F405912
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 321 | 212 | 314 | 122 |
Family's Representative Sequence
| Representative Sequence | 3300006038|Ga0075365_10071784|Ga0075365_100717842 |
| Length | 143 |
| Sequence | MPPGPATRTSSLAVHDAVDSKVLMGNPLNVTDALTDAQYHAKTSXVLXXXEARIDAWLQDDVIDIDVQRTGGLLELTFPNRSKIVLNTQPPLHELWMAARAGGYHYKYVEGVWRDREGREFFEALSACASEQAGRSLAFEAPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 5 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 6 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 7 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 8 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 9 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 44 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 45 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 46 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 47 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 48 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 49 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 50 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 51 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 52 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 64 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 65 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 96 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 102 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 103 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 104 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 105 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 106 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 107 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 108 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 109 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 110 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 111 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 112 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 113 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 114 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 115 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 117 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 118 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 119 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 120 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 121 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 122 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 123 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 124 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 125 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 126 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 127 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 128 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 129 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 130 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 131 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 132 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 133 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 134 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 135 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 136 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 137 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 138 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 139 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 140 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 164 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 165 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 166 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 167 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 168 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 170 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 177 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 178 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 179 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 181 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 182 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 183 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 184 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 185 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 186 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 187 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 188 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 189 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 190 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 191 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 192 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 193 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 194 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 195 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 196 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 197 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 198 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 199 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 200 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 201 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 202 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 203 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 204 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 205 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 206 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 207 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 208 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 209 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 210 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 211 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 212 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.51 |
