F406060

General Info

Members Datasets Scaffolds Average Seq Length
321 187 642 94

Family's Representative Sequence

Representative Sequence 3300034820|Ga0373959_0140382|Ga0373959_0140382_222_560
Length 112
Sequence MFHGSHGVVRNDHIEEKQSMSARCPHLAEVRNVPPKTPDGCEECLATGGRWVHLRLCQECGHVGCCDNSPGRHATKHFHASRHAIMRSFEPGEDWSWCYVDELFFEPAVGPA

Samples

Sample ID Description Type Environment
1 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
142 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
143 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
144 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
145 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
146 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
147 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
148 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
153 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 1.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.28
Rhizosphere 89.41
Stem 0
Stem Tuber 0
Unclassified 7.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373959_0140382 3300034820 Bacteria 604
2 Ga0065715_10374054 3300005293 Bacteria 899
3 Ga0070658_11053869 3300005327 Bacteria 707
4 Ga0070676_10558697 3300005328 Bacteria 820
5 Ga0070683_100190927 3300005329 Bacteria 1945
6 Ga0070683_101984518 3300005329 Bacteria 559
7 Ga0070680_100012060 3300005336 Bacteria 6709
8 Ga0070680_100024104 3300005336 Bacteria 4855
9 Ga0070680_100142366 3300005336 Bacteria 2011
10 Ga0070680_100815118 3300005336 Unclassified 804
11 Ga0070680_101097366 3300005336 Bacteria 688
12 Ga0070682_100124071 3300005337 Bacteria 1738
13 Ga0070682_100511627 3300005337 Bacteria 932
14 Ga0068868_100097370 3300005338 Bacteria 2377
15 Ga0070660_100013594 3300005339 Bacteria 5846
16 Ga0070661_100137790 3300005344 Bacteria 1837
17 Ga0070668_100065789 3300005347 Bacteria 2812
18 Ga0070668_100413593 3300005347 Bacteria 1153
19 Ga0070675_100454066 3300005354 Bacteria 1150
20 Ga0070674_100944198 3300005356 Bacteria 754
21 Ga0070659_100030420 3300005366 Bacteria 4179
22 Ga0070667_102050679 3300005367 Bacteria 539
23 Ga0070709_10899412 3300005434 Bacteria 700
24 Ga0070714_100028991 3300005435 Bacteria 4598
25 Ga0070714_100868305 3300005435 Unclassified 875
26 Ga0070713_100218736 3300005436 Bacteria 1727
27 Ga0070710_11370748 3300005437 Bacteria 528
28 Ga0070711_100429594 3300005439 Bacteria 1078
29 Ga0070705_100027334 3300005440 Bacteria 3114
30 Ga0070705_100592797 3300005440 Bacteria 856
31 Ga0070694_100012159 3300005444 Bacteria 5348
32 Ga0070708_100055697 3300005445 Bacteria 3516
33 Ga0070708_100513497 3300005445 Bacteria 1130
34 Ga0070708_101167194 3300005445 Unclassified 721
35 Ga0070663_100061714 3300005455 Bacteria 2700
36 Ga0070663_100545969 3300005455 Bacteria 968
37 Ga0070663_101378122 3300005455 Bacteria 624
38 Ga0070678_100771249 3300005456 Bacteria 871
39 Ga0070662_100628202 3300005457 Bacteria 905
40 Ga0070681_10072360 3300005458 Bacteria 3410
41 Ga0070681_10079104 3300005458 Bacteria 3244
42 Ga0070681_10374331 3300005458 Bacteria 1335
43 Ga0068867_100072902 3300005459 Bacteria 2571
44 Ga0070706_100028438 3300005467 Bacteria 5146
45 Ga0070706_100371115 3300005467 Bacteria 1333
