F405984

General Info

Members Datasets Scaffolds Average Seq Length
321 174 642 252

Family's Representative Sequence

Representative Sequence 3300014745|Ga0157377_10128918|Ga0157377_101289182
Length 275
Sequence MQNYMDLTGKVAIVTGASSGIGHATALSLANCGAAVAVNYHNNEIGAELLRKQIVANGGKAVAIQADVTVASDVESLVKRTVEEFGTVDILVNNAGSLIERLRLLEMSEERWDQVVDLNLKSAFLCCKAVAPLMMERKTGAIINLSSIAGRNGGALGSLHYSSAKGGLISFTKGLAKELAPFGIRVNAVSPGVIDTPYHEQFSSPEMMKNYVNAIPLGRVGNSDDVAKVIAFLASDAASYLVGETIEVNGGMYMDSGIEPQMNTDLNEKGESTVV

Samples

Sample ID Description Type Environment
1 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
153 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
154 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
155 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
156 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
157 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
158 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
159 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.87
Rhizosphere 96.57
Stem 0
Stem Tuber 0
Unclassified 18.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157377_10128918 3300014745 Bacteria 1542
2 CNAas_1000327 3300000532 Unclassified 4574
3 JGI24748J21848_1000027 3300002074 Bacteria 93866
4 JGI24034J26672_10000009 3300002239 Bacteria 160533
5 JGI24034J26672_10000029 3300002239 Bacteria 101926
6 Ga0065704_10199760 3300005289 Unclassified 1152
7 Ga0065712_10009234 3300005290 Bacteria 2256
8 Ga0065707_10262292 3300005295 Bacteria 1094
9 Ga0070690_100057432 3300005330 Bacteria 2497
10 Ga0070670_100037998 3300005331 Unclassified 4140
11 Ga0070670_100284045 3300005331 Unclassified 1445
12 Ga0068869_100016163 3300005334 Bacteria 5026
13 Ga0068869_100018782 3300005334 Bacteria 4713
14 Ga0068869_100234581 3300005334 Unclassified 1459
15 Ga0070666_10123132 3300005335 Bacteria 1799
16 Ga0070666_10321110 3300005335 Bacteria 1105
17 Ga0070680_100001417 3300005336 Bacteria 17337
18 Ga0068868_100753736 3300005338 Unclassified 875
19 Ga0070689_100076677 3300005340 Bacteria 2619
20 Ga0070689_100314825 3300005340 Bacteria 1305
21 Ga0070687_100045390 3300005343 Bacteria 2244
22 Ga0070668_100013207 3300005347 Bacteria 6160
23 Ga0070669_100122069 3300005353 Bacteria 1989
24 Ga0070669_100177299 3300005353 Unclassified 1665
25 Ga0070675_100020303 3300005354 Bacteria 5301
26 Ga0070671_100004007 3300005355 Bacteria 11603
27 Ga0070671_100011407 3300005355 Bacteria 7145
28 Ga0070671_100074774 3300005355 Bacteria 2830
29 Ga0070674_100091434 3300005356 Bacteria 2197
30 Ga0070674_100328979 3300005356 Bacteria 1228
31 Ga0070674_100367774 3300005356 Unclassified 1166
32 Ga0070673_100007970 3300005364 Bacteria 7017
33 Ga0070673_100127694 3300005364 Bacteria 2129
34 Ga0070673_100186647 3300005364 Bacteria 1778
35 Ga0070673_100379887 3300005364 Unclassified 1259
36 Ga0070688_100171279 3300005365 Bacteria 1499
37 Ga0070659_100001815 3300005366 Bacteria 15366
38 Ga0070659_100028096 3300005366 Unclassified 4341
39 Ga0070703_10000356 3300005406 Bacteria 19880
40 Ga0070701_10026888 3300005438 Unclassified 2812
41 Ga0070701_10116827 3300005438 Bacteria 1498
42 Ga0070705_100050054 3300005440 Bacteria 2429
43 Ga0070705_100230108 3300005440 Bacteria 1289
44 Ga0070694_100001725 3300005444 Bacteria 12883
