F405912

General Info

Members Datasets Scaffolds Average Seq Length
321 212 314 122

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10071784|Ga0075365_100717842
Length 143
Sequence MPPGPATRTSSLAVHDAVDSKVLMGNPLNVTDALTDAQYHAKTSXVLXXXEARIDAWLQDDVIDIDVQRTGGLLELTFPNRSKIVLNTQPPLHELWMAARAGGYHYKYVEGVWRDREGREFFEALSACASEQAGRSLAFEAPR

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
8 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
65 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
96 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
98 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
106 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
107 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
108 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
112 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
113 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
118 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
119 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
120 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
121 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
122 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
123 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
124 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
125 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
126 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
127 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
128 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
129 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
130 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
131 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
132 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
133 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
134 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
135 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
136 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
151 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
152 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
160 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
169 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
177 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
178 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
181 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
182 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
183 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
184 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
185 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
186 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
187 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
190 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
191 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
192 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
193 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
194 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
195 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
196 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
197 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
198 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
199 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
200 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
201 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
202 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
203 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
204 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
205 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
206 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
207 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
208 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
209 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
210 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
211 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
212 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.51
Metatranscriptomes 0
Isolates 2.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 41.43
Nodule 0.62
Rhizoplane 3.74
Rhizosphere 43.93
Stem 0
Stem Tuber 0
Unclassified 10.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000651 3300001979 Bacteria 15005
2 JGI25153J46596_10001636 3300003215 Bacteria 13291
3 rootH1_10058709 3300003316 Bacteria 1076
4 rootL2_10089280 3300003322 Bacteria 1158
5 rootH1_10128341 3300003316 Bacteria 2835
6 rootH1_10128341 3300003323 Bacteria 1626
7 Ga0055524_1000085 3300003775 Bacteria 117478
8 Ga0055530_10028907 3300003791 Bacteria 1489
9 Ga0055530_10081746 3300003791 Bacteria 677
10 Ga0055540_1000056 3300003792 Bacteria 139732
11 Ga0055531_10008479 3300003794 Bacteria 5406
12 Ga0065165_1006591 3300005262 Bacteria 6032
13 Ga0070676_10015225 3300005328 Bacteria 4241
14 Ga0070677_10038590 3300005333 Bacteria 1870
15 Ga0068868_100011934 3300005338 Bacteria 6338
16 Ga0070661_100206326 3300005344 Bacteria 1503
17 Ga0070661_100395254 3300005344 Bacteria 1092
18 Ga0070675_100013555 3300005354 Bacteria 6410