46 Ga0070706_100451103 3300005467 Unclassified 1197
47 Ga0070706_100455075 3300005467 Bacteria 1191
48 Ga0070707_100045992 3300005468 Unclassified 4177
49 Ga0070707_100692755 3300005468 Bacteria 982
50 Ga0070698_100652859 3300005471 Unclassified 993
51 Ga0070699_100006341 3300005518 Bacteria 10314
52 Ga0070699_100855484 3300005518 Bacteria 833
53 Ga0070699_101222346 3300005518 Bacteria 689
54 Ga0070679_100005680 3300005530 Bacteria 11568
55 Ga0070679_100134592 3300005530 Bacteria 2452
56 Ga0070679_100201795 3300005530 Bacteria 1954
57 Ga0070679_100503578 3300005530 Bacteria 1155
58 Ga0070679_100768048 3300005530 Unclassified 907
59 Ga0070679_100994308 3300005530 Bacteria 783
60 Ga0070684_100027208 3300005535 Bacteria 4824
61 Ga0070697_100008629 3300005536 Bacteria 7958
62 Ga0070697_100106422 3300005536 Bacteria 2333
63 Ga0070697_100325294 3300005536 Bacteria 1324
64 Ga0068853_100027367 3300005539 Bacteria 4790
65 Ga0068853_100459563 3300005539 Bacteria 1198
66 Ga0070672_100264607 3300005543 Bacteria 1451
67 Ga0070695_100271577 3300005545 Bacteria 1242
68 Ga0070696_100021393 3300005546 Bacteria 4385
69 Ga0070693_100463299 3300005547 Bacteria 892
70 Ga0070665_100220317 3300005548 Bacteria 1898
71 Ga0070704_100166933 3300005549 Unclassified 1746
72 Ga0070704_100346200 3300005549 Bacteria 1253
73 Ga0068855_100026052 3300005563 Bacteria 6995
74 Ga0068855_100766339 3300005563 Bacteria 1028
75 Ga0068857_100479865 3300005577 Bacteria 1165
76 Ga0068854_100034974 3300005578 Bacteria 3514
77 Ga0068856_100138047 3300005614 Bacteria 2444
78 Ga0068856_100259305 3300005614 Bacteria 1754
79 Ga0068852_100087412 3300005616 Bacteria 2781
80 Ga0068864_100021145 3300005618 Bacteria 5448
81 Ga0068864_100612220 3300005618 Bacteria 1058
82 Ga0068861_100359891 3300005719 Bacteria 1279
83 Ga0068863_100103871 3300005841 Bacteria 2703
84 Ga0068862_101370572 3300005844 Bacteria 710
85 Ga0070717_10023963 3300006028 Bacteria 4842
86 Ga0070717_10160410 3300006028 Bacteria 1950
87 Ga0070715_10680534 3300006163 Bacteria 612
88 Ga0070716_100452177 3300006173 Bacteria 936
89 Ga0070716_101530671 3300006173 Bacteria 546
90 Ga0070712_100120415 3300006175 Bacteria 1974
91 Ga0070712_100454663 3300006175 Bacteria 1067
92 Ga0070712_100613002 3300006175 Bacteria 922
93 Ga0075428_100026546 3300006844 Bacteria 6411
94 Ga0075430_101077842 3300006846 Bacteria 662
95 Ga0075431_100091955 3300006847 Bacteria 3131
96 Ga0075431_100194354 3300006847 Bacteria 2078
97 Ga0075433_10082908 3300006852 Bacteria 2829
98 Ga0075433_10378023 3300006852 Bacteria 1251
99 Ga0075433_10889261 3300006852 Bacteria 777
100 Ga0075434_100036107 3300006871 Bacteria 4887
101 Ga0075434_100054578 3300006871 Bacteria 3970
102 Ga0075434_100127003 3300006871 Bacteria 2567
103 Ga0075434_100240617 3300006871 Bacteria 1830
104 Ga0075434_102056309 3300006871 Bacteria 576
105 Ga0075429_100261176 3300006880 Bacteria 1516
106 Ga0075436_100032762 3300006914 Bacteria 3582
107 Ga0075435_101101659 3300007076 Bacteria 694
108 Ga0105240_10267000 3300009093 Bacteria 1972
109 Ga0114129_10000262 3300009147 Bacteria 59389
110 Ga0114129_10578268 3300009147 Unclassified 1458
111 Ga0105243_11999985 3300009148 Bacteria 614