| Metatranscriptomes | 0 |
| Isolates | 2.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 41.43 |
| Nodule | 0.62 |
| Rhizoplane | 3.74 |
| Rhizosphere | 43.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000651 | 3300001979 | Bacteria | 15005 |
| 2 | JGI25153J46596_10001636 | 3300003215 | Bacteria | 13291 |
| 3 | rootH1_10058709 | 3300003316 | Bacteria | 1076 |
| 4 | rootL2_10089280 | 3300003322 | Bacteria | 1158 |
| 5 | rootH1_10128341 | 3300003316 | Bacteria | 2835 |
| 6 | rootH1_10128341 | 3300003323 | Bacteria | 1626 |
| 7 | Ga0055524_1000085 | 3300003775 | Bacteria | 117478 |
| 8 | Ga0055530_10028907 | 3300003791 | Bacteria | 1489 |
| 9 | Ga0055530_10081746 | 3300003791 | Bacteria | 677 |
| 10 | Ga0055540_1000056 | 3300003792 | Bacteria | 139732 |
| 11 | Ga0055531_10008479 | 3300003794 | Bacteria | 5406 |
| 12 | Ga0065165_1006591 | 3300005262 | Bacteria | 6032 |
| 13 | Ga0070676_10015225 | 3300005328 | Bacteria | 4241 |
| 14 | Ga0070677_10038590 | 3300005333 | Bacteria | 1870 |
| 15 | Ga0068868_100011934 | 3300005338 | Bacteria | 6338 |
| 16 | Ga0070661_100206326 | 3300005344 | Bacteria | 1503 |
| 17 | Ga0070661_100395254 | 3300005344 | Bacteria | 1092 |
| 18 | Ga0070675_100013555 | 3300005354 | Bacteria | 6410 |
| 19 | Ga0070673_100381420 | 3300005364 | Bacteria | 1257 |
| 20 | Ga0070659_100025177 | 3300005366 | Bacteria | 4568 |
| 21 | Ga0070667_100002943 | 3300005367 | Bacteria | 14641 |
| 22 | Ga0070708_100103589 | 3300005445 | Bacteria | 2609 |
| 23 | Ga0068867_100069874 | 3300005459 | Bacteria | 2624 |
| 24 | Ga0068867_100110642 | 3300005459 | Bacteria | 2110 |
| 25 | Ga0068867_101576518 | 3300005459 | Bacteria | 613 |
| 26 | Ga0070685_10694494 | 3300005466 | Bacteria | 741 |
| 27 | Ga0070706_100001547 | 3300005467 | Bacteria | 24043 |
| 28 | Ga0070706_100230005 | 3300005467 | Bacteria | 1731 |
| 29 | Ga0070707_100076326 | 3300005468 | Bacteria | 3232 |
| 30 | Ga0070698_100277730 | 3300005471 | Bacteria | 1607 |
| 31 | Ga0070672_100127752 | 3300005543 | Bacteria | 2087 |
| 32 | Ga0070665_100549617 | 3300005548 | Bacteria | 1167 |
| 33 | Ga0068857_100097912 | 3300005577 | Bacteria | 2630 |
| 34 | Ga0068854_100017675 | 3300005578 | Bacteria | 4775 |
| 35 | Ga0068854_100224866 | 3300005578 | Bacteria | 1487 |
| 36 | Ga0068859_100393158 | 3300005617 | Bacteria | 1482 |
| 37 | Ga0068866_10185063 | 3300005718 | Bacteria | 1233 |
| 38 | Ga0068861_101120335 | 3300005719 | Bacteria | 757 |
| 39 | Ga0068863_102299806 | 3300005841 | Bacteria | 549 |
| 40 | Ga0068858_100425555 | 3300005842 | Bacteria | 1277 |
| 41 | Ga0068860_100715303 | 3300005843 | Bacteria | 1012 |
| 42 | Ga0075365_10071784 | 3300006038 | Bacteria | 2331 |
| 43 | Ga0075368_10001276 | 3300006042 | Bacteria | 7975 |
| 44 | Ga0075368_10006234 | 3300006042 | Bacteria | 4154 |
| 45 | Ga0075368_10049590 | 3300006042 | Bacteria | 1666 |
| 46 | Ga0075368_10143109 | 3300006042 | Bacteria | 997 |
| 47 | Ga0075363_100033829 | 3300006048 | Bacteria | 2665 |
| 48 | Ga0075363_100075349 | 3300006048 | Bacteria | 1838 |
| 49 | Ga0075363_100111870 | 3300006048 | Bacteria | 1518 |
| 50 | Ga0075363_100483800 | 3300006048 | Bacteria | 734 |
| 51 | Ga0075364_10037104 | 3300006051 | Bacteria | 3153 |
| 52 | Ga0075362_10010846 | 3300006177 | Bacteria | 3573 |
| 53 | Ga0075362_10020851 | 3300006177 | Bacteria | 2742 |
| 54 | Ga0075362_10049470 | 3300006177 | Bacteria | 1878 |
| 55 | Ga0075362_10239945 | 3300006177 | Bacteria | 890 |
| 56 | Ga0075367_10007989 | 3300006178 | Bacteria | 5455 |
| 57 | Ga0075367_10017027 | 3300006178 | Bacteria | 3982 |
| 58 | Ga0075367_10028570 | 3300006178 | Bacteria | 3183 |
| 59 | Ga0075367_10029101 | 3300006178 | Bacteria | 3157 |
| 60 | Ga0075367_10264081 | 3300006178 | Bacteria | 1081 |
| 61 | Ga0075369_10041137 | 3300006186 | Bacteria | 1978 |
| 62 | Ga0075369_10062654 | 3300006186 | Bacteria | 1625 |
| 63 | Ga0075369_10100071 | 3300006186 | Bacteria | 1300 |
| 64 | Ga0075366_10002023 | 3300006195 | Bacteria | 10292 |
| 65 | Ga0075366_10005768 | 3300006195 | Bacteria | 6724 |
| 66 | Ga0075366_10031250 | 3300006195 | Bacteria | 3133 |
| 67 | Ga0075366_10047355 | 3300006195 | Bacteria | 2548 |
| 68 | Ga0075366_10074266 | 3300006195 | Bacteria | 2027 |
| 69 | Ga0075366_10135781 | 3300006195 | Bacteria | 1485 |
| 70 | Ga0075366_10160940 | 3300006195 | Bacteria | 1360 |
| 71 | Ga0075366_10844993 | 3300006195 | Bacteria | 570 |
| 72 | Ga0075370_10000529 | 3300006353 | Bacteria | 14601 |
| 73 | Ga0075370_10003524 | 3300006353 | Bacteria | 7467 |
| 74 | Ga0075370_10007339 | 3300006353 | Bacteria | 5613 |
| 75 | Ga0075370_10047646 | 3300006353 | Bacteria | 2427 |
| 76 | Ga0075370_10147864 | 3300006353 | Bacteria | 1376 |
| 77 | Ga0075370_10649202 | 3300006353 | Bacteria | 640 |
| 78 | Ga0075370_10851308 | 3300006353 | Bacteria | 557 |
| 79 | Ga0068865_100381852 | 3300006881 | Bacteria | 1149 |
| 80 | Ga0068865_100420932 | 3300006881 | Bacteria | 1098 |
| 81 | Ga0068865_101036228 | 3300006881 | Bacteria | 720 |
| 82 | Ga0097620_100393170 | 3300006931 | Bacteria | 1482 |
| 83 | Ga0079104_1000073 | 3300006946 | Bacteria | 152269 |
| 84 | Ga0105240_10783022 | 3300009093 | Bacteria | 1034 |
| 85 | Ga0105245_10133328 | 3300009098 | Bacteria | 2332 |
| 86 | Ga0105245_10248436 | 3300009098 | Bacteria | 1727 |
| 87 | Ga0105243_10113645 | 3300009148 | Bacteria | 2271 |
| 88 | Ga0105243_10380726 | 3300009148 | Bacteria | 1305 |
| 89 | Ga0105248_11293873 | 3300009177 | Bacteria | 825 |
| 90 | Ga0105246_10631545 | 3300011119 | Bacteria | 930 |