45 Ga0070694_100010211 3300005444 Bacteria 5782
46 Ga0070694_100355686 3300005444 Bacteria 1136
47 Ga0070708_100306740 3300005445 Bacteria 1495
48 Ga0070678_100069209 3300005456 Bacteria 2635
49 Ga0070662_100655204 3300005457 Unclassified 886
50 Ga0070681_10000032 3300005458 Bacteria 99533
51 Ga0070681_10004095 3300005458 Bacteria 13779
52 Ga0070681_10833759 3300005458 Bacteria 840
53 Ga0068867_100109267 3300005459 Bacteria 2122
54 Ga0070706_100084132 3300005467 Bacteria 2948
55 Ga0070707_100000357 3300005468 Bacteria 44868
56 Ga0070707_100007956 3300005468 Bacteria 9845
57 Ga0070707_100449933 3300005468 Bacteria 1248
58 Ga0070698_100007613 3300005471 Bacteria 11720
59 Ga0070698_100012346 3300005471 Bacteria 9045
60 Ga0070698_100061960 3300005471 Unclassified 3774
61 Ga0070698_100250358 3300005471 Bacteria 1704
62 Ga0070698_100369998 3300005471 Bacteria 1365
63 Ga0070699_100032323 3300005518 Bacteria 4517
64 Ga0070699_100245127 3300005518 Bacteria 1600
65 Ga0070699_100685113 3300005518 Unclassified 936
66 Ga0070679_100000331 3300005530 Bacteria 40170
67 Ga0070679_100202240 3300005530 Unclassified 1952
68 Ga0070697_100000082 3300005536 Bacteria 77550
69 Ga0070697_100124834 3300005536 Bacteria 2156
70 Ga0070697_100136933 3300005536 Bacteria 2057
71 Ga0068853_100008332 3300005539 Bacteria 8324
72 Ga0068853_100017700 3300005539 Bacteria 5881
73 Ga0068853_100645028 3300005539 Bacteria 1007
74 Ga0070672_100069606 3300005543 Bacteria 2794
75 Ga0070672_100086415 3300005543 Bacteria 2522
76 Ga0070672_100163264 3300005543 Bacteria 1849
77 Ga0070686_100036868 3300005544 Bacteria 3030
78 Ga0070695_100298065 3300005545 Bacteria 1191
79 Ga0070696_100055124 3300005546 Bacteria 2772
80 Ga0070696_100149460 3300005546 Bacteria 1713
81 Ga0070696_100291927 3300005546 Bacteria 1246
82 Ga0070696_100452930 3300005546 Bacteria 1013
83 Ga0070693_100083786 3300005547 Bacteria 1907
84 Ga0070693_100513573 3300005547 Unclassified 852
85 Ga0070665_100213747 3300005548 Bacteria 1929
86 Ga0070704_100004009 3300005549 Bacteria 8500
87 Ga0070704_100205314 3300005549 Bacteria 1593
88 Ga0068855_100682895 3300005563 Unclassified 1100
89 Ga0070664_100004419 3300005564 Bacteria 11296
90 Ga0070664_100467176 3300005564 Bacteria 1160
91 Ga0068854_100069700 3300005578 Bacteria 2568
92 Ga0068856_100001623 3300005614 Bacteria 23549
93 Ga0068856_100005019 3300005614 Bacteria 13105
94 Ga0068852_100315296 3300005616 Bacteria 1517
95 Ga0068859_100008407 3300005617 Bacteria 10459
96 Ga0068859_100027924 3300005617 Bacteria 5658
97 Ga0068859_100068369 3300005617 Bacteria 3587
98 Ga0068859_100227715 3300005617 Unclassified 1952
99 Ga0068859_100341619 3300005617 Bacteria 1591
100 Ga0068859_100708460 3300005617 Bacteria 1097
101 Ga0068864_100144436 3300005618 Unclassified 2150
102 Ga0068864_100278552 3300005618 Bacteria 1560
103 Ga0068864_100308638 3300005618 Unclassified 1483
104 Ga0068864_100580577 3300005618 Bacteria 1086
105 Ga0068866_10059673 3300005718 Bacteria 1975
106 Ga0068866_10205111 3300005718 Bacteria 1180
107 Ga0068861_100147058 3300005719 Bacteria 1929
108 Ga0068851_10040904 3300005834 Bacteria 2330
109 Ga0068863_100190118 3300005841 Bacteria 1973
110 Ga0068858_100010239 3300005842 Bacteria 8897