112 Ga0105241_12381598 3300009174 Bacteria 528
113 Ga0105248_10180808 3300009177 Bacteria 2377
114 Ga0105248_10903105 3300009177 Bacteria 997
115 Ga0105238_10594104 3300009551 Bacteria 1114
116 Ga0105238_12229066 3300009551 Bacteria 583
117 Ga0105249_10000009 3300009553 Bacteria 313866
118 Ga0105249_10274679 3300009553 Bacteria 1680
119 Ga0105239_10100660 3300010375 Bacteria 3196
120 Ga0157373_10684531 3300013100 Bacteria 751
121 Ga0157370_10070198 3300013104 Bacteria 3307
122 Ga0157369_10009308 3300013105 Bacteria 11239
123 Ga0157369_10317681 3300013105 Bacteria 1619
124 Ga0157369_11171279 3300013105 Bacteria 785
125 Ga0157378_11659133 3300013297 Bacteria 686
126 Ga0157372_10025884 3300013307 Bacteria 6381
127 Ga0157372_10072309 3300013307 Bacteria 3887
128 Ga0157375_10219461 3300013308 Bacteria 2060
129 Ga0157375_13360725 3300013308 Bacteria 533
130 Ga0163163_10690807 3300014325 Bacteria 1084
131 Ga0163163_11654635 3300014325 Bacteria 701
132 Ga0163163_12575366 3300014325 Bacteria 566
133 Ga0182008_10029881 3300014497 Bacteria 2751
134 Ga0157377_11303616 3300014745 Bacteria 568
135 Ga0157379_10433681 3300014968 Bacteria 1211
136 Ga0163161_11597346 3300017792 Bacteria 575
137 Ga0206351_10187896 3300020077 Bacteria 767
138 Ga0206350_10937331 3300020080 Bacteria 575
139 Ga0154015_1281331 3300020610 Bacteria 760
140 Ga0213875_10017539 3300021388 Bacteria 3457
141 Ga0224712_10145666 3300022467 Bacteria 1046
142 Ga0207642_10441710 3300025899 Bacteria 786
143 Ga0207685_10544502 3300025905 Bacteria 616
144 Ga0207699_11027929 3300025906 Bacteria 609
145 Ga0207699_11057030 3300025906 Bacteria 601
146 Ga0207705_11382170 3300025909 Bacteria 536
147 Ga0207684_10283259 3300025910 Bacteria 1429
148 Ga0207684_10300270 3300025910 Bacteria 1384
149 Ga0207684_10429307 3300025910 Unclassified 1135
150 Ga0207707_10027496 3300025912 Bacteria 4973
151 Ga0207707_10028292 3300025912 Bacteria 4899
152 Ga0207707_10077700 3300025912 Bacteria 2898
153 Ga0207707_10356289 3300025912 Bacteria 1260
154 Ga0207707_10546060 3300025912 Bacteria 985
155 Ga0207695_10046809 3300025913 Bacteria 4582
156 Ga0207695_11714995 3300025913 Bacteria 509
157 Ga0207693_10190169 3300025915 Unclassified 1615
158 Ga0207693_10216567 3300025915 Bacteria 1505
159 Ga0207693_10653201 3300025915 Bacteria 817
160 Ga0207663_10527744 3300025916 Bacteria 920
161 Ga0207660_10025378 3300025917 Bacteria 4022
162 Ga0207660_10084163 3300025917 Bacteria 2344
163 Ga0207660_10152852 3300025917 Bacteria 1775
164 Ga0207657_10028131 3300025919 Bacteria 5135
165 Ga0207657_11460510 3300025919 Bacteria 512
166 Ga0207652_10041802 3300025921 Bacteria 3899
167 Ga0207652_10054148 3300025921 Bacteria 3448
168 Ga0207652_10131396 3300025921 Bacteria 2233
169 Ga0207652_10442340 3300025921 Bacteria 1172
170 Ga0207652_10875796 3300025921 Bacteria 794
171 Ga0207646_10084364 3300025922 Bacteria 2842
172 Ga0207646_10112283 3300025922 Bacteria 2446
173 Ga0207646_10428510 3300025922 Unclassified 1194
174 Ga0207694_10147165 3300025924 Bacteria 1896
175 Ga0207694_10773464 3300025924 Bacteria 811
176 Ga0207694_10876269 3300025924 Bacteria 759
177 Ga0207694_11106358 3300025924 Bacteria 671