| 91 | Ga0157375_10404647 | 3300013308 | Bacteria | 1531 |
| 92 | Ga0157377_10411788 | 3300014745 | Bacteria | 923 |
| 93 | Ga0157379_11856459 | 3300014968 | Bacteria | 593 |
| 94 | Ga0213872_10000247 | 3300021361 | Bacteria | 47840 |
| 95 | Ga0209129_1008294 | 3300025258 | Bacteria | 2915 |
| 96 | Ga0209565_1030348 | 3300025263 | Bacteria | 1056 |
| 97 | Ga0209673_1009687 | 3300025273 | Bacteria | 4141 |
| 98 | Ga0209675_1019085 | 3300025291 | Bacteria | 1898 |
| 99 | Ga0209758_1000124 | 3300025297 | Bacteria | 189933 |
| 100 | Ga0209050_1000691 | 3300025298 | Bacteria | 50632 |
| 101 | Ga0209050_1000718 | 3300025298 | Bacteria | 48528 |
| 102 | Ga0209050_1020171 | 3300025298 | Bacteria | 2492 |
| 103 | Ga0209256_1000036 | 3300025299 | Bacteria | 386664 |
| 104 | Ga0209051_1000068 | 3300025303 | Bacteria | 220063 |
| 105 | Ga0209051_1018401 | 3300025303 | Bacteria | 3092 |
| 106 | Ga0209257_1000146 | 3300025304 | Bacteria | 194261 |
| 107 | Ga0209257_1074480 | 3300025304 | Bacteria | 886 |
| 108 | Ga0207682_10024295 | 3300025893 | Bacteria | 2399 |
| 109 | Ga0207642_10120235 | 3300025899 | Bacteria | 1353 |
| 110 | Ga0207645_10075720 | 3300025907 | Bacteria | 2154 |
| 111 | Ga0207684_10003302 | 3300025910 | Bacteria | 15830 |
| 112 | Ga0207649_10054540 | 3300025920 | Bacteria | 2488 |
| 113 | Ga0207646_11909637 | 3300025922 | Bacteria | 506 |
| 114 | Ga0207659_10063184 | 3300025926 | Bacteria | 2675 |
| 115 | Ga0207659_10115109 | 3300025926 | Bacteria | 2051 |
| 116 | Ga0207687_10150238 | 3300025927 | Bacteria | 1776 |
| 117 | Ga0207644_10328802 | 3300025931 | Bacteria | 1237 |
| 118 | Ga0207709_10438675 | 3300025935 | Bacteria | 1007 |
| 119 | Ga0207704_10933603 | 3300025938 | Bacteria | 731 |
| 120 | Ga0207691_10031494 | 3300025940 | Bacteria | 4949 |
| 121 | Ga0207711_10889109 | 3300025941 | Bacteria | 828 |
| 122 | Ga0207679_10100939 | 3300025945 | Bacteria | 2256 |
| 123 | Ga0207651_10274316 | 3300025960 | Bacteria | 1390 |
| 124 | Ga0207640_10189337 | 3300025981 | Bacteria | 1550 |
| 125 | Ga0207658_10001735 | 3300025986 | Bacteria | 16427 |
| 126 | Ga0207658_11111964 | 3300025986 | Bacteria | 722 |
| 127 | Ga0207677_10045520 | 3300026023 | Bacteria | 2930 |
| 128 | Ga0207677_10861496 | 3300026023 | Bacteria | 815 |
| 129 | Ga0207703_10356466 | 3300026035 | Bacteria | 1348 |
| 130 | Ga0207641_11688646 | 3300026088 | Bacteria | 635 |
| 131 | Ga0207648_10013161 | 3300026089 | Bacteria | 7711 |
| 132 | Ga0207648_10372335 | 3300026089 | Bacteria | 1290 |
| 133 | Ga0207648_10600734 | 3300026089 | Bacteria | 1014 |
| 134 | Ga0207674_10038816 | 3300026116 | Bacteria | 4940 |
| 135 | Ga0209281_1000263 | 3300027111 | Bacteria | 101190 |
| 136 | Ga0209998_10102876 | 3300027717 | Bacteria | 709 |
| 137 | Ga0209813_10032358 | 3300027866 | Bacteria | 1549 |
| 138 | Ga0209813_10128259 | 3300027866 | Bacteria | 890 |
| 139 | Ga0209974_10000422 | 3300027876 | Bacteria | 14107 |
| 140 | Ga0268266_10288785 | 3300028379 | Bacteria | 1527 |
| 141 | Ga0268265_12260406 | 3300028380 | Bacteria | 551 |
| 142 | Ga0307517_10150402 | 3300028786 | Bacteria | 1599 |
| 143 | Ga0307517_10156412 | 3300028786 | Bacteria | 1545 |
| 144 | Ga0307517_10200083 | 3300028786 | Bacteria | 1250 |
| 145 | Ga0307515_10000138 | 3300028794 | Bacteria | 173220 |
| 146 | Ga0307515_10001206 | 3300028794 | Bacteria | 59045 |
| 147 | Ga0307515_10027458 | 3300028794 | Bacteria | 9730 |
| 148 | Ga0307515_10036745 | 3300028794 | Bacteria | 7909 |
| 149 | Ga0307512_10150391 | 3300030522 | Bacteria | 1395 |
| 150 | Ga0307513_10019744 | 3300031456 | Bacteria | 8010 |
| 151 | Ga0307513_10118398 | 3300031456 | Bacteria | 2623 |
| 152 | Ga0307513_10163720 | 3300031456 | Bacteria | 2112 |
| 153 | Ga0307513_10833155 | 3300031456 | Bacteria | 629 |
| 154 | Ga0307509_10426944 | 3300031507 | Bacteria | 1025 |
| 155 | Ga0307509_10583248 | 3300031507 | Bacteria | 792 |
| 156 | Ga0307508_10000216 | 3300031616 | Bacteria | 69990 |
| 157 | Ga0307508_10284565 | 3300031616 | Bacteria | 1247 |
| 158 | Ga0307514_10013973 | 3300031649 | Bacteria | 6652 |
| 159 | Ga0307516_10018428 | 3300031730 | Bacteria | 7255 |
| 160 | Ga0307405_11724070 | 3300031731 | Unclassified | 555 |
| 161 | Ga0307416_101877855 | 3300032002 | Bacteria | 702 |
| 162 | Ga0307507_10008058 | 3300033179 | Bacteria | 14835 |
| 163 | Ga0373959_0195407 | 3300034820 | Unclassified | 532 |
| 164 | Ga0373939_0041645 | 3300035114 | Bacteria | 1385 |
| 165 | Ga0373924_0455059 | 3300035410 | Unclassified | 574 |
| 166 | Ga0373937_1659253 | 3300036401 | Bacteria | 586 |
| 167 | Ga0395905_0097354 | 3300037471 | Bacteria | 2762 |
| 168 | Ga0436361_0504982 | 3300039447 | Bacteria | 102576 |
| 169 | Ga0436361_0571366 | 3300039447 | Bacteria | 1290 |
| 170 | Ga0451789_0278294 | 3300041443 | Bacteria | 3053 |
| 171 | Ga0451791_0193244 | 3300041451 | Bacteria | 807 |
| 172 | Ga0451793_0071570 | 3300041452 | Bacteria | 1872 |
| 173 | Ga0451797_0472492 | 3300041453 | Bacteria | 909 |
| 174 | Ga0451795_1083069 | 3300041456 | Bacteria | 601 |
| 175 | Ga0451795_1295643 | 3300041456 | Bacteria | 559 |
| 176 | Ga0451795_1324251 | 3300041456 | Bacteria | 925 |
| 177 | Ga0451798_0000695 | 3300041458 | Bacteria | 1881 |
| 178 | Ga0451800_1223580 | 3300041459 | Bacteria | 880 |
| 179 | Ga0451804_0163100 | 3300041463 | Bacteria | 1650 |
| 180 | Ga0451807_1897981 | 3300041486 | Bacteria | 1052 |
| 181 | Ga0451833_0219174 | 3300041491 | Bacteria | 537 |
| 182 | Ga0451845_0296347 | 3300041501 | Bacteria | 622 |
| 183 | Ga0451847_0611866 | 3300041503 | Bacteria | 975 |
| 184 | Ga0450919_007491 | 3300042121 | Bacteria | 1275 |
| 185 | Ga0450920_019650 | 3300042122 | Bacteria | 1298 |
| 186 | Ga0450923_040872 | 3300042125 | Bacteria | 974 |