111 Ga0068858_100565370 3300005842 Bacteria 1101
112 Ga0068858_100657537 3300005842 Bacteria 1018
113 Ga0068860_100009938 3300005843 Bacteria 9430
114 Ga0068860_100051819 3300005843 Bacteria 3904
115 Ga0068860_100241039 3300005843 Bacteria 1759
116 Ga0068862_100019797 3300005844 Bacteria 5621
117 Ga0068862_100021858 3300005844 Bacteria 5349
118 Ga0068862_100460215 3300005844 Bacteria 1201
119 Ga0068862_100480370 3300005844 Bacteria 1176
120 Ga0081455_10011401 3300005937 Bacteria 8935
121 Ga0081540_1021008 3300005983 Unclassified 3905
122 Ga0097621_100075056 3300006237 Bacteria 2801
123 Ga0097621_100181289 3300006237 Bacteria 1820
124 Ga0075428_100294136 3300006844 Bacteria 1746
125 Ga0075428_100427146 3300006844 Unclassified 1420
126 Ga0075430_100015568 3300006846 Bacteria 6473
127 Ga0075431_100008708 3300006847 Bacteria 10166
128 Ga0075431_100147023 3300006847 Bacteria 2428
129 Ga0075431_100347246 3300006847 Bacteria 1492
130 Ga0075433_10544735 3300006852 Unclassified 1020
131 Ga0075434_100076442 3300006871 Bacteria 3343
132 Ga0075434_100239983 3300006871 Bacteria 1832
133 Ga0075429_100027370 3300006880 Unclassified 4948
134 Ga0075429_100163307 3300006880 Unclassified 1951
135 Ga0068865_100062642 3300006881 Bacteria 2611
136 Ga0075436_100000057 3300006914 Bacteria 65664
137 Ga0097620_100008407 3300006931 Bacteria 10459
138 Ga0097620_100027925 3300006931 Bacteria 5658
139 Ga0097620_100068368 3300006931 Bacteria 3587
140 Ga0097620_100227714 3300006931 Unclassified 1952
141 Ga0097620_100341647 3300006931 Bacteria 1591
142 Ga0097620_100708525 3300006931 Bacteria 1097
143 Ga0075435_100000325 3300007076 Bacteria 29372
144 Ga0075435_100525139 3300007076 Bacteria 1024
145 Ga0111539_10012661 3300009094 Bacteria 10567
146 Ga0111539_10016322 3300009094 Bacteria 9206
147 Ga0111539_10469914 3300009094 Bacteria 1464
148 Ga0105245_10008226 3300009098 Bacteria 9116
149 Ga0105247_10000039 3300009101 Bacteria 160675
150 Ga0114129_10266935 3300009147 Bacteria 2291
151 Ga0114129_10468126 3300009147 Unclassified 1651
152 Ga0105243_10000187 3300009148 Bacteria 72048
153 Ga0105243_10000628 3300009148 Bacteria 35191
154 Ga0105243_10034219 3300009148 Bacteria 3932
155 Ga0105243_10074129 3300009148 Bacteria 2760
156 Ga0105242_10000008 3300009176 Bacteria 172348
157 Ga0105242_10000204 3300009176 Bacteria 46259
158 Ga0105242_10031947 3300009176 Bacteria 4208
159 Ga0105242_10539129 3300009176 Bacteria 1117
160 Ga0105248_10030999 3300009177 Bacteria 5974
161 Ga0105248_10058904 3300009177 Bacteria 4313
162 Ga0105248_10078156 3300009177 Unclassified 3721
163 Ga0105248_10137657 3300009177 Bacteria 2754
164 Ga0105249_10000113 3300009553 Bacteria 108613
165 Ga0105249_10122355 3300009553 Bacteria 2474
166 Ga0105249_10676277 3300009553 Bacteria 1091
167 Ga0105249_10901717 3300009553 Bacteria 951
168 Ga0105246_10006141 3300011119 Bacteria 7330
169 Ga0157371_10044455 3300013102 Unclassified 3162
170 Ga0157374_10036918 3300013296 Unclassified 4479
171 Ga0157374_10101762 3300013296 Bacteria 2755
172 Ga0157374_10118751 3300013296 Bacteria 2550
173 Ga0157378_10003865 3300013297 Bacteria 13254
174 Ga0157378_10020832 3300013297 Bacteria 5766
175 Ga0157378_10058767 3300013297 Bacteria 3429
176 Ga0157378_10063683 3300013297 Unclassified 3295