19 Ga0070673_100381420 3300005364 Bacteria 1257
20 Ga0070659_100025177 3300005366 Bacteria 4568
21 Ga0070667_100002943 3300005367 Bacteria 14641
22 Ga0070708_100103589 3300005445 Bacteria 2609
23 Ga0068867_100069874 3300005459 Bacteria 2624
24 Ga0068867_100110642 3300005459 Bacteria 2110
25 Ga0068867_101576518 3300005459 Bacteria 613
26 Ga0070685_10694494 3300005466 Bacteria 741
27 Ga0070706_100001547 3300005467 Bacteria 24043
28 Ga0070706_100230005 3300005467 Bacteria 1731
29 Ga0070707_100076326 3300005468 Bacteria 3232
30 Ga0070698_100277730 3300005471 Bacteria 1607
31 Ga0070672_100127752 3300005543 Bacteria 2087
32 Ga0070665_100549617 3300005548 Bacteria 1167
33 Ga0068857_100097912 3300005577 Bacteria 2630
34 Ga0068854_100017675 3300005578 Bacteria 4775
35 Ga0068854_100224866 3300005578 Bacteria 1487
36 Ga0068859_100393158 3300005617 Bacteria 1482
37 Ga0068866_10185063 3300005718 Bacteria 1233
38 Ga0068861_101120335 3300005719 Bacteria 757
39 Ga0068863_102299806 3300005841 Bacteria 549
40 Ga0068858_100425555 3300005842 Bacteria 1277
41 Ga0068860_100715303 3300005843 Bacteria 1012
42 Ga0075365_10071784 3300006038 Bacteria 2331
43 Ga0075368_10001276 3300006042 Bacteria 7975
44 Ga0075368_10006234 3300006042 Bacteria 4154
45 Ga0075368_10049590 3300006042 Bacteria 1666
46 Ga0075368_10143109 3300006042 Bacteria 997
47 Ga0075363_100033829 3300006048 Bacteria 2665
48 Ga0075363_100075349 3300006048 Bacteria 1838
49 Ga0075363_100111870 3300006048 Bacteria 1518
50 Ga0075363_100483800 3300006048 Bacteria 734
51 Ga0075364_10037104 3300006051 Bacteria 3153
52 Ga0075362_10010846 3300006177 Bacteria 3573
53 Ga0075362_10020851 3300006177 Bacteria 2742
54 Ga0075362_10049470 3300006177 Bacteria 1878
55 Ga0075362_10239945 3300006177 Bacteria 890
56 Ga0075367_10007989 3300006178 Bacteria 5455
57 Ga0075367_10017027 3300006178 Bacteria 3982
58 Ga0075367_10028570 3300006178 Bacteria 3183
59 Ga0075367_10029101 3300006178 Bacteria 3157
60 Ga0075367_10264081 3300006178 Bacteria 1081
61 Ga0075369_10041137 3300006186 Bacteria 1978
62 Ga0075369_10062654 3300006186 Bacteria 1625
63 Ga0075369_10100071 3300006186 Bacteria 1300
64 Ga0075366_10002023 3300006195 Bacteria 10292
65 Ga0075366_10005768 3300006195 Bacteria 6724
66 Ga0075366_10031250 3300006195 Bacteria 3133
67 Ga0075366_10047355 3300006195 Bacteria 2548
68 Ga0075366_10074266 3300006195 Bacteria 2027
69 Ga0075366_10135781 3300006195 Bacteria 1485
70 Ga0075366_10160940 3300006195 Bacteria 1360
71 Ga0075366_10844993 3300006195 Bacteria 570
72 Ga0075370_10000529 3300006353 Bacteria 14601
73 Ga0075370_10003524 3300006353 Bacteria 7467
74 Ga0075370_10007339 3300006353 Bacteria 5613
75 Ga0075370_10047646 3300006353 Bacteria 2427
76 Ga0075370_10147864 3300006353 Bacteria 1376
77 Ga0075370_10649202 3300006353 Bacteria 640
78 Ga0075370_10851308 3300006353 Bacteria 557
79 Ga0068865_100381852 3300006881 Bacteria 1149
80 Ga0068865_100420932 3300006881 Bacteria 1098
81 Ga0068865_101036228 3300006881 Bacteria 720
82 Ga0097620_100393170 3300006931 Bacteria 1482
83 Ga0079104_1000073 3300006946 Bacteria 152269
84 Ga0105240_10783022 3300009093 Bacteria 1034
85 Ga0105245_10133328 3300009098 Bacteria 2332
86 Ga0105245_10248436 3300009098 Bacteria 1727
87 Ga0105243_10113645 3300009148 Bacteria 2271
88 Ga0105243_10380726 3300009148 Bacteria 1305
89 Ga0105248_11293873 3300009177 Bacteria 825
90 Ga0105246_10631545 3300011119 Bacteria 930
91 Ga0157375_10404647 3300013308 Bacteria 1531
92 Ga0157377_10411788 3300014745 Bacteria 923
93 Ga0157379_11856459 3300014968 Bacteria 593
94 Ga0213872_10000247 3300021361 Bacteria 47840
95 Ga0209129_1008294 3300025258 Bacteria 2915
96 Ga0209565_1030348 3300025263 Bacteria 1056
97 Ga0209673_1009687 3300025273 Bacteria 4141
98 Ga0209675_1019085 3300025291 Bacteria 1898
99 Ga0209758_1000124 3300025297 Bacteria 189933
100 Ga0209050_1000691 3300025298 Bacteria 50632
101 Ga0209050_1000718 3300025298 Bacteria 48528
102 Ga0209050_1020171 3300025298 Bacteria 2492
103 Ga0209256_1000036 3300025299 Bacteria 386664
104 Ga0209051_1000068 3300025303 Bacteria 220063
105 Ga0209051_1018401 3300025303 Bacteria 3092
106 Ga0209257_1000146 3300025304 Bacteria 194261
107 Ga0209257_1074480 3300025304 Bacteria 886
108 Ga0207682_10024295 3300025893 Bacteria 2399
109 Ga0207642_10120235 3300025899 Bacteria 1353
110 Ga0207645_10075720 3300025907 Bacteria 2154
111 Ga0207684_10003302 3300025910 Bacteria 15830
112 Ga0207649_10054540 3300025920 Bacteria 2488
113 Ga0207646_11909637 3300025922 Bacteria 506
114 Ga0207659_10063184 3300025926 Bacteria 2675
115 Ga0207659_10115109 3300025926 Bacteria 2051
116 Ga0207687_10150238 3300025927 Bacteria 1776
117 Ga0207644_10328802 3300025931 Bacteria 1237
118 Ga0207709_10438675 3300025935 Bacteria 1007
119 Ga0207704_10933603 3300025938 Bacteria 731
120 Ga0207691_10031494 3300025940 Bacteria 4949
121 Ga0207711_10889109 3300025941 Bacteria 828
122 Ga0207679_10100939 3300025945 Bacteria 2256
123 Ga0207651_10274316 3300025960 Bacteria 1390
124 Ga0207640_10189337 3300025981 Bacteria 1550
125 Ga0207658_10001735 3300025986 Bacteria 16427
126 Ga0207658_11111964 3300025986 Bacteria 722