178 Ga0207664_10063291 3300025929 Bacteria 2956
179 Ga0207664_10704415 3300025929 Unclassified 908
180 Ga0207690_10074360 3300025932 Bacteria 2353
181 Ga0207690_10077448 3300025932 Bacteria 2311
182 Ga0207706_10520746 3300025933 Bacteria 1025
183 Ga0207670_10816957 3300025936 Bacteria 777
184 Ga0207669_10330931 3300025937 Bacteria 1169
185 Ga0207665_10018588 3300025939 Bacteria 4566
186 Ga0207665_10692629 3300025939 Bacteria 801
187 Ga0207691_10147179 3300025940 Bacteria 2072
188 Ga0207711_10012192 3300025941 Bacteria 7147
189 Ga0207711_11604806 3300025941 Bacteria 594
190 Ga0207661_10004803 3300025944 Bacteria 9462
191 Ga0207661_10779644 3300025944 Bacteria 880
192 Ga0207667_10130399 3300025949 Bacteria 2589
193 Ga0207667_10354353 3300025949 Bacteria 1496
194 Ga0207651_10852580 3300025960 Bacteria 810
195 Ga0207712_10000077 3300025961 Bacteria 119803
196 Ga0207712_10371009 3300025961 Bacteria 1195
197 Ga0207668_10060786 3300025972 Bacteria 2653
198 Ga0207668_10119420 3300025972 Bacteria 1993
199 Ga0207640_10072158 3300025981 Bacteria 2328
200 Ga0207658_11561043 3300025986 Bacteria 604
201 Ga0207677_10659040 3300026023 Bacteria 925
202 Ga0207703_11011029 3300026035 Bacteria 798
203 Ga0207639_10088444 3300026041 Bacteria 2472
204 Ga0207678_10043405 3300026067 Bacteria 3891
205 Ga0207678_10043687 3300026067 Bacteria 3877
206 Ga0207678_10527567 3300026067 Bacteria 1031
207 Ga0207708_10078926 3300026075 Bacteria 2528
208 Ga0207702_10126958 3300026078 Bacteria 2291
209 Ga0207702_10145898 3300026078 Bacteria 2147
210 Ga0207702_11004280 3300026078 Bacteria 828
211 Ga0207702_11434877 3300026078 Unclassified 684
212 Ga0207641_11333215 3300026088 Bacteria 718
213 Ga0207676_10035217 3300026095 Bacteria 3798
214 Ga0207676_10166777 3300026095 Unclassified 1914
215 Ga0207676_10852496 3300026095 Bacteria 891
216 Ga0207676_11634778 3300026095 Bacteria 642
217 Ga0207675_100467083 3300026118 Bacteria 1252
218 Ga0207683_10464051 3300026121 Bacteria 1168
219 Ga0207683_11508483 3300026121 Bacteria 621
220 Ga0207698_10167482 3300026142 Bacteria 1930
221 Ga0207698_10618738 3300026142 Bacteria 1069
222 Ga0268265_11263945 3300028380 Bacteria 737
223 Ga0268265_12476500 3300028380 Bacteria 525
224 Ga0307408_100643573 3300031548 Bacteria 947
225 Ga0265314_10587916 3300031711 Bacteria 575
226 Ga0307405_10257389 3300031731 Bacteria 1302
227 Ga0307405_10363009 3300031731 Bacteria 1121
228 Ga0307413_10761916 3300031824 Bacteria 810
229 Ga0307410_10819226 3300031852 Bacteria 793
230 Ga0307406_10027287 3300031901 Bacteria 3440
231 Ga0307407_10416921 3300031903 Bacteria 967
232 Ga0307407_10667129 3300031903 Bacteria 780
233 Ga0307409_100040559 3300031995 Bacteria 3468
234 Ga0307409_100209481 3300031995 Bacteria 1751
235 Ga0307416_100011443 3300032002 Bacteria 5918
236 Ga0307416_100532575 3300032002 Bacteria 1245
237 Ga0307416_101433367 3300032002 Unclassified 796
238 Ga0307416_102299705 3300032002 Bacteria 639
239 Ga0307414_10151177 3300032004 Bacteria 1832
240 Ga0307414_10937486 3300032004 Bacteria 795
241 Ga0307414_11347792 3300032004 Unclassified 662
242 Ga0307411_10236869 3300032005 Unclassified 1426
243 Ga0307411_10314280 3300032005 Bacteria 1262