177 Ga0157378_10078837 3300013297 Bacteria 2972
178 Ga0163162_10000023 3300013306 Bacteria 193395
179 Ga0163162_10008040 3300013306 Bacteria 10288
180 Ga0163162_10043856 3300013306 Bacteria 4478
181 Ga0163162_10062497 3300013306 Bacteria 3764
182 Ga0163162_10570598 3300013306 Bacteria 1259
183 Ga0163162_10594674 3300013306 Bacteria 1233
184 Ga0157372_10041908 3300013307 Bacteria 5062
185 Ga0157372_10244662 3300013307 Unclassified 2081
186 Ga0157375_10011320 3300013308 Bacteria 7878
187 Ga0157375_10115276 3300013308 Unclassified 2790
188 Ga0157375_10207741 3300013308 Bacteria 2115
189 Ga0157375_10569129 3300013308 Bacteria 1294
190 Ga0157375_10613742 3300013308 Unclassified 1246
191 Ga0163163_10002720 3300014325 Bacteria 14933
192 Ga0163163_10015624 3300014325 Bacteria 7024
193 Ga0163163_10019949 3300014325 Bacteria 6306
194 Ga0163163_10130787 3300014325 Bacteria 2550
195 Ga0163163_10220769 3300014325 Unclassified 1944
196 Ga0163163_10404628 3300014325 Archaea 1423
197 Ga0157380_10588725 3300014326 Bacteria 1098
198 Ga0157377_10185002 3300014745 Bacteria 1313
199 Ga0157379_10145463 3300014968 Unclassified 2138
200 Ga0157376_10024531 3300014969 Bacteria 4737
201 Ga0157376_10372709 3300014969 Unclassified 1373
202 Ga0163161_10029668 3300017792 Bacteria 3888
203 Ga0213872_10001146 3300021361 Bacteria 18043
204 Ga0213876_10000011 3300021384 Bacteria 414473
205 Ga0213876_10000317 3300021384 Bacteria 42312
206 Ga0207672_1000190 3300025223 Bacteria 8596
207 Ga0207697_10048797 3300025315 Bacteria 1747
208 Ga0207653_10000121 3300025885 Bacteria 55532
209 Ga0207642_10058459 3300025899 Bacteria 1779
210 Ga0207710_10000001 3300025900 Bacteria 1797433
211 Ga0207688_10281601 3300025901 Bacteria 1013
212 Ga0207680_10137317 3300025903 Bacteria 1617
213 Ga0207643_10022903 3300025908 Bacteria 3442
214 Ga0207684_10021002 3300025910 Bacteria 5576
215 Ga0207684_10350964 3300025910 Bacteria 1270
216 Ga0207707_10000062 3300025912 Bacteria 108192
217 Ga0207707_10029731 3300025912 Unclassified 4778
218 Ga0207660_10000608 3300025917 Bacteria 24160
219 Ga0207662_10014367 3300025918 Bacteria 4441
220 Ga0207662_10099436 3300025918 Bacteria 1801
221 Ga0207662_10416186 3300025918 Unclassified 914
222 Ga0207657_10143019 3300025919 Unclassified 1953
223 Ga0207652_10000175 3300025921 Bacteria 68407
224 Ga0207652_10205719 3300025921 Unclassified 1772
225 Ga0207646_10014556 3300025922 Bacteria 7464
226 Ga0207646_10019940 3300025922 Bacteria 6221
227 Ga0207646_10362281 3300025922 Bacteria 1310
228 Ga0207646_10697772 3300025922 Bacteria 908
229 Ga0207681_10274908 3300025923 Unclassified 1324
230 Ga0207650_10026373 3300025925 Unclassified 4144
231 Ga0207659_10065825 3300025926 Bacteria 2627
232 Ga0207687_10073213 3300025927 Bacteria 2453
233 Ga0207644_10003297 3300025931 Bacteria 10434
234 Ga0207644_10076577 3300025931 Bacteria 2461
235 Ga0207690_10004094 3300025932 Bacteria 8607
236 Ga0207690_10029908 3300025932 Unclassified 3468
237 Ga0207706_10274832 3300025933 Bacteria 1470
238 Ga0207686_10000023 3300025934 Bacteria 172422
239 Ga0207709_10000062 3300025935 Bacteria 194534
240 Ga0207709_10003675 3300025935 Bacteria 9030
241 Ga0207670_10055075 3300025936 Bacteria 2686