| 187 | Ga0450898_038747 | 3300042134 | Bacteria | 895 |
| 188 | Ga0439446_0012753 | 3300042156 | Bacteria | 2299 |
| 189 | Ga0439434_0013866 | 3300042435 | Bacteria | 2395 |
| 190 | Ga0450918_000488 | 3300042531 | Bacteria | 8486 |
| 191 | Ga0466965_0182218 | 3300044683 | Bacteria | 1108 |
| 192 | Ga0466964_0672401 | 3300044706 | Bacteria | 575 |
| 193 | Ga0453684_0004870 | 3300044712 | Bacteria | 27520 |
| 194 | Ga0495590_0026550 | 3300046457 | Bacteria | 2033 |
| 195 | Ga0495638_0030769 | 3300046460 | Bacteria | 3452 |
| 196 | Ga0495650_0138489 | 3300046471 | Bacteria | 882 |
| 197 | Ga0495606_0385130 | 3300046507 | Bacteria | 734 |
| 198 | Ga0495610_0382203 | 3300046512 | Bacteria | 523 |
| 199 | Ga0495628_0968174 | 3300046516 | Bacteria | 587 |
| 200 | Ga0495631_0270167 | 3300046518 | Bacteria | 724 |
| 201 | Ga0495632_0009823 | 3300046519 | Bacteria | 5725 |
| 202 | Ga0495632_0020328 | 3300046519 | Bacteria | 3595 |
| 203 | Ga0495632_0056708 | 3300046519 | Bacteria | 1914 |
| 204 | Ga0495643_0047569 | 3300046522 | Bacteria | 2322 |
| 205 | Ga0495643_0428486 | 3300046522 | Unclassified | 579 |
| 206 | Ga0495648_0343760 | 3300046524 | Bacteria | 684 |
| 207 | Ga0495642_0049670 | 3300046528 | Bacteria | 1724 |
| 208 | Ga0495609_0277988 | 3300046538 | Bacteria | 685 |
| 209 | Ga0495611_0079228 | 3300046648 | Bacteria | 1509 |
| 210 | Ga0495625_0011613 | 3300046660 | Bacteria | 7163 |
| 211 | Ga0495625_0012016 | 3300046660 | Bacteria | 7027 |
| 212 | Ga0495658_0204495 | 3300046683 | Bacteria | 1232 |
| 213 | Ga0495670_0781140 | 3300046691 | Bacteria | 521 |
| 214 | Ga0495649_0000401 | 3300046694 | Bacteria | 37516 |
| 215 | Ga0495660_0015242 | 3300046810 | Bacteria | 4442 |
| 216 | Ga0495676_0909181 | 3300047321 | Bacteria | 564 |
| 217 | Ga0495683_0268328 | 3300047323 | Bacteria | 743 |
| 218 | Ga0495687_019392 | 3300047443 | Bacteria | 3339 |
| 219 | Ga0495687_019393 | 3300047443 | Bacteria | 3339 |
| 220 | Ga0495686_0470229 | 3300047472 | Bacteria | 665 |
| 221 | Ga0495686_0596797 | 3300047472 | Bacteria | 572 |
| 222 | Ga0495626_0191779 | 3300048091 | Bacteria | 842 |
| 223 | Ga0496102_0002356 | 3300048905 | Bacteria | 16116 |
| 224 | Ga0496121_0169497 | 3300048924 | Bacteria | 1587 |
| 225 | Ga0496122_0290884 | 3300048925 | Bacteria | 887 |
| 226 | Ga0496124_0000108 | 3300048927 | Bacteria | 167473 |
| 227 | Ga0496125_0015641 | 3300048928 | Bacteria | 7322 |
| 228 | Ga0495678_071369 | 3300049459 | Bacteria | 1272 |
| 229 | Ga0501294_008890 | 3300049517 | Bacteria | 982 |
| 230 | Ga0501032_0203576 | 3300049569 | Bacteria | 1292 |
| 231 | Ga0501042_0110842 | 3300049578 | Bacteria | 1976 |
| 232 | Ga0501043_0000002 | 3300049579 | Bacteria | 351081 |
| 233 | Ga0501046_0000008 | 3300049580 | Bacteria | 351167 |
| 234 | Ga0501047_0000003 | 3300049581 | Bacteria | 508375 |
| 235 | Ga0501048_0001116 | 3300049582 | Bacteria | 20152 |
| 236 | Ga0501252_001152 | 3300049682 | Bacteria | 2358 |
| 237 | Ga0501253_050062 | 3300049683 | Bacteria | 872 |
| 238 | Ga0501219_009075 | 3300049703 | Bacteria | 733 |
| 239 | Ga0501045_0033364 | 3300049824 | Bacteria | 3732 |
| 240 | Ga0501226_027828 | 3300049853 | Bacteria | 637 |
| 241 | nmdc:mga03683_267348_c1 | 3300050489 | Bacteria | 797 |
| 242 | nmdc:mga03683_397397_c1 | 3300050489 | Bacteria | 658 |
| 243 | nmdc:mga03683_50838_c1 | 3300050489 | Bacteria | 1728 |
| 244 | nmdc:mga03683_515351_c1 | 3300050489 | Unclassified | 580 |
| 245 | nmdc:mga03683_562986_c1 | 3300050489 | Bacteria | 556 |
| 246 | nmdc:mga03683_8228_c1 | 3300050489 | Bacteria | 3657 |
| 247 | nmdc:mga03n38_227170_c1 | 3300050490 | Bacteria | 977 |
| 248 | nmdc:mga03n38_341130_c1 | 3300050490 | Bacteria | 813 |
| 249 | nmdc:mga03n38_400811_c1 | 3300050490 | Bacteria | 755 |
| 250 | nmdc:mga03n38_48485_c1 | 3300050490 | Bacteria | 1884 |
| 251 | nmdc:mga00v17_122990_c1 | 3300050491 | Bacteria | 1654 |
| 252 | nmdc:mga0yw44_174826_c1 | 3300050492 | Bacteria | 1411 |
| 253 | nmdc:mga0k408_116510_c1 | 3300050493 | Bacteria | 1581 |
| 254 | nmdc:mga0k408_1189_c1 | 3300050493 | Bacteria | 13937 |
| 255 | nmdc:mga0k408_16824_c1 | 3300050493 | Bacteria | 4066 |
| 256 | nmdc:mga0k408_179492_c1 | 3300050493 | Bacteria | 1263 |
| 257 | nmdc:mga0k408_19948_c1 | 3300050493 | Bacteria | 3752 |
| 258 | nmdc:mga0k408_226836_c1 | 3300050493 | Bacteria | 1115 |
| 259 | nmdc:mga0k408_3311_c1 | 3300050493 | Bacteria | 8524 |
| 260 | nmdc:mga0k408_33310_c1 | 3300050493 | Bacteria | 2947 |
| 261 | nmdc:mga0k408_360_c1 | 3300050493 | Bacteria | 25004 |
| 262 | nmdc:mga0k408_431373_c1 | 3300050493 | Bacteria | 783 |
| 263 | nmdc:mga0k408_441807_c1 | 3300050493 | Unclassified | 773 |
| 264 | nmdc:mga0k408_631246_c1 | 3300050493 | Bacteria | 631 |
| 265 | nmdc:mga0k408_737997_c1 | 3300050493 | Bacteria | 576 |
| 266 | nmdc:mga0k408_9723_c1 | 3300050493 | Bacteria | 5192 |
| 267 | nmdc:mga06z11_159049_c1 | 3300050494 | Bacteria | 1290 |
| 268 | nmdc:mga06z11_262468_c1 | 3300050494 | Bacteria | 1019 |
| 269 | nmdc:mga06z11_398768_c1 | 3300050494 | Bacteria | 828 |
| 270 | nmdc:mga06z11_415817_c1 | 3300050494 | Bacteria | 810 |
| 271 | nmdc:mga06z11_7862_c1 | 3300050494 | Bacteria | 4413 |
| 272 | nmdc:mga04h51_13345_c1 | 3300050495 | Bacteria | 2324 |
| 273 | nmdc:mga04h51_150121_c1 | 3300050495 | Bacteria | 890 |
| 274 | nmdc:mga07m45_1002_c1 | 3300050496 | Bacteria | 12472 |
| 275 | nmdc:mga07m45_199264_c1 | 3300050496 | Bacteria | 1165 |
| 276 | nmdc:mga07m45_29370_c1 | 3300050496 | Bacteria | 3040 |
| 277 | nmdc:mga07m45_546014_c1 | 3300050496 | Bacteria | 670 |
| 278 | nmdc:mga07m45_5495_c1 | 3300050496 | Bacteria | 6313 |
| 279 | nmdc:mga07m45_55760_c1 | 3300050496 | Bacteria | 2234 |
| 280 | nmdc:mga07m45_62487_c1 | 3300050496 | Bacteria | 2111 |