244 Ga0307411_10831656 3300032005 Bacteria 815
245 Ga0307415_100462331 3300032126 Unclassified 1100
246 Ga0307415_100767706 3300032126 Unclassified 877
247 Ga0307415_101872309 3300032126 Bacteria 582
248 Ga0373930_0029080 3300034816 Bacteria 1128
249 Ga0373928_0103207 3300035084 Bacteria 746
250 Ga0373929_0005879 3300035085 Bacteria 2216
251 Ga0373940_0120907 3300035088 Bacteria 812
252 Ga0373949_0171095 3300035090 Bacteria 639
253 Ga0373952_0168084 3300035092 Bacteria 625
254 Ga0373932_0072153 3300035112 Bacteria 1073
255 Ga0373941_0025904 3300035115 Bacteria 1699
256 Ga0373931_0030280 3300035691 Bacteria 2785
257 Ga0373931_0129051 3300035691 Bacteria 1453
258 Ga0395905_0567054 3300037471 Bacteria 1037
259 Ga0395901_0568421 3300038443 Bacteria 1147
260 Ga0395901_1824928 3300038443 Bacteria 557
261 Ga0242420_008842 3300038996 Bacteria 1642
262 Ga0451797_0135164 3300041453 Bacteria 581
263 Ga0453683_0466434 3300044673 Bacteria 818
264 Ga0466964_0744580 3300044706 Bacteria 550
265 Ga0466958_0763682 3300045836 Bacteria 630
266 Ga0466967_0967494 3300045976 Bacteria 847
267 Ga0495603_0166363 3300046455 Bacteria 1278
268 Ga0495603_0642395 3300046455 Bacteria 607
269 Ga0495629_0945852 3300046459 Bacteria 563
270 Ga0495665_0262565 3300046531 Bacteria 888
271 Ga0495668_0806108 3300046616 Bacteria 520
272 Ga0495647_0136951 3300046681 Bacteria 1042
273 Ga0495613_0022496 3300046689 Bacteria 4696
274 Ga0495581_0056760 3300047315 Bacteria 2260
275 Ga0495686_0013424 3300047472 Bacteria 5681
276 Ga0496100_0194271 3300048903 Bacteria 1475
277 Ga0496101_0957785 3300048904 Bacteria 673
278 Ga0496102_0011529 3300048905 Bacteria 7625
279 Ga0496102_0152549 3300048905 Bacteria 2172
280 Ga0496102_0221683 3300048905 Unclassified 1783
281 Ga0496103_0015854 3300048906 Bacteria 4493
282 Ga0496104_0012200 3300048907 Bacteria 7721
283 Ga0496104_0093431 3300048907 Bacteria 2877
284 Ga0496105_0045077 3300048908 Bacteria 3639
285 Ga0496105_0551961 3300048908 Bacteria 899
286 Ga0496106_0089337 3300048909 Bacteria 2376
287 Ga0496106_0154967 3300048909 Bacteria 1809
288 Ga0496106_0300438 3300048909 Bacteria 1287
289 Ga0496106_0514658 3300048909 Bacteria 961
290 Ga0496106_0901529 3300048909 Bacteria 698
291 Ga0496108_0041412 3300048911 Bacteria 3846
292 Ga0496108_0046366 3300048911 Bacteria 3631
293 Ga0496109_0002703 3300048912 Bacteria 14870
294 Ga0496109_0014427 3300048912 Bacteria 6875
295 Ga0496109_0043602 3300048912 Bacteria 4066
296 Ga0496110_0035086 3300048913 Bacteria 4349
297 Ga0496110_0097980 3300048913 Bacteria 2627
298 Ga0496110_0263953 3300048913 Bacteria 1567
299 Ga0496111_0060408 3300048914 Bacteria 2748
300 Ga0496111_0399257 3300048914 Bacteria 1016
301 Ga0496112_0000234 3300048915 Bacteria 35575
302 Ga0496112_0000676 3300048915 Bacteria 23790
303 Ga0496112_0011150 3300048915 Bacteria 8196
304 Ga0496112_0487010 3300048915 Bacteria 1169
305 Ga0496113_0021037 3300048916 Bacteria 4597
306 Ga0496113_0021802 3300048916 Bacteria 4523
307 Ga0496114_0217204 3300048917 Bacteria 1678
308 Ga0501283_133807 3300049779 Bacteria 505
309 nmdc:mga05p37_3765_c1 3300050507 Bacteria 17758
310 nmdc:mga09592_264508_c1 3300050508 Bacteria 1492