242 Ga0207670_10524585 3300025936 Bacteria 965
243 Ga0207669_10503662 3300025937 Bacteria 969
244 Ga0207691_10025625 3300025940 Bacteria 5536
245 Ga0207691_10082734 3300025940 Bacteria 2883
246 Ga0207711_10034377 3300025941 Bacteria 4293
247 Ga0207711_10101809 3300025941 Unclassified 2542
248 Ga0207711_10358151 3300025941 Bacteria 1351
249 Ga0207689_10025518 3300025942 Bacteria 4952
250 Ga0207689_10027033 3300025942 Bacteria 4803
251 Ga0207689_10052440 3300025942 Bacteria 3361
252 Ga0207689_10308885 3300025942 Unclassified 1311
253 Ga0207679_10017970 3300025945 Unclassified 4726
254 Ga0207679_10121315 3300025945 Bacteria 2082
255 Ga0207667_10318452 3300025949 Unclassified 1588
256 Ga0207651_10025453 3300025960 Bacteria 3678
257 Ga0207651_10485788 3300025960 Bacteria 1065
258 Ga0207712_10000216 3300025961 Bacteria 57333
259 Ga0207668_10149614 3300025972 Bacteria 1806
260 Ga0207640_10095209 3300025981 Bacteria 2073
261 Ga0207640_10119226 3300025981 Bacteria 1887
262 Ga0207677_10343776 3300026023 Bacteria 1247
263 Ga0207703_10008587 3300026035 Bacteria 8062
264 Ga0207639_10005709 3300026041 Bacteria 8423
265 Ga0207639_10326273 3300026041 Bacteria 1364
266 Ga0207708_10047225 3300026075 Bacteria 3279
267 Ga0207708_10367577 3300026075 Bacteria 1183
268 Ga0207702_10002362 3300026078 Bacteria 18028
269 Ga0207648_10046694 3300026089 Bacteria 3797
270 Ga0207676_10053096 3300026095 Bacteria 3171
271 Ga0207676_10196018 3300026095 Unclassified 1781
272 Ga0207676_10196449 3300026095 Bacteria 1779
273 Ga0207676_10484127 3300026095 Unclassified 1172
274 Ga0207676_10639505 3300026095 Unclassified 1025
275 Ga0207674_10000666 3300026116 Bacteria 44694
276 Ga0207675_100009053 3300026118 Bacteria 9344
277 Ga0207675_100013676 3300026118 Bacteria 7573
278 Ga0207428_10004541 3300027907 Bacteria 13160
279 Ga0207428_10006462 3300027907 Bacteria 10821
280 Ga0268266_10189746 3300028379 Bacteria 1876
281 Ga0268265_10045573 3300028380 Bacteria 3273
282 Ga0268265_10312764 3300028380 Bacteria 1419
283 Ga0268265_10381761 3300028380 Bacteria 1296
284 Ga0268265_10410353 3300028380 Bacteria 1255
285 Ga0268264_10044954 3300028381 Bacteria 3666
286 Ga0268264_10104749 3300028381 Unclassified 2466
287 Ga0265314_10001392 3300031711 Bacteria 27113
288 Ga0395899_0170705 3300037312 Bacteria 1532
289 Ga0395900_0117841 3300037418 Unclassified 2724
290 Ga0395898_0424227 3300037466 Bacteria 1267
291 Ga0395901_0136121 3300038443 Bacteria 2582
292 Ga0436365_0576586 3300039437 Bacteria 106320
293 Ga0436365_0970387 3300039437 Bacteria 322356
294 Ga0436361_0199503 3300039447 Bacteria 72236
295 Ga0451576_0363594 3300045051 Bacteria 1515
296 Ga0495620_0093544 3300046515 Bacteria 1204
297 Ga0495663_0000362 3300046525 Bacteria 16911
298 Ga0495598_0000835 3300046537 Bacteria 5909
299 Ga0495621_0000765 3300046539 Bacteria 8142
300 Ga0495621_0125177 3300046539 Bacteria 996
301 Ga0495656_0142620 3300046615 Unclassified 1150
302 Ga0495659_0072278 3300046664 Bacteria 1294
303 Ga0495677_0149567 3300047445 Unclassified 899
304 Ga0495615_0053344 3300048090 Bacteria 1047
305 Ga0496102_0748665 3300048905 Bacteria 900
306 Ga0496103_0265547 3300048906 Unclassified 1104
307 Ga0496104_0390108 3300048907 Unclassified 1305
308 Ga0496106_0008507 3300048909 Bacteria 7590