| 281 | nmdc:mga07m45_69065_c1 | 3300050496 | Bacteria | 2009 |
| 282 | nmdc:mga07m45_701988_c1 | 3300050496 | Bacteria | 582 |
| 283 | nmdc:mga07m45_864395_c1 | 3300050496 | Bacteria | 518 |
| 284 | nmdc:mga0sz30_188886_c1 | 3300050516 | Bacteria | 915 |
| 285 | nmdc:mga0sz30_381912_c1 | 3300050516 | Bacteria | 631 |
| 286 | Ga0500578_0001754 | 3300053086 | Bacteria | 20477 |
| 287 | Ga0500578_0170480 | 3300053086 | Bacteria | 1346 |
| 288 | Ga0500578_0261551 | 3300053086 | Bacteria | 1039 |
| 289 | Ga0500644_0056744 | 3300053088 | Bacteria | 1364 |
| 290 | Ga0500646_0007985 | 3300053090 | Bacteria | 2704 |
| 291 | Ga0500583_0271180 | 3300053092 | Bacteria | 835 |
| 292 | Ga0500583_0278601 | 3300053092 | Bacteria | 822 |
| 293 | Ga0500583_0404072 | 3300053092 | Bacteria | 655 |
| 294 | Ga0500641_0331366 | 3300053096 | Bacteria | 617 |
| 295 | Ga0500650_0092196 | 3300053098 | Bacteria | 1418 |
| 296 | Ga0500650_0486725 | 3300053098 | Bacteria | 526 |
| 297 | Ga0500562_070317 | 3300053108 | Bacteria | 944 |
| 298 | Ga0500623_182260 | 3300053127 | Bacteria | 807 |
| 299 | Ga0500628_166677 | 3300053129 | Bacteria | 623 |
| 300 | Ga0500642_0037802 | 3300053130 | Bacteria | 2065 |
| 301 | Ga0500652_003921 | 3300053131 | Bacteria | 4549 |
| 302 | Ga0500655_018952 | 3300053133 | Bacteria | 1279 |
| 303 | Ga0500658_0028559 | 3300053134 | Bacteria | 2165 |
| 304 | Ga0500568_0003783 | 3300053139 | Bacteria | 8282 |
| 305 | Ga0500577_0016091 | 3300053142 | Bacteria | 2351 |
| 306 | Ga0500579_139830 | 3300053143 | Bacteria | 1098 |
| 307 | Ga0500604_0156066 | 3300053151 | Bacteria | 776 |
| 308 | Ga0500619_000006 | 3300053154 | Bacteria | 77270 |
| 309 | Ga0500622_0000125 | 3300053156 | Bacteria | 81109 |
| 310 | Ga0500622_0007470 | 3300053156 | Bacteria | 6206 |
| 311 | Ga0500627_0421802 | 3300053158 | Bacteria | 565 |
| 312 | Ga0500570_082175 | 3300053724 | Bacteria | 1445 |
| 313 | Ga0500584_115855 | 3300053726 | Bacteria | 1073 |
| 314 | Ga0500587_000033 | 3300053739 | Bacteria | 13415 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005459 | Ga0068867_101576518 | Ga0068867_1015765181 | 111 |
| 2 | 3300031456 | Ga0307513_10118398 | Ga0307513_101183983 | 111 |
| 3 | 3300042156 | Ga0439446_0012753 | Ga0439446_0012753_1272_1616 | 114 |
| 4 | 3300006048 | Ga0075363_100111870 | Ga0075363_1001118701 | 115 |
| 5 | 3300006177 | Ga0075362_10020851 | Ga0075362_100208512 | 115 |
| 6 | 3300006195 | Ga0075366_10135781 | Ga0075366_101357812 | 115 |
| 7 | 3300028786 | Ga0307517_10150402 | Ga0307517_101504022 | 115 |
| 8 | 3300028786 | Ga0307517_10200083 | Ga0307517_102000832 | 115 |
| 9 | 3300028794 | Ga0307515_10027458 | Ga0307515_100274586 | 115 |
| 10 | 3300046457 | Ga0495590_0026550 | Ga0495590_0026550_966_1316 | 115 |
| 11 | 3300046518 | Ga0495631_0270167 | Ga0495631_0270167_298_648 | 115 |
| 12 | 3300046519 | Ga0495632_0056708 | Ga0495632_0056708_621_971 | 115 |
| 13 | 3300046524 | Ga0495648_0343760 | Ga0495648_0343760_224_574 | 115 |
| 14 | 3300046528 | Ga0495642_0049670 | Ga0495642_0049670_981_1331 | 115 |
| 15 | 3300046538 | Ga0495609_0277988 | Ga0495609_0277988_67_417 | 115 |
| 16 | 3300046648 | Ga0495611_0079228 | Ga0495611_0079228_278_628 | 115 |
| 17 | 3300046660 | Ga0495625_0012016 | Ga0495625_0012016_3401_3751 | 115 |
| 18 | 3300046694 | Ga0495649_0000401 | Ga0495649_0000401_36305_36655 | 115 |
| 19 | 3300046810 | Ga0495660_0015242 | Ga0495660_0015242_258_608 | 115 |
| 20 | 3300047323 | Ga0495683_0268328 | Ga0495683_0268328_147_497 | 115 |
| 21 | 3300047443 | Ga0495687_019392 | Ga0495687_019392_1294_1644 | 115 |
| 22 | 3300047443 | Ga0495687_019393 | Ga0495687_019393_1696_2046 | 115 |
| 23 | 3300048091 | Ga0495626_0191779 | Ga0495626_0191779_417_767 | 115 |
| 24 | 3300049459 | Ga0495678_071369 | Ga0495678_071369_908_1258 | 115 |
| 25 | 3300050489 | nmdc:mga03683_8228_c1 | nmdc:mga03683_8228_c1_828_1178 | 115 |
| 26 | 3300050490 | nmdc:mga03n38_400811_c1 | nmdc:mga03n38_400811_c1_105_455 | 115 |
| 27 | 3300050493 | nmdc:mga0k408_1189_c1 | nmdc:mga0k408_1189_c1_66_416 | 115 |
| 28 | 3300053086 | Ga0500578_0170480 | Ga0500578_0170480_374_724 | 115 |
| 29 | 3300053098 | Ga0500650_0486725 | Ga0500650_0486725_158_508 | 115 |
| 30 | 3300053134 | Ga0500658_0028559 | Ga0500658_0028559_194_544 | 115 |
| 31 | 3300005466 | Ga0070685_10694494 | Ga0070685_106944942 | 116 |
| 32 | 3300005617 | Ga0068859_100393158 | Ga0068859_1003931582 | 116 |
| 33 | 3300006931 | Ga0097620_100393170 | Ga0097620_1003931702 | 116 |
| 34 | 3300026023 | Ga0207677_10861496 | Ga0207677_108614962 | 116 |
| 35 | 3300026089 | Ga0207648_10600734 | Ga0207648_106007342 | 116 |
| 36 | 3300037471 | Ga0395905_0097354 | Ga0395905_0097354_1337_1690 | 116 |
| 37 | 3300039447 | Ga0436361_0571366 | Ga0436361_0571366_160_510 | 116 |
| 38 | iso_pu_bacteria | 2585428062 | 2587759525 | 116 |
| 39 | iso_pu_bacteria | 2588253510 | 2588290135 | 116 |
| 40 | iso_pu_bacteria | 2643221592 | 2643972853 | 116 |
| 41 | iso_pu_bacteria | 2643221625 | 2644143300 | 116 |
| 42 | iso_pu_bacteria | 2643221648 | 2644276263 | 116 |
| 43 | iso_pu_bacteria | 2643221654 | 2644301220 | 116 |
| 44 | 3300005445 | Ga0070708_100103589 | Ga0070708_1001035892 | 117 |
| 45 | 3300005467 | Ga0070706_100001547 | Ga0070706_10000154718 | 117 |
| 46 | 3300005468 | Ga0070707_100076326 | Ga0070707_1000763262 | 117 |
| 47 | 3300005471 | Ga0070698_100277730 | Ga0070698_1002777302 | 117 |
| 48 | 3300006178 | Ga0075367_10007989 | Ga0075367_100079892 | 117 |
| 49 | 3300006186 | Ga0075369_10100071 | Ga0075369_101000712 | 117 |
| 50 | 3300006195 | Ga0075366_10031250 | Ga0075366_100312502 | 117 |
| 51 | 3300025910 | Ga0207684_10003302 | Ga0207684_100033028 | 117 |
| 52 | 3300050494 | nmdc:mga06z11_7862_c1 | nmdc:mga06z11_7862_c1_776_1135 | 117 |
