| 568 | Ga0501047_0035352 | |||
| 569 | Ga0501068_0417977 | |||
| 570 | Ga0501071_0028258 | |||
| 571 | Ga0501072_0039391 | |||
| 572 | Ga0501074_0133844 | |||
| 573 | Ga0501075_0184737 | |||
| 574 | Ga0501075_0304530 | |||
| 575 | Ga0501077_0153936 | |||
| 576 | Ga0501238_001252 | |||
| 577 | Ga0501079_0329229 | |||
| 578 | Ga0501080_0246869 | |||
| 579 | Ga0501044_0007941 | |||
| 580 | Ga0501044_0012534 | |||
| 581 | Ga0501045_0035835 | |||
| 582 | nmdc:mga00v17_494_c1 | |||
| 583 | nmdc:mga0k408_126576_c1 | |||
| 584 | nmdc:mga0k408_26405_c1 | |||
| 585 | nmdc:mga06z11_143944_c1 | |||
| 586 | nmdc:mga07m45_73803_c1 | |||
| 587 | nmdc:mga05p37_566641_c1 | |||
| 588 | nmdc:mga08y16_57983_c1 | |||
| 589 | nmdc:mga08y16_81635_c1 | |||
| 590 | nmdc:mga0a205_3604_c1 | |||
| 591 | nmdc:mga0sz30_15197_c2 | |||
| 592 | nmdc:mga0sz30_2040_c1 | |||
| 593 | Ga0500578_0000015 | |||
| 594 | Ga0500644_0009374 | |||
| 595 | Ga0500583_0169218 | |||
| 596 | Ga0500554_001481 | |||
| 597 | Ga0500555_015089 | |||
| 598 | Ga0500556_0001513 | |||
| 599 | Ga0500594_0000554 | |||
| 600 | Ga0500595_026153 | |||
| 601 | Ga0500608_000011 | |||
| 602 | Ga0500608_083191 | |||
| 603 | Ga0500618_000159 | |||
| 604 | Ga0500559_0000009 | |||
| 605 | Ga0500559_0002111 | |||
| 606 | Ga0500559_0013358 | |||
| 607 | Ga0500564_000225 | |||
| 608 | Ga0500577_0006096 | |||
| 609 | Ga0500588_0033261 | |||
| 610 | Ga0500616_0079696 | |||
| 611 | Ga0500616_0096566 | |||
| 612 | Ga0500622_0000346 | |||
| 613 | Ga0500622_0005914 | |||
| 614 | Ga0500622_0012444 | |||
| 615 | Ga0500627_0002760 | |||
| 616 | Ga0500611_001653 | |||
| 617 | Ga0500645_004109 | |||
| 618 | Ga0500609_000839 | |||
| 619 | Ga0501084_0025523 | |||
| 620 | 2511122279 | |||
| 621 | 2585149783 | |||
| 622 | 2585151206 | |||
| 623 | 2585197077 | |||
| 624 | 2587920001 | |||
| 625 | 2643747631 | |||
| 626 | 2643781968 | |||
| 627 | 2643924102 | |||
| 628 | 2643931938 | |||
| 629 | 2644223367 | |||
| 630 | 2644237109 | |||
| 631 | 2644506987 | |||
| 632 | 2792460800 | |||
| 633 | 2819538283 | |||
| 634 | 2819647147 | |||
| 635 | 2843745541 | |||
| 636 | 2849561155 | |||
| 637 | 2849576136 | |||
| 638 | 2851157190 | |||
| 639 | 2857505743 | |||
| 640 | 2884965559 | |||
| 641 | 2898332849 | |||
| 642 | 2928532143 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2wjz-assembly3.cif.gz_D | crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity | 0.9354 | 3 | 210 |
| 2wjz-assembly1.cif.gz_B | crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity | 0.9322 | 3 | 210 |
| 4gud-assembly2.cif.gz_B | crystal structure of amidotransferase hish from vibrio cholerae | 0.9273 | 1 | 210 |
| 7ac8-assembly3.cif.gz_F | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9223 | 3 | 210 |
| 1ka9-assembly1.cif.gz_H | imidazole glycerol phosphate synthase | 0.9205 | 3 | 212 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57929_1_195_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9544 | 4 | 211 | 3.40.50.880 |
| af_Q57929_1_195_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9449 | 4 | 211 | 3.40.50.880 |
| af_Q2FUU1_1_190_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9356 | 4 | 202 | 3.40.50.880 |
| 2wjzB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9322 | 3 | 210 | 3.40.50.880 |
| af_P9WMM1_1_205_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.931 | 2 | 211 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258DBC4-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH | 0.9984 | 15 | 213 |
GO:0000105
GO:0000107 GO:0004359 GO:0006541 GO:0016829 |
| AF-P58788-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) | 0.9904 | 3 | 213 |
GO:0000105
GO:0000107 GO:0004359 GO:0005737 GO:0016829 |
| AF-A0A839F7Y1-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) | 0.99 | 3 | 213 |
GO:0000105
GO:0000107 GO:0005737 GO:0006541 GO:0016787 GO:0016829 |
| AF-A0A258DBC4-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH | 0.9885 | 15 | 213 |
GO:0000105
GO:0000107 GO:0004359 GO:0006541 GO:0016829 |
| AF-A0A4Q3FG20-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH | 0.9874 | 50 | 213 |
GO:0000105
GO:0000107 GO:0004359 GO:0006541 GO:0016829 |