311 nmdc:mga0qj67_597142_c1 3300050509 Unclassified 883
312 nmdc:mga06r32_522622_c1 3300050510 Unclassified 1162
313 nmdc:mga06r32_53939_c1 3300050510 Bacteria 3853
314 nmdc:mga0n895_1504427_c1 3300050512 Bacteria 639
315 nmdc:mga0n895_36972_c1 3300050512 Bacteria 4719
316 nmdc:mga0n895_429063_c1 3300050512 Bacteria 1336
317 nmdc:mga0n895_76433_c1 3300050512 Bacteria 3330
318 nmdc:mga08x19_281665_c1 3300050514 Bacteria 1152
319 nmdc:mga0a205_298475_c1 3300050515 Bacteria 1484
320 nmdc:mga0a205_379491_c1 3300050515 Bacteria 1279
321 nmdc:mga0a205_96568_c1 3300050515 Bacteria 2854
322 Ga0373959_0140382
323 Ga0065715_10374054
324 Ga0070658_11053869
325 Ga0070676_10558697
326 Ga0070683_100190927
327 Ga0070683_101984518
328 Ga0070680_100012060
329 Ga0070680_100024104
330 Ga0070680_100142366
331 Ga0070680_100815118
332 Ga0070680_101097366
333 Ga0070682_100124071
334 Ga0070682_100511627
335 Ga0068868_100097370
336 Ga0070660_100013594
337 Ga0070661_100137790
338 Ga0070668_100065789
339 Ga0070668_100413593
340 Ga0070675_100454066
341 Ga0070674_100944198
342 Ga0070659_100030420
343 Ga0070667_102050679
344 Ga0070709_10899412
345 Ga0070714_100028991
346 Ga0070714_100868305
347 Ga0070713_100218736
348 Ga0070710_11370748
349 Ga0070711_100429594
350 Ga0070705_100027334
351 Ga0070705_100592797
352 Ga0070694_100012159
353 Ga0070708_100055697
354 Ga0070708_100513497
355 Ga0070708_101167194
356 Ga0070663_100061714
357 Ga0070663_100545969
358 Ga0070663_101378122
359 Ga0070678_100771249
360 Ga0070662_100628202
361 Ga0070681_10072360
362 Ga0070681_10079104
363 Ga0070681_10374331
364 Ga0068867_100072902
365 Ga0070706_100028438
366 Ga0070706_100371115
367 Ga0070706_100451103
368 Ga0070706_100455075
369 Ga0070707_100045992
370 Ga0070707_100692755
371 Ga0070698_100652859
372 Ga0070699_100006341
373 Ga0070699_100855484
374 Ga0070699_101222346
375 Ga0070679_100005680
376 Ga0070679_100134592
377 Ga0070679_100201795
378 Ga0070679_100503578
379 Ga0070679_100768048
380 Ga0070679_100994308
381 Ga0070684_100027208
382 Ga0070697_100008629
383 Ga0070697_100106422
384 Ga0070697_100325294
385 Ga0068853_100027367
386 Ga0068853_100459563
387 Ga0070672_100264607
388 Ga0070695_100271577
389 Ga0070696_100021393
390 Ga0070693_100463299
391 Ga0070665_100220317
392 Ga0070704_100166933
393 Ga0070704_100346200
394 Ga0068855_100026052
395 Ga0068855_100766339
396 Ga0068857_100479865
397 Ga0068854_100034974
398 Ga0068856_100138047
399 Ga0068856_100259305
400 Ga0068852_100087412
401 Ga0068864_100021145
402 Ga0068864_100612220
403 Ga0068861_100359891
404 Ga0068863_100103871
405 Ga0068862_101370572
406 Ga0070717_10023963
407 Ga0070717_10160410
408 Ga0070715_10680534
409 Ga0070716_100452177
410 Ga0070716_101530671
411 Ga0070712_100120415
412 Ga0070712_100454663
413 Ga0070712_100613002
414 Ga0075428_100026546
415 Ga0075430_101077842
416 Ga0075431_100091955
417 Ga0075431_100194354
418 Ga0075433_10082908
419 Ga0075433_10378023
420 Ga0075433_10889261
421 Ga0075434_100036107
422 Ga0075434_100054578
423 Ga0075434_100127003
424 Ga0075434_100240617
425 Ga0075434_102056309
426 Ga0075429_100261176
427 Ga0075436_100032762
428 Ga0075435_101101659
429 Ga0105240_10267000
430 Ga0114129_10000262
431 Ga0114129_10578268