127 Ga0207677_10045520 3300026023 Bacteria 2930
128 Ga0207677_10861496 3300026023 Bacteria 815
129 Ga0207703_10356466 3300026035 Bacteria 1348
130 Ga0207641_11688646 3300026088 Bacteria 635
131 Ga0207648_10013161 3300026089 Bacteria 7711
132 Ga0207648_10372335 3300026089 Bacteria 1290
133 Ga0207648_10600734 3300026089 Bacteria 1014
134 Ga0207674_10038816 3300026116 Bacteria 4940
135 Ga0209281_1000263 3300027111 Bacteria 101190
136 Ga0209998_10102876 3300027717 Bacteria 709
137 Ga0209813_10032358 3300027866 Bacteria 1549
138 Ga0209813_10128259 3300027866 Bacteria 890
139 Ga0209974_10000422 3300027876 Bacteria 14107
140 Ga0268266_10288785 3300028379 Bacteria 1527
141 Ga0268265_12260406 3300028380 Bacteria 551
142 Ga0307517_10150402 3300028786 Bacteria 1599
143 Ga0307517_10156412 3300028786 Bacteria 1545
144 Ga0307517_10200083 3300028786 Bacteria 1250
145 Ga0307515_10000138 3300028794 Bacteria 173220
146 Ga0307515_10001206 3300028794 Bacteria 59045
147 Ga0307515_10027458 3300028794 Bacteria 9730
148 Ga0307515_10036745 3300028794 Bacteria 7909
149 Ga0307512_10150391 3300030522 Bacteria 1395
150 Ga0307513_10019744 3300031456 Bacteria 8010
151 Ga0307513_10118398 3300031456 Bacteria 2623
152 Ga0307513_10163720 3300031456 Bacteria 2112
153 Ga0307513_10833155 3300031456 Bacteria 629
154 Ga0307509_10426944 3300031507 Bacteria 1025
155 Ga0307509_10583248 3300031507 Bacteria 792
156 Ga0307508_10000216 3300031616 Bacteria 69990
157 Ga0307508_10284565 3300031616 Bacteria 1247
158 Ga0307514_10013973 3300031649 Bacteria 6652
159 Ga0307516_10018428 3300031730 Bacteria 7255
160 Ga0307405_11724070 3300031731 Unclassified 555
161 Ga0307416_101877855 3300032002 Bacteria 702
162 Ga0307507_10008058 3300033179 Bacteria 14835
163 Ga0373959_0195407 3300034820 Unclassified 532
164 Ga0373939_0041645 3300035114 Bacteria 1385
165 Ga0373924_0455059 3300035410 Unclassified 574
166 Ga0373937_1659253 3300036401 Bacteria 586
167 Ga0395905_0097354 3300037471 Bacteria 2762
168 Ga0436361_0504982 3300039447 Bacteria 102576
169 Ga0436361_0571366 3300039447 Bacteria 1290
170 Ga0451789_0278294 3300041443 Bacteria 3053
171 Ga0451791_0193244 3300041451 Bacteria 807
172 Ga0451793_0071570 3300041452 Bacteria 1872
173 Ga0451797_0472492 3300041453 Bacteria 909
174 Ga0451795_1083069 3300041456 Bacteria 601
175 Ga0451795_1295643 3300041456 Bacteria 559
176 Ga0451795_1324251 3300041456 Bacteria 925
177 Ga0451798_0000695 3300041458 Bacteria 1881
178 Ga0451800_1223580 3300041459 Bacteria 880
179 Ga0451804_0163100 3300041463 Bacteria 1650
180 Ga0451807_1897981 3300041486 Bacteria 1052
181 Ga0451833_0219174 3300041491 Bacteria 537
182 Ga0451845_0296347 3300041501 Bacteria 622
183 Ga0451847_0611866 3300041503 Bacteria 975
184 Ga0450919_007491 3300042121 Bacteria 1275
185 Ga0450920_019650 3300042122 Bacteria 1298
186 Ga0450923_040872 3300042125 Bacteria 974
187 Ga0450898_038747 3300042134 Bacteria 895
188 Ga0439446_0012753 3300042156 Bacteria 2299
189 Ga0439434_0013866 3300042435 Bacteria 2395
190 Ga0450918_000488 3300042531 Bacteria 8486
191 Ga0466965_0182218 3300044683 Bacteria 1108
192 Ga0466964_0672401 3300044706 Bacteria 575
193 Ga0453684_0004870 3300044712 Bacteria 27520
194 Ga0495590_0026550 3300046457 Bacteria 2033
195 Ga0495638_0030769 3300046460 Bacteria 3452
196 Ga0495650_0138489 3300046471 Bacteria 882
197 Ga0495606_0385130 3300046507 Bacteria 734
198 Ga0495610_0382203 3300046512 Bacteria 523
199 Ga0495628_0968174 3300046516 Bacteria 587
200 Ga0495631_0270167 3300046518 Bacteria 724
201 Ga0495632_0009823 3300046519 Bacteria 5725
202 Ga0495632_0020328 3300046519 Bacteria 3595
203 Ga0495632_0056708 3300046519 Bacteria 1914
204 Ga0495643_0047569 3300046522 Bacteria 2322
205 Ga0495643_0428486 3300046522 Unclassified 579
206 Ga0495648_0343760 3300046524 Bacteria 684
207 Ga0495642_0049670 3300046528 Bacteria 1724
208 Ga0495609_0277988 3300046538 Bacteria 685
209 Ga0495611_0079228 3300046648 Bacteria 1509
210 Ga0495625_0011613 3300046660 Bacteria 7163
211 Ga0495625_0012016 3300046660 Bacteria 7027
212 Ga0495658_0204495 3300046683 Bacteria 1232
213 Ga0495670_0781140 3300046691 Bacteria 521
214 Ga0495649_0000401 3300046694 Bacteria 37516
215 Ga0495660_0015242 3300046810 Bacteria 4442
216 Ga0495676_0909181 3300047321 Bacteria 564
217 Ga0495683_0268328 3300047323 Bacteria 743
218 Ga0495687_019392 3300047443 Bacteria 3339
219 Ga0495687_019393 3300047443 Bacteria 3339
220 Ga0495686_0470229 3300047472 Bacteria 665
221 Ga0495686_0596797 3300047472 Bacteria 572
222 Ga0495626_0191779 3300048091 Bacteria 842
223 Ga0496102_0002356 3300048905 Bacteria 16116
224 Ga0496121_0169497 3300048924 Bacteria 1587
225 Ga0496122_0290884 3300048925 Bacteria 887
226 Ga0496124_0000108 3300048927 Bacteria 167473
227 Ga0496125_0015641 3300048928 Bacteria 7322
228 Ga0495678_071369 3300049459 Bacteria 1272
229 Ga0501294_008890 3300049517 Bacteria 982
230 Ga0501032_0203576 3300049569 Bacteria 1292
231 Ga0501042_0110842 3300049578 Bacteria 1976
232 Ga0501043_0000002 3300049579 Bacteria 351081
233 Ga0501046_0000008 3300049580 Bacteria 351167
234 Ga0501047_0000003 3300049581 Bacteria 508375
235 Ga0501048_0001116 3300049582 Bacteria 20152