| 53 | iso_pu_bacteria | 2585428058 | 2587731379 | 117 |
| 54 | 3300025922 | Ga0207646_11909637 | Ga0207646_119096371 | 118 |
| 55 | 3300025986 | Ga0207658_11111964 | Ga0207658_111119642 | 118 |
| 56 | 3300044683 | Ga0466965_0182218 | Ga0466965_0182218_593_949 | 118 |
| 57 | 3300044706 | Ga0466964_0672401 | Ga0466964_0672401_39_395 | 118 |
| 58 | 3300048924 | Ga0496121_0169497 | Ga0496121_0169497_899_1255 | 118 |
| 59 | 3300048927 | Ga0496124_0000108 | Ga0496124_0000108_92374_92730 | 118 |
| 60 | 3300048928 | Ga0496125_0015641 | Ga0496125_0015641_2440_2796 | 118 |
| 61 | 3300003775 | Ga0055524_1000085 | Ga0055524_100008511 | 119 |
| 62 | 3300003791 | Ga0055530_10081746 | Ga0055530_100817461 | 119 |
| 63 | 3300005328 | Ga0070676_10015225 | Ga0070676_100152255 | 119 |
| 64 | 3300005333 | Ga0070677_10038590 | Ga0070677_100385901 | 119 |
| 65 | 3300005338 | Ga0068868_100011934 | Ga0068868_1000119342 | 119 |
| 66 | 3300005344 | Ga0070661_100206326 | Ga0070661_1002063261 | 119 |
| 67 | 3300005344 | Ga0070661_100395254 | Ga0070661_1003952543 | 119 |
| 68 | 3300005354 | Ga0070675_100013555 | Ga0070675_1000135554 | 119 |
| 69 | 3300005364 | Ga0070673_100381420 | Ga0070673_1003814202 | 119 |
| 70 | 3300005366 | Ga0070659_100025177 | Ga0070659_1000251773 | 119 |
| 71 | 3300005459 | Ga0068867_100069874 | Ga0068867_1000698742 | 119 |
| 72 | 3300005459 | Ga0068867_100110642 | Ga0068867_1001106422 | 119 |
| 73 | 3300005467 | Ga0070706_100230005 | Ga0070706_1002300053 | 119 |
| 74 | 3300005543 | Ga0070672_100127752 | Ga0070672_1001277522 | 119 |
| 75 | 3300005577 | Ga0068857_100097912 | Ga0068857_1000979122 | 119 |
| 76 | 3300005578 | Ga0068854_100017675 | Ga0068854_1000176754 | 119 |
| 77 | 3300005578 | Ga0068854_100224866 | Ga0068854_1002248662 | 119 |
| 78 | 3300005718 | Ga0068866_10185063 | Ga0068866_101850632 | 119 |
| 79 | 3300005719 | Ga0068861_101120335 | Ga0068861_1011203352 | 119 |
| 80 | 3300005841 | Ga0068863_102299806 | Ga0068863_1022998061 | 119 |
| 81 | 3300005842 | Ga0068858_100425555 | Ga0068858_1004255552 | 119 |
| 82 | 3300005843 | Ga0068860_100715303 | Ga0068860_1007153032 | 119 |
| 83 | 3300006038 | Ga0075365_10071784 | Ga0075365_100717842 | 119 |
| 84 | 3300006042 | Ga0075368_10001276 | Ga0075368_100012763 | 119 |
| 85 | 3300006042 | Ga0075368_10049590 | Ga0075368_100495902 | 119 |
| 86 | 3300006042 | Ga0075368_10143109 | Ga0075368_101431092 | 119 |
| 87 | 3300006048 | Ga0075363_100033829 | Ga0075363_1000338292 | 119 |
| 88 | 3300006051 | Ga0075364_10037104 | Ga0075364_100371042 | 119 |
| 89 | 3300006177 | Ga0075362_10010846 | Ga0075362_100108462 | 119 |
| 90 | 3300006177 | Ga0075362_10239945 | Ga0075362_102399451 | 119 |
| 91 | 3300006178 | Ga0075367_10028570 | Ga0075367_100285703 | 119 |
| 92 | 3300006178 | Ga0075367_10029101 | Ga0075367_100291012 | 119 |
| 93 | 3300006178 | Ga0075367_10264081 | Ga0075367_102640812 | 119 |
| 94 | 3300006186 | Ga0075369_10062654 | Ga0075369_100626542 | 119 |
| 95 | 3300006195 | Ga0075366_10002023 | Ga0075366_100020238 | 119 |
| 96 | 3300006195 | Ga0075366_10005768 | Ga0075366_100057687 | 119 |
| 97 | 3300006195 | Ga0075366_10047355 | Ga0075366_100473553 | 119 |
| 98 | 3300006195 | Ga0075366_10844993 | Ga0075366_108449932 | 119 |
| 99 | 3300006353 | Ga0075370_10003524 | Ga0075370_100035242 | 119 |
| 100 | 3300006353 | Ga0075370_10007339 | Ga0075370_100073395 | 119 |
| 101 | 3300006353 | Ga0075370_10147864 | Ga0075370_101478643 | 119 |
| 102 | 3300006353 | Ga0075370_10649202 | Ga0075370_106492022 | 119 |
| 103 | 3300006353 | Ga0075370_10851308 | Ga0075370_108513081 | 119 |
| 104 | 3300006881 | Ga0068865_100381852 | Ga0068865_1003818521 | 119 |
| 105 | 3300006881 | Ga0068865_101036228 | Ga0068865_1010362282 | 119 |
| 106 | 3300006946 | Ga0079104_1000073 | Ga0079104_100007388 | 119 |
| 107 | 3300009093 | Ga0105240_10783022 | Ga0105240_107830222 | 119 |
| 108 | 3300009098 | Ga0105245_10133328 | Ga0105245_101333282 | 119 |
| 109 | 3300009148 | Ga0105243_10113645 | Ga0105243_101136452 | 119 |
| 110 | 3300009148 | Ga0105243_10380726 | Ga0105243_103807262 | 119 |
| 111 | 3300011119 | Ga0105246_10631545 | Ga0105246_106315453 | 119 |
| 112 | 3300014745 | Ga0157377_10411788 | Ga0157377_104117881 | 119 |
| 113 | 3300014968 | Ga0157379_11856459 | Ga0157379_118564591 | 119 |
| 114 | 3300021361 | Ga0213872_10000247 | Ga0213872_100002479 | 119 |
| 115 | 3300025263 | Ga0209565_1030348 | Ga0209565_10303482 | 119 |
| 116 | 3300025291 | Ga0209675_1019085 | Ga0209675_10190853 | 119 |
| 117 | 3300025298 | Ga0209050_1020171 | Ga0209050_10201713 | 119 |
| 118 | 3300025299 | Ga0209256_1000036 | Ga0209256_1000036121 | 119 |
| 119 | 3300025893 | Ga0207682_10024295 | Ga0207682_100242952 | 119 |
| 120 | 3300025899 | Ga0207642_10120235 | Ga0207642_101202352 | 119 |
| 121 | 3300025907 | Ga0207645_10075720 | Ga0207645_100757203 | 119 |
| 122 | 3300025920 | Ga0207649_10054540 | Ga0207649_100545401 | 119 |
| 123 | 3300025926 | Ga0207659_10063184 | Ga0207659_100631842 | 119 |
| 124 | 3300025926 | Ga0207659_10115109 | Ga0207659_101151092 | 119 |
| 125 | 3300025931 | Ga0207644_10328802 | Ga0207644_103288021 | 119 |
| 126 | 3300025935 | Ga0207709_10438675 | Ga0207709_104386752 | 119 |
| 127 | 3300025938 | Ga0207704_10933603 | Ga0207704_109336032 | 119 |
| 128 | 3300025940 | Ga0207691_10031494 | Ga0207691_100314946 | 119 |
| 129 | 3300025945 | Ga0207679_10100939 | Ga0207679_101009392 | 119 |
| 130 | 3300025960 | Ga0207651_10274316 | Ga0207651_102743162 | 119 |
| 131 | 3300025981 | Ga0207640_10189337 | Ga0207640_101893372 | 119 |
| 132 | 3300026023 | Ga0207677_10045520 | Ga0207677_100455202 | 119 |
| 133 | 3300026035 | Ga0207703_10356466 | Ga0207703_103564662 | 119 |
| 134 | 3300026088 | Ga0207641_11688646 | Ga0207641_116886461 | 119 |