309 Ga0496113_0322559 3300048916 Unclassified 1238
310 Ga0496115_0094428 3300048918 Bacteria 2447
311 Ga0496121_0035067 3300048924 Bacteria 4502
312 nmdc:mga05p37_122596_c1 3300050507 Bacteria 3193
313 nmdc:mga09592_43145_c1 3300050508 Bacteria 3795
314 nmdc:mga06r32_250393_c1 3300050510 Unclassified 1759
315 nmdc:mga06r32_376947_c1 3300050510 Bacteria 1402
316 nmdc:mga08y16_1267_c1 3300050511 Bacteria 25093
317 nmdc:mga08y16_38787_c1 3300050511 Bacteria 5000
318 nmdc:mga0n895_50698_c1 3300050512 Bacteria 4069
319 nmdc:mga0rr50_1414_c1 3300050513 Bacteria 13153
320 nmdc:mga08x19_16_c1 3300050514 Bacteria 348119
321 nmdc:mga0a205_87628_c1 3300050515 Unclassified 3007
322 Ga0157377_10128918
323 CNAas_1000327
324 JGI24748J21848_1000027
325 JGI24034J26672_10000009
326 JGI24034J26672_10000029
327 Ga0065704_10199760
328 Ga0065712_10009234
329 Ga0065707_10262292
330 Ga0070690_100057432
331 Ga0070670_100037998
332 Ga0070670_100284045
333 Ga0068869_100016163
334 Ga0068869_100018782
335 Ga0068869_100234581
336 Ga0070666_10123132
337 Ga0070666_10321110
338 Ga0070680_100001417
339 Ga0068868_100753736
340 Ga0070689_100076677
341 Ga0070689_100314825
342 Ga0070687_100045390
343 Ga0070668_100013207
344 Ga0070669_100122069
345 Ga0070669_100177299
346 Ga0070675_100020303
347 Ga0070671_100004007
348 Ga0070671_100011407
349 Ga0070671_100074774
350 Ga0070674_100091434
351 Ga0070674_100328979
352 Ga0070674_100367774
353 Ga0070673_100007970
354 Ga0070673_100127694
355 Ga0070673_100186647
356 Ga0070673_100379887
357 Ga0070688_100171279
358 Ga0070659_100001815
359 Ga0070659_100028096
360 Ga0070703_10000356
361 Ga0070701_10026888
362 Ga0070701_10116827
363 Ga0070705_100050054
364 Ga0070705_100230108
365 Ga0070694_100001725
366 Ga0070694_100010211
367 Ga0070694_100355686
368 Ga0070708_100306740
369 Ga0070678_100069209
370 Ga0070662_100655204
371 Ga0070681_10000032
372 Ga0070681_10004095
373 Ga0070681_10833759
374 Ga0068867_100109267
375 Ga0070706_100084132
376 Ga0070707_100000357
377 Ga0070707_100007956
378 Ga0070707_100449933
379 Ga0070698_100007613
380 Ga0070698_100012346
381 Ga0070698_100061960
382 Ga0070698_100250358
383 Ga0070698_100369998
384 Ga0070699_100032323
385 Ga0070699_100245127
386 Ga0070699_100685113
387 Ga0070679_100000331
388 Ga0070679_100202240
389 Ga0070697_100000082
390 Ga0070697_100124834
391 Ga0070697_100136933
392 Ga0068853_100008332
393 Ga0068853_100017700
394 Ga0068853_100645028
395 Ga0070672_100069606
396 Ga0070672_100086415
397 Ga0070672_100163264
398 Ga0070686_100036868
399 Ga0070695_100298065
400 Ga0070696_100055124
401 Ga0070696_100149460
402 Ga0070696_100291927
403 Ga0070696_100452930
404 Ga0070693_100083786
405 Ga0070693_100513573
406 Ga0070665_100213747
407 Ga0070704_100004009
408 Ga0070704_100205314
409 Ga0068855_100682895
410 Ga0070664_100004419
411 Ga0070664_100467176
412 Ga0068854_100069700
413 Ga0068856_100001623
414 Ga0068856_100005019
415 Ga0068852_100315296
416 Ga0068859_100008407
417 Ga0068859_100027924
418 Ga0068859_100068369
419 Ga0068859_100227715
420 Ga0068859_100341619
421 Ga0068859_100708460
422 Ga0068864_100144436
423 Ga0068864_100278552
424 Ga0068864_100308638
425 Ga0068864_100580577
426 Ga0068866_10059673
427 Ga0068866_10205111
428 Ga0068861_100147058