236 Ga0501252_001152 3300049682 Bacteria 2358
237 Ga0501253_050062 3300049683 Bacteria 872
238 Ga0501219_009075 3300049703 Bacteria 733
239 Ga0501045_0033364 3300049824 Bacteria 3732
240 Ga0501226_027828 3300049853 Bacteria 637
241 nmdc:mga03683_267348_c1 3300050489 Bacteria 797
242 nmdc:mga03683_397397_c1 3300050489 Bacteria 658
243 nmdc:mga03683_50838_c1 3300050489 Bacteria 1728
244 nmdc:mga03683_515351_c1 3300050489 Unclassified 580
245 nmdc:mga03683_562986_c1 3300050489 Bacteria 556
246 nmdc:mga03683_8228_c1 3300050489 Bacteria 3657
247 nmdc:mga03n38_227170_c1 3300050490 Bacteria 977
248 nmdc:mga03n38_341130_c1 3300050490 Bacteria 813
249 nmdc:mga03n38_400811_c1 3300050490 Bacteria 755
250 nmdc:mga03n38_48485_c1 3300050490 Bacteria 1884
251 nmdc:mga00v17_122990_c1 3300050491 Bacteria 1654
252 nmdc:mga0yw44_174826_c1 3300050492 Bacteria 1411
253 nmdc:mga0k408_116510_c1 3300050493 Bacteria 1581
254 nmdc:mga0k408_1189_c1 3300050493 Bacteria 13937
255 nmdc:mga0k408_16824_c1 3300050493 Bacteria 4066
256 nmdc:mga0k408_179492_c1 3300050493 Bacteria 1263
257 nmdc:mga0k408_19948_c1 3300050493 Bacteria 3752
258 nmdc:mga0k408_226836_c1 3300050493 Bacteria 1115
259 nmdc:mga0k408_3311_c1 3300050493 Bacteria 8524
260 nmdc:mga0k408_33310_c1 3300050493 Bacteria 2947
261 nmdc:mga0k408_360_c1 3300050493 Bacteria 25004
262 nmdc:mga0k408_431373_c1 3300050493 Bacteria 783
263 nmdc:mga0k408_441807_c1 3300050493 Unclassified 773
264 nmdc:mga0k408_631246_c1 3300050493 Bacteria 631
265 nmdc:mga0k408_737997_c1 3300050493 Bacteria 576
266 nmdc:mga0k408_9723_c1 3300050493 Bacteria 5192
267 nmdc:mga06z11_159049_c1 3300050494 Bacteria 1290
268 nmdc:mga06z11_262468_c1 3300050494 Bacteria 1019
269 nmdc:mga06z11_398768_c1 3300050494 Bacteria 828
270 nmdc:mga06z11_415817_c1 3300050494 Bacteria 810
271 nmdc:mga06z11_7862_c1 3300050494 Bacteria 4413
272 nmdc:mga04h51_13345_c1 3300050495 Bacteria 2324
273 nmdc:mga04h51_150121_c1 3300050495 Bacteria 890
274 nmdc:mga07m45_1002_c1 3300050496 Bacteria 12472
275 nmdc:mga07m45_199264_c1 3300050496 Bacteria 1165
276 nmdc:mga07m45_29370_c1 3300050496 Bacteria 3040
277 nmdc:mga07m45_546014_c1 3300050496 Bacteria 670
278 nmdc:mga07m45_5495_c1 3300050496 Bacteria 6313
279 nmdc:mga07m45_55760_c1 3300050496 Bacteria 2234
280 nmdc:mga07m45_62487_c1 3300050496 Bacteria 2111
281 nmdc:mga07m45_69065_c1 3300050496 Bacteria 2009
282 nmdc:mga07m45_701988_c1 3300050496 Bacteria 582
283 nmdc:mga07m45_864395_c1 3300050496 Bacteria 518
284 nmdc:mga0sz30_188886_c1 3300050516 Bacteria 915
285 nmdc:mga0sz30_381912_c1 3300050516 Bacteria 631
286 Ga0500578_0001754 3300053086 Bacteria 20477
287 Ga0500578_0170480 3300053086 Bacteria 1346
288 Ga0500578_0261551 3300053086 Bacteria 1039
289 Ga0500644_0056744 3300053088 Bacteria 1364
290 Ga0500646_0007985 3300053090 Bacteria 2704
291 Ga0500583_0271180 3300053092 Bacteria 835
292 Ga0500583_0278601 3300053092 Bacteria 822
293 Ga0500583_0404072 3300053092 Bacteria 655
294 Ga0500641_0331366 3300053096 Bacteria 617
295 Ga0500650_0092196 3300053098 Bacteria 1418
296 Ga0500650_0486725 3300053098 Bacteria 526
297 Ga0500562_070317 3300053108 Bacteria 944
298 Ga0500623_182260 3300053127 Bacteria 807
299 Ga0500628_166677 3300053129 Bacteria 623
300 Ga0500642_0037802 3300053130 Bacteria 2065
301 Ga0500652_003921 3300053131 Bacteria 4549
302 Ga0500655_018952 3300053133 Bacteria 1279
303 Ga0500658_0028559 3300053134 Bacteria 2165
304 Ga0500568_0003783 3300053139 Bacteria 8282
305 Ga0500577_0016091 3300053142 Bacteria 2351
306 Ga0500579_139830 3300053143 Bacteria 1098
307 Ga0500604_0156066 3300053151 Bacteria 776
308 Ga0500619_000006 3300053154 Bacteria 77270
309 Ga0500622_0000125 3300053156 Bacteria 81109
310 Ga0500622_0007470 3300053156 Bacteria 6206
311 Ga0500627_0421802 3300053158 Bacteria 565
312 Ga0500570_082175 3300053724 Bacteria 1445
313 Ga0500584_115855 3300053726 Bacteria 1073
314 Ga0500587_000033 3300053739 Bacteria 13415

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005459 Ga0068867_101576518 Ga0068867_1015765181 111
2 3300031456 Ga0307513_10118398 Ga0307513_101183983 111
3 3300042156 Ga0439446_0012753 Ga0439446_0012753_1272_1616 114
4 3300006048 Ga0075363_100111870 Ga0075363_1001118701 115
5 3300006177 Ga0075362_10020851 Ga0075362_100208512 115
6 3300006195 Ga0075366_10135781 Ga0075366_101357812 115
7 3300028786 Ga0307517_10150402 Ga0307517_101504022 115
8 3300028786 Ga0307517_10200083 Ga0307517_102000832 115
9 3300028794 Ga0307515_10027458 Ga0307515_100274586 115
10 3300046457 Ga0495590_0026550 Ga0495590_0026550_966_1316 115
11 3300046518 Ga0495631_0270167 Ga0495631_0270167_298_648 115
12 3300046519 Ga0495632_0056708 Ga0495632_0056708_621_971 115
13 3300046524 Ga0495648_0343760 Ga0495648_0343760_224_574 115
14 3300046528 Ga0495642_0049670 Ga0495642_0049670_981_1331 115
15 3300046538 Ga0495609_0277988 Ga0495609_0277988_67_417 115
16 3300046648 Ga0495611_0079228 Ga0495611_0079228_278_628 115
17 3300046660 Ga0495625_0012016 Ga0495625_0012016_3401_3751 115
18 3300046694 Ga0495649_0000401 Ga0495649_0000401_36305_36655 115
19 3300046810 Ga0495660_0015242 Ga0495660_0015242_258_608 115