| 135 | 3300026089 | Ga0207648_10013161 | Ga0207648_100131614 | 119 |
| 136 | 3300026089 | Ga0207648_10372335 | Ga0207648_103723351 | 119 |
| 137 | 3300026116 | Ga0207674_10038816 | Ga0207674_100388162 | 119 |
| 138 | 3300027111 | Ga0209281_1000263 | Ga0209281_100026388 | 119 |
| 139 | 3300027866 | Ga0209813_10032358 | Ga0209813_100323582 | 119 |
| 140 | 3300027866 | Ga0209813_10128259 | Ga0209813_101282592 | 119 |
| 141 | 3300028380 | Ga0268265_12260406 | Ga0268265_122604062 | 119 |
| 142 | 3300031616 | Ga0307508_10284565 | Ga0307508_102845652 | 119 |
| 143 | 3300031730 | Ga0307516_10018428 | Ga0307516_100184285 | 119 |
| 144 | 3300034820 | Ga0373959_0195407 | Ga0373959_0195407_73_432 | 119 |
| 145 | 3300035114 | Ga0373939_0041645 | Ga0373939_0041645_420_779 | 119 |
| 146 | 3300035410 | Ga0373924_0455059 | Ga0373924_0455059_100_462 | 119 |
| 147 | 3300036401 | Ga0373937_1659253 | Ga0373937_1659253_125_487 | 119 |
| 148 | 3300039447 | Ga0436361_0504982 | Ga0436361_0504982_7240_7599 | 119 |
| 149 | 3300042121 | Ga0450919_007491 | Ga0450919_007491_537_896 | 119 |
| 150 | 3300042122 | Ga0450920_019650 | Ga0450920_019650_557_916 | 119 |
| 151 | 3300042125 | Ga0450923_040872 | Ga0450923_040872_561_920 | 119 |
| 152 | 3300042134 | Ga0450898_038747 | Ga0450898_038747_73_432 | 119 |
| 153 | 3300042435 | Ga0439434_0013866 | Ga0439434_0013866_245_604 | 119 |
| 154 | 3300042531 | Ga0450918_000488 | Ga0450918_000488_1299_1658 | 119 |
| 155 | 3300046516 | Ga0495628_0968174 | Ga0495628_0968174_156_518 | 119 |
| 156 | 3300046683 | Ga0495658_0204495 | Ga0495658_0204495_108_470 | 119 |
| 157 | 3300046691 | Ga0495670_0781140 | Ga0495670_0781140_22_420 | 119 |
| 158 | 3300047321 | Ga0495676_0909181 | Ga0495676_0909181_131_493 | 119 |
| 159 | 3300048905 | Ga0496102_0002356 | Ga0496102_0002356_9285_9644 | 119 |
| 160 | 3300049569 | Ga0501032_0203576 | Ga0501032_0203576_44_403 | 119 |
| 161 | 3300049578 | Ga0501042_0110842 | Ga0501042_0110842_871_1230 | 119 |
| 162 | 3300049579 | Ga0501043_0000002 | Ga0501043_0000002_261721_262080 | 119 |
| 163 | 3300049580 | Ga0501046_0000008 | Ga0501046_0000008_261804_262163 | 119 |
| 164 | 3300049581 | Ga0501047_0000003 | Ga0501047_0000003_284986_285345 | 119 |
| 165 | 3300049582 | Ga0501048_0001116 | Ga0501048_0001116_4872_5231 | 119 |
| 166 | 3300049682 | Ga0501252_001152 | Ga0501252_001152_1885_2244 | 119 |
| 167 | 3300049824 | Ga0501045_0033364 | Ga0501045_0033364_1608_1967 | 119 |
| 168 | 3300049853 | Ga0501226_027828 | Ga0501226_027828_81_440 | 119 |
| 169 | 3300050489 | nmdc:mga03683_267348_c1 | nmdc:mga03683_267348_c1_291_689 | 119 |
| 170 | 3300050489 | nmdc:mga03683_562986_c1 | nmdc:mga03683_562986_c1_19_417 | 119 |
| 171 | 3300050490 | nmdc:mga03n38_341130_c1 | nmdc:mga03n38_341130_c1_220_618 | 119 |
| 172 | 3300050491 | nmdc:mga00v17_122990_c1 | nmdc:mga00v17_122990_c1_842_1240 | 119 |
| 173 | 3300050492 | nmdc:mga0yw44_174826_c1 | nmdc:mga0yw44_174826_c1_799_1197 | 119 |
| 174 | 3300050493 | nmdc:mga0k408_16824_c1 | nmdc:mga0k408_16824_c1_2436_2834 | 119 |
| 175 | 3300050493 | nmdc:mga0k408_226836_c1 | nmdc:mga0k408_226836_c1_609_968 | 119 |
| 176 | 3300050493 | nmdc:mga0k408_3311_c1 | nmdc:mga0k408_3311_c1_506_919 | 119 |
| 177 | 3300050493 | nmdc:mga0k408_360_c1 | nmdc:mga0k408_360_c1_21901_22299 | 119 |
| 178 | 3300050493 | nmdc:mga0k408_431373_c1 | nmdc:mga0k408_431373_c1_387_749 | 119 |
| 179 | 3300050494 | nmdc:mga06z11_398768_c1 | nmdc:mga06z11_398768_c1_280_693 | 119 |
| 180 | 3300050495 | nmdc:mga04h51_13345_c1 | nmdc:mga04h51_13345_c1_1085_1483 | 119 |
| 181 | 3300050495 | nmdc:mga04h51_150121_c1 | nmdc:mga04h51_150121_c1_331_744 | 119 |
| 182 | 3300050496 | nmdc:mga07m45_1002_c1 | nmdc:mga07m45_1002_c1_2582_2980 | 119 |
| 183 | 3300050496 | nmdc:mga07m45_546014_c1 | nmdc:mga07m45_546014_c1_103_501 | 119 |
| 184 | 3300050496 | nmdc:mga07m45_5495_c1 | nmdc:mga07m45_5495_c1_4172_4585 | 119 |
| 185 | 3300050496 | nmdc:mga07m45_69065_c1 | nmdc:mga07m45_69065_c1_897_1295 | 119 |
| 186 | 3300050496 | nmdc:mga07m45_864395_c1 | nmdc:mga07m45_864395_c1_91_453 | 119 |
| 187 | 3300050516 | nmdc:mga0sz30_188886_c1 | nmdc:mga0sz30_188886_c1_19_417 | 119 |
| 188 | 3300053092 | Ga0500583_0278601 | Ga0500583_0278601_130_528 | 119 |
| 189 | 3300053139 | Ga0500568_0003783 | Ga0500568_0003783_1507_1905 | 119 |
| 190 | 3300003215 | JGI25153J46596_10001636 | JGI25153J46596_1000163611 | 120 |
| 191 | 3300003323 | rootH1_10128341 | rootH1_101283412 | 120 |
| 192 | 3300003791 | Ga0055530_10028907 | Ga0055530_100289072 | 120 |
| 193 | 3300003792 | Ga0055540_1000056 | Ga0055540_1000056116 | 120 |
| 194 | 3300003794 | Ga0055531_10008479 | Ga0055531_100084795 | 120 |
| 195 | 3300005262 | Ga0065165_1006591 | Ga0065165_10065911 | 120 |
| 196 | 3300005367 | Ga0070667_100002943 | Ga0070667_10000294313 | 120 |
| 197 | 3300005548 | Ga0070665_100549617 | Ga0070665_1005496172 | 120 |
| 198 | 3300006042 | Ga0075368_10006234 | Ga0075368_100062345 | 120 |
| 199 | 3300006048 | Ga0075363_100075349 | Ga0075363_1000753492 | 120 |
| 200 | 3300006048 | Ga0075363_100483800 | Ga0075363_1004838001 | 120 |
| 201 | 3300006177 | Ga0075362_10049470 | Ga0075362_100494703 | 120 |
| 202 | 3300006178 | Ga0075367_10017027 | Ga0075367_100170273 | 120 |
| 203 | 3300006195 | Ga0075366_10074266 | Ga0075366_100742662 | 120 |
| 204 | 3300006195 | Ga0075366_10160940 | Ga0075366_101609402 | 120 |
| 205 | 3300006353 | Ga0075370_10000529 | Ga0075370_1000052913 | 120 |
| 206 | 3300006353 | Ga0075370_10047646 | Ga0075370_100476462 | 120 |
| 207 | 3300006881 | Ga0068865_100420932 | Ga0068865_1004209322 | 120 |
| 208 | 3300009098 | Ga0105245_10248436 | Ga0105245_102484362 | 120 |
| 209 | 3300009177 | Ga0105248_11293873 | Ga0105248_112938733 | 120 |