429 Ga0068851_10040904
430 Ga0068863_100190118
431 Ga0068858_100010239
432 Ga0068858_100565370
433 Ga0068858_100657537
434 Ga0068860_100009938
435 Ga0068860_100051819
436 Ga0068860_100241039
437 Ga0068862_100019797
438 Ga0068862_100021858
439 Ga0068862_100460215
440 Ga0068862_100480370
441 Ga0081455_10011401
442 Ga0081540_1021008
443 Ga0097621_100075056
444 Ga0097621_100181289
445 Ga0075428_100294136
446 Ga0075428_100427146
447 Ga0075430_100015568
448 Ga0075431_100008708
449 Ga0075431_100147023
450 Ga0075431_100347246
451 Ga0075433_10544735
452 Ga0075434_100076442
453 Ga0075434_100239983
454 Ga0075429_100027370
455 Ga0075429_100163307
456 Ga0068865_100062642
457 Ga0075436_100000057
458 Ga0097620_100008407
459 Ga0097620_100027925
460 Ga0097620_100068368
461 Ga0097620_100227714
462 Ga0097620_100341647
463 Ga0097620_100708525
464 Ga0075435_100000325
465 Ga0075435_100525139
466 Ga0111539_10012661
467 Ga0111539_10016322
468 Ga0111539_10469914
469 Ga0105245_10008226
470 Ga0105247_10000039
471 Ga0114129_10266935
472 Ga0114129_10468126
473 Ga0105243_10000187
474 Ga0105243_10000628
475 Ga0105243_10034219
476 Ga0105243_10074129
477 Ga0105242_10000008
478 Ga0105242_10000204
479 Ga0105242_10031947
480 Ga0105242_10539129
481 Ga0105248_10030999
482 Ga0105248_10058904
483 Ga0105248_10078156
484 Ga0105248_10137657
485 Ga0105249_10000113
486 Ga0105249_10122355
487 Ga0105249_10676277
488 Ga0105249_10901717
489 Ga0105246_10006141
490 Ga0157371_10044455
491 Ga0157374_10036918
492 Ga0157374_10101762
493 Ga0157374_10118751
494 Ga0157378_10003865
495 Ga0157378_10020832
496 Ga0157378_10058767
497 Ga0157378_10063683
498 Ga0157378_10078837
499 Ga0163162_10000023
500 Ga0163162_10008040
501 Ga0163162_10043856
502 Ga0163162_10062497
503 Ga0163162_10570598
504 Ga0163162_10594674
505 Ga0157372_10041908
506 Ga0157372_10244662
507 Ga0157375_10011320
508 Ga0157375_10115276
509 Ga0157375_10207741
510 Ga0157375_10569129
511 Ga0157375_10613742
512 Ga0163163_10002720
513 Ga0163163_10015624
514 Ga0163163_10019949
515 Ga0163163_10130787
516 Ga0163163_10220769
517 Ga0163163_10404628
518 Ga0157380_10588725
519 Ga0157377_10185002
520 Ga0157379_10145463
521 Ga0157376_10024531
522 Ga0157376_10372709
523 Ga0163161_10029668
524 Ga0213872_10001146
525 Ga0213876_10000011
526 Ga0213876_10000317
527 Ga0207672_1000190
528 Ga0207697_10048797
529 Ga0207653_10000121
530 Ga0207642_10058459
531 Ga0207710_10000001
532 Ga0207688_10281601
533 Ga0207680_10137317
534 Ga0207643_10022903
535 Ga0207684_10021002
536 Ga0207684_10350964
537 Ga0207707_10000062
538 Ga0207707_10029731
539 Ga0207660_10000608
540 Ga0207662_10014367
541 Ga0207662_10099436
542 Ga0207662_10416186
543 Ga0207657_10143019
544 Ga0207652_10000175
545 Ga0207652_10205719
546 Ga0207646_10014556
547 Ga0207646_10019940
548 Ga0207646_10362281
549 Ga0207646_10697772
550 Ga0207681_10274908
551 Ga0207650_10026373
552 Ga0207659_10065825
553 Ga0207687_10073213
554 Ga0207644_10003297
555 Ga0207644_10076577
556 Ga0207690_10004094
557 Ga0207690_10029908
558 Ga0207706_10274832
559 Ga0207686_10000023
560 Ga0207709_10000062
561 Ga0207709_10003675
562 Ga0207670_10055075
563 Ga0207670_10524585
564 Ga0207669_10503662
565 Ga0207691_10025625
566 Ga0207691_10082734
567 Ga0207711_10034377