20 3300047323 Ga0495683_0268328 Ga0495683_0268328_147_497 115
21 3300047443 Ga0495687_019392 Ga0495687_019392_1294_1644 115
22 3300047443 Ga0495687_019393 Ga0495687_019393_1696_2046 115
23 3300048091 Ga0495626_0191779 Ga0495626_0191779_417_767 115
24 3300049459 Ga0495678_071369 Ga0495678_071369_908_1258 115
25 3300050489 nmdc:mga03683_8228_c1 nmdc:mga03683_8228_c1_828_1178 115
26 3300050490 nmdc:mga03n38_400811_c1 nmdc:mga03n38_400811_c1_105_455 115
27 3300050493 nmdc:mga0k408_1189_c1 nmdc:mga0k408_1189_c1_66_416 115
28 3300053086 Ga0500578_0170480 Ga0500578_0170480_374_724 115
29 3300053098 Ga0500650_0486725 Ga0500650_0486725_158_508 115
30 3300053134 Ga0500658_0028559 Ga0500658_0028559_194_544 115
31 3300005466 Ga0070685_10694494 Ga0070685_106944942 116
32 3300005617 Ga0068859_100393158 Ga0068859_1003931582 116
33 3300006931 Ga0097620_100393170 Ga0097620_1003931702 116
34 3300026023 Ga0207677_10861496 Ga0207677_108614962 116
35 3300026089 Ga0207648_10600734 Ga0207648_106007342 116
36 3300037471 Ga0395905_0097354 Ga0395905_0097354_1337_1690 116
37 3300039447 Ga0436361_0571366 Ga0436361_0571366_160_510 116
38 iso_pu_bacteria 2585428062 2587759525 116
39 iso_pu_bacteria 2588253510 2588290135 116
40 iso_pu_bacteria 2643221592 2643972853 116
41 iso_pu_bacteria 2643221625 2644143300 116
42 iso_pu_bacteria 2643221648 2644276263 116
43 iso_pu_bacteria 2643221654 2644301220 116
44 3300005445 Ga0070708_100103589 Ga0070708_1001035892 117
45 3300005467 Ga0070706_100001547 Ga0070706_10000154718 117
46 3300005468 Ga0070707_100076326 Ga0070707_1000763262 117
47 3300005471 Ga0070698_100277730 Ga0070698_1002777302 117
48 3300006178 Ga0075367_10007989 Ga0075367_100079892 117
49 3300006186 Ga0075369_10100071 Ga0075369_101000712 117
50 3300006195 Ga0075366_10031250 Ga0075366_100312502 117
51 3300025910 Ga0207684_10003302 Ga0207684_100033028 117
52 3300050494 nmdc:mga06z11_7862_c1 nmdc:mga06z11_7862_c1_776_1135 117
53 iso_pu_bacteria 2585428058 2587731379 117
54 3300025922 Ga0207646_11909637 Ga0207646_119096371 118
55 3300025986 Ga0207658_11111964 Ga0207658_111119642 118
56 3300044683 Ga0466965_0182218 Ga0466965_0182218_593_949 118
57 3300044706 Ga0466964_0672401 Ga0466964_0672401_39_395 118
58 3300048924 Ga0496121_0169497 Ga0496121_0169497_899_1255 118
59 3300048927 Ga0496124_0000108 Ga0496124_0000108_92374_92730 118
60 3300048928 Ga0496125_0015641 Ga0496125_0015641_2440_2796 118
61 3300003775 Ga0055524_1000085 Ga0055524_100008511 119
62 3300003791 Ga0055530_10081746 Ga0055530_100817461 119
63 3300005328 Ga0070676_10015225 Ga0070676_100152255 119
64 3300005333 Ga0070677_10038590 Ga0070677_100385901 119
65 3300005338 Ga0068868_100011934 Ga0068868_1000119342 119
66 3300005344 Ga0070661_100206326 Ga0070661_1002063261 119
67 3300005344 Ga0070661_100395254 Ga0070661_1003952543 119
68 3300005354 Ga0070675_100013555 Ga0070675_1000135554 119
69 3300005364 Ga0070673_100381420 Ga0070673_1003814202 119
70 3300005366 Ga0070659_100025177 Ga0070659_1000251773 119
71 3300005459 Ga0068867_100069874 Ga0068867_1000698742 119
72 3300005459 Ga0068867_100110642 Ga0068867_1001106422 119
73 3300005467 Ga0070706_100230005 Ga0070706_1002300053 119
74 3300005543 Ga0070672_100127752 Ga0070672_1001277522 119
75 3300005577 Ga0068857_100097912 Ga0068857_1000979122 119
76 3300005578 Ga0068854_100017675 Ga0068854_1000176754 119
77 3300005578 Ga0068854_100224866 Ga0068854_1002248662 119
78 3300005718 Ga0068866_10185063 Ga0068866_101850632 119
79 3300005719 Ga0068861_101120335 Ga0068861_1011203352 119
80 3300005841 Ga0068863_102299806 Ga0068863_1022998061 119
81 3300005842 Ga0068858_100425555 Ga0068858_1004255552 119
82 3300005843 Ga0068860_100715303 Ga0068860_1007153032 119
83 3300006038 Ga0075365_10071784 Ga0075365_100717842 119
84 3300006042 Ga0075368_10001276 Ga0075368_100012763 119
85 3300006042 Ga0075368_10049590 Ga0075368_100495902 119
86 3300006042 Ga0075368_10143109 Ga0075368_101431092 119
87 3300006048 Ga0075363_100033829 Ga0075363_1000338292 119
88 3300006051 Ga0075364_10037104 Ga0075364_100371042 119
89 3300006177 Ga0075362_10010846 Ga0075362_100108462 119
90 3300006177 Ga0075362_10239945 Ga0075362_102399451 119
91 3300006178 Ga0075367_10028570 Ga0075367_100285703 119
92 3300006178 Ga0075367_10029101 Ga0075367_100291012 119
93 3300006178 Ga0075367_10264081 Ga0075367_102640812 119
94 3300006186 Ga0075369_10062654 Ga0075369_100626542 119
95 3300006195 Ga0075366_10002023 Ga0075366_100020238 119
96 3300006195 Ga0075366_10005768 Ga0075366_100057687 119
97 3300006195 Ga0075366_10047355 Ga0075366_100473553 119
98 3300006195 Ga0075366_10844993 Ga0075366_108449932 119
99 3300006353 Ga0075370_10003524 Ga0075370_100035242 119
100 3300006353 Ga0075370_10007339 Ga0075370_100073395 119
101 3300006353 Ga0075370_10147864 Ga0075370_101478643 119
102 3300006353 Ga0075370_10649202 Ga0075370_106492022 119
103 3300006353 Ga0075370_10851308 Ga0075370_108513081 119
104 3300006881 Ga0068865_100381852 Ga0068865_1003818521 119
105 3300006881 Ga0068865_101036228 Ga0068865_1010362282 119
106 3300006946 Ga0079104_1000073 Ga0079104_100007388 119
107 3300009093 Ga0105240_10783022 Ga0105240_107830222 119
108 3300009098 Ga0105245_10133328 Ga0105245_101333282 119