432 Ga0105243_11999985
433 Ga0105241_12381598
434 Ga0105248_10180808
435 Ga0105248_10903105
436 Ga0105238_10594104
437 Ga0105238_12229066
438 Ga0105249_10000009
439 Ga0105249_10274679
440 Ga0105239_10100660
441 Ga0157373_10684531
442 Ga0157370_10070198
443 Ga0157369_10009308
444 Ga0157369_10317681
445 Ga0157369_11171279
446 Ga0157378_11659133
447 Ga0157372_10025884
448 Ga0157372_10072309
449 Ga0157375_10219461
450 Ga0157375_13360725
451 Ga0163163_10690807
452 Ga0163163_11654635
453 Ga0163163_12575366
454 Ga0182008_10029881
455 Ga0157377_11303616
456 Ga0157379_10433681
457 Ga0163161_11597346
458 Ga0206351_10187896
459 Ga0206350_10937331
460 Ga0154015_1281331
461 Ga0213875_10017539
462 Ga0224712_10145666
463 Ga0207642_10441710
464 Ga0207685_10544502
465 Ga0207699_11027929
466 Ga0207699_11057030
467 Ga0207705_11382170
468 Ga0207684_10283259
469 Ga0207684_10300270
470 Ga0207684_10429307
471 Ga0207707_10027496
472 Ga0207707_10028292
473 Ga0207707_10077700
474 Ga0207707_10356289
475 Ga0207707_10546060
476 Ga0207695_10046809
477 Ga0207695_11714995
478 Ga0207693_10190169
479 Ga0207693_10216567
480 Ga0207693_10653201
481 Ga0207663_10527744
482 Ga0207660_10025378
483 Ga0207660_10084163
484 Ga0207660_10152852
485 Ga0207657_10028131
486 Ga0207657_11460510
487 Ga0207652_10041802
488 Ga0207652_10054148
489 Ga0207652_10131396
490 Ga0207652_10442340
491 Ga0207652_10875796
492 Ga0207646_10084364
493 Ga0207646_10112283
494 Ga0207646_10428510
495 Ga0207694_10147165
496 Ga0207694_10773464
497 Ga0207694_10876269
498 Ga0207694_11106358
499 Ga0207664_10063291
500 Ga0207664_10704415
501 Ga0207690_10074360
502 Ga0207690_10077448
503 Ga0207706_10520746
504 Ga0207670_10816957
505 Ga0207669_10330931
506 Ga0207665_10018588
507 Ga0207665_10692629
508 Ga0207691_10147179
509 Ga0207711_10012192
510 Ga0207711_11604806
511 Ga0207661_10004803
512 Ga0207661_10779644
513 Ga0207667_10130399
514 Ga0207667_10354353
515 Ga0207651_10852580
516 Ga0207712_10000077
517 Ga0207712_10371009
518 Ga0207668_10060786
519 Ga0207668_10119420
520 Ga0207640_10072158
521 Ga0207658_11561043
522 Ga0207677_10659040
523 Ga0207703_11011029
524 Ga0207639_10088444
525 Ga0207678_10043405
526 Ga0207678_10043687
527 Ga0207678_10527567
528 Ga0207708_10078926
529 Ga0207702_10126958
530 Ga0207702_10145898
531 Ga0207702_11004280
532 Ga0207702_11434877
533 Ga0207641_11333215
534 Ga0207676_10035217
535 Ga0207676_10166777
536 Ga0207676_10852496
537 Ga0207676_11634778
538 Ga0207675_100467083
539 Ga0207683_10464051
540 Ga0207683_11508483
541 Ga0207698_10167482
542 Ga0207698_10618738
543 Ga0268265_11263945
544 Ga0268265_12476500
545 Ga0307408_100643573
546 Ga0265314_10587916
547 Ga0307405_10257389
548 Ga0307405_10363009
549 Ga0307413_10761916
550 Ga0307410_10819226
551 Ga0307406_10027287
552 Ga0307407_10416921
553 Ga0307407_10667129
554 Ga0307409_100040559
555 Ga0307409_100209481
556 Ga0307416_100011443
557 Ga0307416_100532575
558 Ga0307416_101433367
559 Ga0307416_102299705
560 Ga0307414_10151177
561 Ga0307414_10937486
562 Ga0307414_11347792
563 Ga0307411_10236869
564 Ga0307411_10314280
565 Ga0307411_10831656
566 Ga0307415_100462331
567 Ga0307415_100767706
568 Ga0307415_101872309