568 Ga0207711_10101809
569 Ga0207711_10358151
570 Ga0207689_10025518
571 Ga0207689_10027033
572 Ga0207689_10052440
573 Ga0207689_10308885
574 Ga0207679_10017970
575 Ga0207679_10121315
576 Ga0207667_10318452
577 Ga0207651_10025453
578 Ga0207651_10485788
579 Ga0207712_10000216
580 Ga0207668_10149614
581 Ga0207640_10095209
582 Ga0207640_10119226
583 Ga0207677_10343776
584 Ga0207703_10008587
585 Ga0207639_10005709
586 Ga0207639_10326273
587 Ga0207708_10047225
588 Ga0207708_10367577
589 Ga0207702_10002362
590 Ga0207648_10046694
591 Ga0207676_10053096
592 Ga0207676_10196018
593 Ga0207676_10196449
594 Ga0207676_10484127
595 Ga0207676_10639505
596 Ga0207674_10000666
597 Ga0207675_100009053
598 Ga0207675_100013676
599 Ga0207428_10004541
600 Ga0207428_10006462
601 Ga0268266_10189746
602 Ga0268265_10045573
603 Ga0268265_10312764
604 Ga0268265_10381761
605 Ga0268265_10410353
606 Ga0268264_10044954
607 Ga0268264_10104749
608 Ga0265314_10001392
609 Ga0395899_0170705
610 Ga0395900_0117841
611 Ga0395898_0424227
612 Ga0395901_0136121
613 Ga0436365_0576586
614 Ga0436365_0970387
615 Ga0436361_0199503
616 Ga0451576_0363594
617 Ga0495620_0093544
618 Ga0495663_0000362
619 Ga0495598_0000835
620 Ga0495621_0000765
621 Ga0495621_0125177
622 Ga0495656_0142620
623 Ga0495659_0072278
624 Ga0495677_0149567
625 Ga0495615_0053344
626 Ga0496102_0748665
627 Ga0496103_0265547
628 Ga0496104_0390108
629 Ga0496106_0008507
630 Ga0496113_0322559
631 Ga0496115_0094428
632 Ga0496121_0035067
633 nmdc:mga05p37_122596_c1
634 nmdc:mga09592_43145_c1
635 nmdc:mga06r32_250393_c1
636 nmdc:mga06r32_376947_c1
637 nmdc:mga08y16_1267_c1
638 nmdc:mga08y16_38787_c1
639 nmdc:mga0n895_50698_c1
640 nmdc:mga0rr50_1414_c1
641 nmdc:mga08x19_16_c1
642 nmdc:mga0a205_87628_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

10

207

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

16

253

0.94

PF08659

KR

KR domain

10

195

0.8

PF23441

3

255

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ijk-assembly1.cif.gz_D crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 0.9725 10 251
4jro-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9723 6 254
2uvd-assembly1.cif.gz_C the crystal structure of a 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis (ba3989) 0.9719 7 254
4rzh-assembly1.cif.gz_B crystal structure of fabg from synechocystis sp. pcc 6803 0.9714 9 254
4ijk-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 0.9709 10 251
ID Description Score Start End Superfamily
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9756 7 251 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9694 10 254 3.40.50.720
4iinB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9681 10 254 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9669 7 251 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9654 6 251 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A537CIR7-F1-model_v4 SDR family oxidoreductase 0.9814 6 199
AF-A0A7C3JT67-F1-model_v4 SDR family oxidoreductase 0.9797 5 251 GO:0006635
GO:0016616
AF-A0A2V8QIC0-F1-model_v4 Oxidoreductase 0.9793 1 199 GO:0016616
AF-A0A7C4CI43-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9791 6 183 GO:0016491
AF-A0A2V8NWW3-F1-model_v4 Oxidoreductase 0.9785 1 255 GO:0016491

Map