109 3300009148 Ga0105243_10113645 Ga0105243_101136452 119
110 3300009148 Ga0105243_10380726 Ga0105243_103807262 119
111 3300011119 Ga0105246_10631545 Ga0105246_106315453 119
112 3300014745 Ga0157377_10411788 Ga0157377_104117881 119
113 3300014968 Ga0157379_11856459 Ga0157379_118564591 119
114 3300021361 Ga0213872_10000247 Ga0213872_100002479 119
115 3300025263 Ga0209565_1030348 Ga0209565_10303482 119
116 3300025291 Ga0209675_1019085 Ga0209675_10190853 119
117 3300025298 Ga0209050_1020171 Ga0209050_10201713 119
118 3300025299 Ga0209256_1000036 Ga0209256_1000036121 119
119 3300025893 Ga0207682_10024295 Ga0207682_100242952 119
120 3300025899 Ga0207642_10120235 Ga0207642_101202352 119
121 3300025907 Ga0207645_10075720 Ga0207645_100757203 119
122 3300025920 Ga0207649_10054540 Ga0207649_100545401 119
123 3300025926 Ga0207659_10063184 Ga0207659_100631842 119
124 3300025926 Ga0207659_10115109 Ga0207659_101151092 119
125 3300025931 Ga0207644_10328802 Ga0207644_103288021 119
126 3300025935 Ga0207709_10438675 Ga0207709_104386752 119
127 3300025938 Ga0207704_10933603 Ga0207704_109336032 119
128 3300025940 Ga0207691_10031494 Ga0207691_100314946 119
129 3300025945 Ga0207679_10100939 Ga0207679_101009392 119
130 3300025960 Ga0207651_10274316 Ga0207651_102743162 119
131 3300025981 Ga0207640_10189337 Ga0207640_101893372 119
132 3300026023 Ga0207677_10045520 Ga0207677_100455202 119
133 3300026035 Ga0207703_10356466 Ga0207703_103564662 119
134 3300026088 Ga0207641_11688646 Ga0207641_116886461 119
135 3300026089 Ga0207648_10013161 Ga0207648_100131614 119
136 3300026089 Ga0207648_10372335 Ga0207648_103723351 119
137 3300026116 Ga0207674_10038816 Ga0207674_100388162 119
138 3300027111 Ga0209281_1000263 Ga0209281_100026388 119
139 3300027866 Ga0209813_10032358 Ga0209813_100323582 119
140 3300027866 Ga0209813_10128259 Ga0209813_101282592 119
141 3300028380 Ga0268265_12260406 Ga0268265_122604062 119
142 3300031616 Ga0307508_10284565 Ga0307508_102845652 119
143 3300031730 Ga0307516_10018428 Ga0307516_100184285 119
144 3300034820 Ga0373959_0195407 Ga0373959_0195407_73_432 119
145 3300035114 Ga0373939_0041645 Ga0373939_0041645_420_779 119
146 3300035410 Ga0373924_0455059 Ga0373924_0455059_100_462 119
147 3300036401 Ga0373937_1659253 Ga0373937_1659253_125_487 119
148 3300039447 Ga0436361_0504982 Ga0436361_0504982_7240_7599 119
149 3300042121 Ga0450919_007491 Ga0450919_007491_537_896 119
150 3300042122 Ga0450920_019650 Ga0450920_019650_557_916 119
151 3300042125 Ga0450923_040872 Ga0450923_040872_561_920 119
152 3300042134 Ga0450898_038747 Ga0450898_038747_73_432 119
153 3300042435 Ga0439434_0013866 Ga0439434_0013866_245_604 119
154 3300042531 Ga0450918_000488 Ga0450918_000488_1299_1658 119
155 3300046516 Ga0495628_0968174 Ga0495628_0968174_156_518 119
156 3300046683 Ga0495658_0204495 Ga0495658_0204495_108_470 119
157 3300046691 Ga0495670_0781140 Ga0495670_0781140_22_420 119
158 3300047321 Ga0495676_0909181 Ga0495676_0909181_131_493 119
159 3300048905 Ga0496102_0002356 Ga0496102_0002356_9285_9644 119
160 3300049569 Ga0501032_0203576 Ga0501032_0203576_44_403 119
161 3300049578 Ga0501042_0110842 Ga0501042_0110842_871_1230 119
162 3300049579 Ga0501043_0000002 Ga0501043_0000002_261721_262080 119
163 3300049580 Ga0501046_0000008 Ga0501046_0000008_261804_262163 119
164 3300049581 Ga0501047_0000003 Ga0501047_0000003_284986_285345 119
165 3300049582 Ga0501048_0001116 Ga0501048_0001116_4872_5231 119
166 3300049682 Ga0501252_001152 Ga0501252_001152_1885_2244 119
167 3300049824 Ga0501045_0033364 Ga0501045_0033364_1608_1967 119
168 3300049853 Ga0501226_027828 Ga0501226_027828_81_440 119
169 3300050489 nmdc:mga03683_267348_c1 nmdc:mga03683_267348_c1_291_689 119
170 3300050489 nmdc:mga03683_562986_c1 nmdc:mga03683_562986_c1_19_417 119
171 3300050490 nmdc:mga03n38_341130_c1 nmdc:mga03n38_341130_c1_220_618 119
172 3300050491 nmdc:mga00v17_122990_c1 nmdc:mga00v17_122990_c1_842_1240 119
173 3300050492 nmdc:mga0yw44_174826_c1 nmdc:mga0yw44_174826_c1_799_1197 119
174 3300050493 nmdc:mga0k408_16824_c1 nmdc:mga0k408_16824_c1_2436_2834 119
175 3300050493 nmdc:mga0k408_226836_c1 nmdc:mga0k408_226836_c1_609_968 119
176 3300050493 nmdc:mga0k408_3311_c1 nmdc:mga0k408_3311_c1_506_919 119
177 3300050493 nmdc:mga0k408_360_c1 nmdc:mga0k408_360_c1_21901_22299 119
178 3300050493 nmdc:mga0k408_431373_c1 nmdc:mga0k408_431373_c1_387_749 119
179 3300050494 nmdc:mga06z11_398768_c1 nmdc:mga06z11_398768_c1_280_693 119
180 3300050495 nmdc:mga04h51_13345_c1 nmdc:mga04h51_13345_c1_1085_1483 119
181 3300050495 nmdc:mga04h51_150121_c1 nmdc:mga04h51_150121_c1_331_744 119
182 3300050496 nmdc:mga07m45_1002_c1 nmdc:mga07m45_1002_c1_2582_2980 119
183 3300050496 nmdc:mga07m45_546014_c1 nmdc:mga07m45_546014_c1_103_501 119
184 3300050496 nmdc:mga07m45_5495_c1 nmdc:mga07m45_5495_c1_4172_4585 119
185 3300050496 nmdc:mga07m45_69065_c1 nmdc:mga07m45_69065_c1_897_1295 119
186 3300050496 nmdc:mga07m45_864395_c1 nmdc:mga07m45_864395_c1_91_453 119
187 3300050516 nmdc:mga0sz30_188886_c1 nmdc:mga0sz30_188886_c1_19_417 119
188 3300053092 Ga0500583_0278601 Ga0500583_0278601_130_528 119
189 3300053139 Ga0500568_0003783 Ga0500568_0003783_1507_1905 119