569 Ga0373930_0029080
570 Ga0373928_0103207
571 Ga0373929_0005879
572 Ga0373940_0120907
573 Ga0373949_0171095
574 Ga0373952_0168084
575 Ga0373932_0072153
576 Ga0373941_0025904
577 Ga0373931_0030280
578 Ga0373931_0129051
579 Ga0395905_0567054
580 Ga0395901_0568421
581 Ga0395901_1824928
582 Ga0242420_008842
583 Ga0451797_0135164
584 Ga0453683_0466434
585 Ga0466964_0744580
586 Ga0466958_0763682
587 Ga0466967_0967494
588 Ga0495603_0166363
589 Ga0495603_0642395
590 Ga0495629_0945852
591 Ga0495665_0262565
592 Ga0495668_0806108
593 Ga0495647_0136951
594 Ga0495613_0022496
595 Ga0495581_0056760
596 Ga0495686_0013424
597 Ga0496100_0194271
598 Ga0496101_0957785
599 Ga0496102_0011529
600 Ga0496102_0152549
601 Ga0496102_0221683
602 Ga0496103_0015854
603 Ga0496104_0012200
604 Ga0496104_0093431
605 Ga0496105_0045077
606 Ga0496105_0551961
607 Ga0496106_0089337
608 Ga0496106_0154967
609 Ga0496106_0300438
610 Ga0496106_0514658
611 Ga0496106_0901529
612 Ga0496108_0041412
613 Ga0496108_0046366
614 Ga0496109_0002703
615 Ga0496109_0014427
616 Ga0496109_0043602
617 Ga0496110_0035086
618 Ga0496110_0097980
619 Ga0496110_0263953
620 Ga0496111_0060408
621 Ga0496111_0399257
622 Ga0496112_0000234
623 Ga0496112_0000676
624 Ga0496112_0011150
625 Ga0496112_0487010
626 Ga0496113_0021037
627 Ga0496113_0021802
628 Ga0496114_0217204
629 Ga0501283_133807
630 nmdc:mga05p37_3765_c1
631 nmdc:mga09592_264508_c1
632 nmdc:mga0qj67_597142_c1
633 nmdc:mga06r32_522622_c1
634 nmdc:mga06r32_53939_c1
635 nmdc:mga0n895_1504427_c1
636 nmdc:mga0n895_36972_c1
637 nmdc:mga0n895_429063_c1
638 nmdc:mga0n895_76433_c1
639 nmdc:mga08x19_281665_c1
640 nmdc:mga0a205_298475_c1
641 nmdc:mga0a205_379491_c1
642 nmdc:mga0a205_96568_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02148

zf-UBP

Zn-finger in ubiquitin-hydrolases and other protein

41

109

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8746 1 94
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8658 1 94
3phd-assembly1.cif.gz_B crystal structure of human hdac6 in complex with ubiquitin 0.8159 1 87
4zux-assembly2.cif.gz_j saga dub module ubp8/sgf11/sus1/sgf73 bound to ubiqitinated nucleosome 0.8147 33 86
3phd-assembly1.cif.gz_D crystal structure of human hdac6 in complex with ubiquitin 0.8136 4 91
ID Description Score Start End Superfamily
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9369 1 89 3.30.40.10
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9269 1 89 3.30.40.10
af_Q4DD96_272_345_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9074 21 85 3.30.40.10
af_Q54QE6_6_116_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9028 20 87 3.30.40.10
af_A4HRG6_422_490_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8946 21 85 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A1H3IX77-F1-model_v4 Ubiquitin-hydrolase Zn-finger-containing protein 0.9913 33 85 GO:0008270
GO:0016787
AF-A0A7C1JR31-F1-model_v4 UBP-type domain-containing protein 0.9863 5 85 GO:0008270
AF-A0A535JQR3-F1-model_v4 UBP-type zinc finger domain-containing protein 0.9842 4 87 GO:0008270
AF-A0A529SVC8-F1-model_v4 UBP-type domain-containing protein 0.978 34 86 GO:0008270
AF-A0A841NYZ2-F1-model_v4 deleted 0.9767 37 86

Map