190 3300003215 JGI25153J46596_10001636 JGI25153J46596_1000163611 120
191 3300003323 rootH1_10128341 rootH1_101283412 120
192 3300003791 Ga0055530_10028907 Ga0055530_100289072 120
193 3300003792 Ga0055540_1000056 Ga0055540_1000056116 120
194 3300003794 Ga0055531_10008479 Ga0055531_100084795 120
195 3300005262 Ga0065165_1006591 Ga0065165_10065911 120
196 3300005367 Ga0070667_100002943 Ga0070667_10000294313 120
197 3300005548 Ga0070665_100549617 Ga0070665_1005496172 120
198 3300006042 Ga0075368_10006234 Ga0075368_100062345 120
199 3300006048 Ga0075363_100075349 Ga0075363_1000753492 120
200 3300006048 Ga0075363_100483800 Ga0075363_1004838001 120
201 3300006177 Ga0075362_10049470 Ga0075362_100494703 120
202 3300006178 Ga0075367_10017027 Ga0075367_100170273 120
203 3300006195 Ga0075366_10074266 Ga0075366_100742662 120
204 3300006195 Ga0075366_10160940 Ga0075366_101609402 120
205 3300006353 Ga0075370_10000529 Ga0075370_1000052913 120
206 3300006353 Ga0075370_10047646 Ga0075370_100476462 120
207 3300006881 Ga0068865_100420932 Ga0068865_1004209322 120
208 3300009098 Ga0105245_10248436 Ga0105245_102484362 120
209 3300009177 Ga0105248_11293873 Ga0105248_112938733 120
210 3300013308 Ga0157375_10404647 Ga0157375_104046472 120
211 3300025258 Ga0209129_1008294 Ga0209129_10082943 120
212 3300025273 Ga0209673_1009687 Ga0209673_10096873 120
213 3300025297 Ga0209758_1000124 Ga0209758_100012427 120
214 3300025298 Ga0209050_1000691 Ga0209050_100069135 120
215 3300025298 Ga0209050_1000718 Ga0209050_100071826 120
216 3300025303 Ga0209051_1000068 Ga0209051_100006889 120
217 3300025303 Ga0209051_1018401 Ga0209051_10184012 120
218 3300025304 Ga0209257_1000146 Ga0209257_100014663 120
219 3300025304 Ga0209257_1074480 Ga0209257_10744802 120
220 3300025927 Ga0207687_10150238 Ga0207687_101502382 120
221 3300025941 Ga0207711_10889109 Ga0207711_108891092 120
222 3300025986 Ga0207658_10001735 Ga0207658_1000173510 120
223 3300027717 Ga0209998_10102876 Ga0209998_101028762 120
224 3300027876 Ga0209974_10000422 Ga0209974_100004227 120
225 3300028379 Ga0268266_10288785 Ga0268266_102887852 120
226 3300028786 Ga0307517_10156412 Ga0307517_101564122 120
227 3300028794 Ga0307515_10000138 Ga0307515_1000013823 120
228 3300028794 Ga0307515_10001206 Ga0307515_1000120645 120
229 3300028794 Ga0307515_10036745 Ga0307515_100367457 120
230 3300030522 Ga0307512_10150391 Ga0307512_101503911 120
231 3300031456 Ga0307513_10019744 Ga0307513_100197447 120
232 3300031456 Ga0307513_10163720 Ga0307513_101637201 120
233 3300031456 Ga0307513_10833155 Ga0307513_108331552 120
234 3300031507 Ga0307509_10426944 Ga0307509_104269441 120
235 3300031616 Ga0307508_10000216 Ga0307508_1000021634 120
236 3300031649 Ga0307514_10013973 Ga0307514_100139734 120
237 3300031731 Ga0307405_11724070 Ga0307405_117240702 120
238 3300032002 Ga0307416_101877855 Ga0307416_1018778551 120
239 3300033179 Ga0307507_10008058 Ga0307507_100080587 120
240 3300041443 Ga0451789_0278294 Ga0451789_0278294_781_1143 120
241 3300041451 Ga0451791_0193244 Ga0451791_0193244_25_387 120
242 3300041452 Ga0451793_0071570 Ga0451793_0071570_474_836 120
243 3300041453 Ga0451797_0472492 Ga0451797_0472492_373_735 120
244 3300041456 Ga0451795_1083069 Ga0451795_1083069_79_441 120
245 3300041456 Ga0451795_1295643 Ga0451795_1295643_10_372 120
246 3300041456 Ga0451795_1324251 Ga0451795_1324251_417_779 120
247 3300041458 Ga0451798_0000695 Ga0451798_0000695_428_790 120
248 3300041459 Ga0451800_1223580 Ga0451800_1223580_82_444 120
249 3300041463 Ga0451804_0163100 Ga0451804_0163100_886_1248 120
250 3300041486 Ga0451807_1897981 Ga0451807_1897981_122_484 120
251 3300041491 Ga0451833_0219174 Ga0451833_0219174_17_379 120
252 3300041501 Ga0451845_0296347 Ga0451845_0296347_24_386 120
253 3300041503 Ga0451847_0611866 Ga0451847_0611866_362_724 120
254 3300044712 Ga0453684_0004870 Ga0453684_0004870_24563_24925 120
255 3300046460 Ga0495638_0030769 Ga0495638_0030769_647_1009 120
256 3300046507 Ga0495606_0385130 Ga0495606_0385130_246_608 120
257 3300046512 Ga0495610_0382203 Ga0495610_0382203_104_466 120
258 3300046519 Ga0495632_0009823 Ga0495632_0009823_777_1139 120
259 3300046519 Ga0495632_0020328 Ga0495632_0020328_1782_2144 120
260 3300046522 Ga0495643_0047569 Ga0495643_0047569_752_1171 120
261 3300046522 Ga0495643_0428486 Ga0495643_0428486_95_457 120
262 3300046660 Ga0495625_0011613 Ga0495625_0011613_1826_2245 120
263 3300047472 Ga0495686_0470229 Ga0495686_0470229_186_548 120
264 3300047472 Ga0495686_0596797 Ga0495686_0596797_44_406 120
265 3300048925 Ga0496122_0290884 Ga0496122_0290884_185_547 120
266 3300049517 Ga0501294_008890 Ga0501294_008890_575_937 120
267 3300049683 Ga0501253_050062 Ga0501253_050062_277_639 120
268 3300049703 Ga0501219_009075 Ga0501219_009075_356_718 120
269 3300050489 nmdc:mga03683_397397_c1 nmdc:mga03683_397397_c1_177_596 120
270 3300050489 nmdc:mga03683_50838_c1 nmdc:mga03683_50838_c1_882_1244 120
271 3300050489 nmdc:mga03683_515351_c1 nmdc:mga03683_515351_c1_27_446 120
272 3300050490 nmdc:mga03n38_227170_c1 nmdc:mga03n38_227170_c1_219_638 120
273 3300050490 nmdc:mga03n38_48485_c1 nmdc:mga03n38_48485_c1_395_757 120
274 3300050493 nmdc:mga0k408_116510_c1 nmdc:mga0k408_116510_c1_506_925 120
275 3300050493 nmdc:mga0k408_179492_c1 nmdc:mga0k408_179492_c1_100_519 120
276 3300050493 nmdc:mga0k408_19948_c1 nmdc:mga0k408_19948_c1_1813_2232 120
277 3300050493 nmdc:mga0k408_33310_c1 nmdc:mga0k408_33310_c1_1608_1970 120
278 3300050493 nmdc:mga0k408_441807_c1 nmdc:mga0k408_441807_c1_60_479 120
279 3300050493 nmdc:mga0k408_631246_c1 nmdc:mga0k408_631246_c1_60_479 120
280 3300050493 nmdc:mga0k408_737997_c1 nmdc:mga0k408_737997_c1_98_517 120
281 3300050493 nmdc:mga0k408_9723_c1 nmdc:mga0k408_9723_c1_2493_2912 120
282 3300050494 nmdc:mga06z11_159049_c1 nmdc:mga06z11_159049_c1_283_645 120
283 3300050494 nmdc:mga06z11_262468_c1 nmdc:mga06z11_262468_c1_446_865 120
284 3300050494 nmdc:mga06z11_415817_c1 nmdc:mga06z11_415817_c1_292_711 120
285 3300050496 nmdc:mga07m45_199264_c1 nmdc:mga07m45_199264_c1_584_1003 120
286 3300050496 nmdc:mga07m45_29370_c1 nmdc:mga07m45_29370_c1_845_1264 120
287 3300050496 nmdc:mga07m45_55760_c1 nmdc:mga07m45_55760_c1_96_515 120
288 3300050496 nmdc:mga07m45_62487_c1 nmdc:mga07m45_62487_c1_869_1288 120
289 3300050496 nmdc:mga07m45_701988_c1 nmdc:mga07m45_701988_c1_38_457 120
290 3300053086 Ga0500578_0001754 Ga0500578_0001754_1699_2061 120
291 3300053086 Ga0500578_0261551 Ga0500578_0261551_249_611 120
292 3300053088 Ga0500644_0056744 Ga0500644_0056744_722_1084 120
293 3300053090 Ga0500646_0007985 Ga0500646_0007985_511_873 120
294 3300053092 Ga0500583_0271180 Ga0500583_0271180_322_684 120
295 3300053092 Ga0500583_0404072 Ga0500583_0404072_139_501 120
296 3300053096 Ga0500641_0331366 Ga0500641_0331366_214_576 120
297 3300053098 Ga0500650_0092196 Ga0500650_0092196_235_597 120
298 3300053108 Ga0500562_070317 Ga0500562_070317_452_814 120
299 3300053127 Ga0500623_182260 Ga0500623_182260_30_392 120
300 3300053129 Ga0500628_166677 Ga0500628_166677_63_425 120
301 3300053130 Ga0500642_0037802 Ga0500642_0037802_136_498 120
302 3300053131 Ga0500652_003921 Ga0500652_003921_3492_3854 120
303 3300053133 Ga0500655_018952 Ga0500655_018952_202_564 120
304 3300053142 Ga0500577_0016091 Ga0500577_0016091_1708_2070 120
305 3300053143 Ga0500579_139830 Ga0500579_139830_32_394 120
306 3300053151 Ga0500604_0156066 Ga0500604_0156066_30_392 120
307 3300053156 Ga0500622_0000125 Ga0500622_0000125_75008_75370 120
308 3300053156 Ga0500622_0007470 Ga0500622_0007470_5760_6122 120
309 3300053158 Ga0500627_0421802 Ga0500627_0421802_11_373 120
310 3300053724 Ga0500570_082175 Ga0500570_082175_886_1248 120
311 3300053726 Ga0500584_115855 Ga0500584_115855_635_997 120
312 3300053739 Ga0500587_000033 Ga0500587_000033_12654_13016 120
313 iso_pu_bacteria 2585428057 2587725265 120
314 3300001979 JGI24740J21852_10000651 JGI24740J21852_100006514 121
315 3300003316 rootH1_10058709 rootH1_100587092 121
316 3300003322 rootL2_10089280 rootL2_100892802 121
317 3300006186 Ga0075369_10041137 Ga0075369_100411372 121
318 3300031507 Ga0307509_10583248 Ga0307509_105832482 121
319 3300046471 Ga0495650_0138489 Ga0495650_0138489_278_646 121
320 3300050516 nmdc:mga0sz30_381912_c1 nmdc:mga0sz30_381912_c1_225_590 121
321 3300053154 Ga0500619_000006 Ga0500619_000006_38740_39108 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01491

Frataxin_Cyay

Frataxin-like domain

34

137

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ew4-assembly1.cif.gz_A crystal structure of escherichia coli cyay protein reveals a novel fold for the frataxin family 0.9396 10 116
4jpd-assembly1.cif.gz_A the structure of cyay from burkholderia cenocepacia 0.9285 9 118
1ew4-assembly1.cif.gz_A crystal structure of escherichia coli cyay protein reveals a novel fold for the frataxin family 0.9228 10 116
4jpd-assembly1.cif.gz_A the structure of cyay from burkholderia cenocepacia 0.9204 9 118
4hs5-assembly2.cif.gz_B frataxin from psychromonas ingrahamii as a model to study stability modulation within cyay protein family 0.9202 10 116
ID Description Score Start End Superfamily
2p1xA00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.9384 10 116 3.30.920.10
4jpdA00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.9285 9 118 3.30.920.10
2p1xA00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.9216 10 116 3.30.920.10
4jpdA00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.9204 9 118 3.30.920.10
af_Q54C45_74_193_3.30.920.10 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.8937 7 113 3.30.920.10
ID Description Score Start End GO Terms
AF-A0A4V1UF61-F1-model_v4 Iron-sulfur cluster assembly protein CyaY 0.9836 10 116 GO:0005829
GO:0008198
GO:0008199
GO:0016226
AF-A0A0G3BI29-F1-model_v4 Iron-sulfur cluster assembly protein CyaY 0.9752 6 118 GO:0005829
GO:0008198
GO:0008199
GO:0016226
AF-A0A4V1UF61-F1-model_v4 Iron-sulfur cluster assembly protein CyaY 0.9745 10 116 GO:0005829
GO:0008198
GO:0008199
GO:0016226
AF-A0A257LQS6-F1-model_v4 Iron-sulfur cluster assembly protein CyaY 0.9702 10 119 GO:0005737
GO:0008199
GO:0016226
AF-A0A3N7CCP5-F1-model_v4 Iron-sulfur cluster assembly protein CyaY 0.9677 6 119 GO:0005737
GO:0008199
GO:0016226

Feature Viewer

pLDDT pTM Quality
90.2 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map