| 210 | 3300013308 | Ga0157375_10404647 | Ga0157375_104046472 | 120 |
| 211 | 3300025258 | Ga0209129_1008294 | Ga0209129_10082943 | 120 |
| 212 | 3300025273 | Ga0209673_1009687 | Ga0209673_10096873 | 120 |
| 213 | 3300025297 | Ga0209758_1000124 | Ga0209758_100012427 | 120 |
| 214 | 3300025298 | Ga0209050_1000691 | Ga0209050_100069135 | 120 |
| 215 | 3300025298 | Ga0209050_1000718 | Ga0209050_100071826 | 120 |
| 216 | 3300025303 | Ga0209051_1000068 | Ga0209051_100006889 | 120 |
| 217 | 3300025303 | Ga0209051_1018401 | Ga0209051_10184012 | 120 |
| 218 | 3300025304 | Ga0209257_1000146 | Ga0209257_100014663 | 120 |
| 219 | 3300025304 | Ga0209257_1074480 | Ga0209257_10744802 | 120 |
| 220 | 3300025927 | Ga0207687_10150238 | Ga0207687_101502382 | 120 |
| 221 | 3300025941 | Ga0207711_10889109 | Ga0207711_108891092 | 120 |
| 222 | 3300025986 | Ga0207658_10001735 | Ga0207658_1000173510 | 120 |
| 223 | 3300027717 | Ga0209998_10102876 | Ga0209998_101028762 | 120 |
| 224 | 3300027876 | Ga0209974_10000422 | Ga0209974_100004227 | 120 |
| 225 | 3300028379 | Ga0268266_10288785 | Ga0268266_102887852 | 120 |
| 226 | 3300028786 | Ga0307517_10156412 | Ga0307517_101564122 | 120 |
| 227 | 3300028794 | Ga0307515_10000138 | Ga0307515_1000013823 | 120 |
| 228 | 3300028794 | Ga0307515_10001206 | Ga0307515_1000120645 | 120 |
| 229 | 3300028794 | Ga0307515_10036745 | Ga0307515_100367457 | 120 |
| 230 | 3300030522 | Ga0307512_10150391 | Ga0307512_101503911 | 120 |
| 231 | 3300031456 | Ga0307513_10019744 | Ga0307513_100197447 | 120 |
| 232 | 3300031456 | Ga0307513_10163720 | Ga0307513_101637201 | 120 |
| 233 | 3300031456 | Ga0307513_10833155 | Ga0307513_108331552 | 120 |
| 234 | 3300031507 | Ga0307509_10426944 | Ga0307509_104269441 | 120 |
| 235 | 3300031616 | Ga0307508_10000216 | Ga0307508_1000021634 | 120 |
| 236 | 3300031649 | Ga0307514_10013973 | Ga0307514_100139734 | 120 |
| 237 | 3300031731 | Ga0307405_11724070 | Ga0307405_117240702 | 120 |
| 238 | 3300032002 | Ga0307416_101877855 | Ga0307416_1018778551 | 120 |
| 239 | 3300033179 | Ga0307507_10008058 | Ga0307507_100080587 | 120 |
| 240 | 3300041443 | Ga0451789_0278294 | Ga0451789_0278294_781_1143 | 120 |
| 241 | 3300041451 | Ga0451791_0193244 | Ga0451791_0193244_25_387 | 120 |
| 242 | 3300041452 | Ga0451793_0071570 | Ga0451793_0071570_474_836 | 120 |
| 243 | 3300041453 | Ga0451797_0472492 | Ga0451797_0472492_373_735 | 120 |
| 244 | 3300041456 | Ga0451795_1083069 | Ga0451795_1083069_79_441 | 120 |
| 245 | 3300041456 | Ga0451795_1295643 | Ga0451795_1295643_10_372 | 120 |
| 246 | 3300041456 | Ga0451795_1324251 | Ga0451795_1324251_417_779 | 120 |
| 247 | 3300041458 | Ga0451798_0000695 | Ga0451798_0000695_428_790 | 120 |
| 248 | 3300041459 | Ga0451800_1223580 | Ga0451800_1223580_82_444 | 120 |
| 249 | 3300041463 | Ga0451804_0163100 | Ga0451804_0163100_886_1248 | 120 |
| 250 | 3300041486 | Ga0451807_1897981 | Ga0451807_1897981_122_484 | 120 |
| 251 | 3300041491 | Ga0451833_0219174 | Ga0451833_0219174_17_379 | 120 |
| 252 | 3300041501 | Ga0451845_0296347 | Ga0451845_0296347_24_386 | 120 |
| 253 | 3300041503 | Ga0451847_0611866 | Ga0451847_0611866_362_724 | 120 |
| 254 | 3300044712 | Ga0453684_0004870 | Ga0453684_0004870_24563_24925 | 120 |
| 255 | 3300046460 | Ga0495638_0030769 | Ga0495638_0030769_647_1009 | 120 |
| 256 | 3300046507 | Ga0495606_0385130 | Ga0495606_0385130_246_608 | 120 |
| 257 | 3300046512 | Ga0495610_0382203 | Ga0495610_0382203_104_466 | 120 |
| 258 | 3300046519 | Ga0495632_0009823 | Ga0495632_0009823_777_1139 | 120 |
| 259 | 3300046519 | Ga0495632_0020328 | Ga0495632_0020328_1782_2144 | 120 |
| 260 | 3300046522 | Ga0495643_0047569 | Ga0495643_0047569_752_1171 | 120 |
| 261 | 3300046522 | Ga0495643_0428486 | Ga0495643_0428486_95_457 | 120 |
| 262 | 3300046660 | Ga0495625_0011613 | Ga0495625_0011613_1826_2245 | 120 |
| 263 | 3300047472 | Ga0495686_0470229 | Ga0495686_0470229_186_548 | 120 |
| 264 | 3300047472 | Ga0495686_0596797 | Ga0495686_0596797_44_406 | 120 |
| 265 | 3300048925 | Ga0496122_0290884 | Ga0496122_0290884_185_547 | 120 |
| 266 | 3300049517 | Ga0501294_008890 | Ga0501294_008890_575_937 | 120 |
| 267 | 3300049683 | Ga0501253_050062 | Ga0501253_050062_277_639 | 120 |
| 268 | 3300049703 | Ga0501219_009075 | Ga0501219_009075_356_718 | 120 |
| 269 | 3300050489 | nmdc:mga03683_397397_c1 | nmdc:mga03683_397397_c1_177_596 | 120 |
| 270 | 3300050489 | nmdc:mga03683_50838_c1 | nmdc:mga03683_50838_c1_882_1244 | 120 |
| 271 | 3300050489 | nmdc:mga03683_515351_c1 | nmdc:mga03683_515351_c1_27_446 | 120 |
| 272 | 3300050490 | nmdc:mga03n38_227170_c1 | nmdc:mga03n38_227170_c1_219_638 | 120 |
| 273 | 3300050490 | nmdc:mga03n38_48485_c1 | nmdc:mga03n38_48485_c1_395_757 | 120 |
| 274 | 3300050493 | nmdc:mga0k408_116510_c1 | nmdc:mga0k408_116510_c1_506_925 | 120 |
| 275 | 3300050493 | nmdc:mga0k408_179492_c1 | nmdc:mga0k408_179492_c1_100_519 | 120 |
| 276 | 3300050493 | nmdc:mga0k408_19948_c1 | nmdc:mga0k408_19948_c1_1813_2232 | 120 |
| 277 | 3300050493 | nmdc:mga0k408_33310_c1 | nmdc:mga0k408_33310_c1_1608_1970 | 120 |
| 278 | 3300050493 | nmdc:mga0k408_441807_c1 | nmdc:mga0k408_441807_c1_60_479 | 120 |
| 279 | 3300050493 | nmdc:mga0k408_631246_c1 | nmdc:mga0k408_631246_c1_60_479 | 120 |
| 280 | 3300050493 | nmdc:mga0k408_737997_c1 | nmdc:mga0k408_737997_c1_98_517 | 120 |
| 281 | 3300050493 | nmdc:mga0k408_9723_c1 | nmdc:mga0k408_9723_c1_2493_2912 | 120 |
| 282 | 3300050494 | nmdc:mga06z11_159049_c1 | nmdc:mga06z11_159049_c1_283_645 | 120 |
| 283 | 3300050494 | nmdc:mga06z11_262468_c1 | nmdc:mga06z11_262468_c1_446_865 | 120 |
| 284 | 3300050494 | nmdc:mga06z11_415817_c1 | nmdc:mga06z11_415817_c1_292_711 | 120 |
| 285 | 3300050496 | nmdc:mga07m45_199264_c1 | nmdc:mga07m45_199264_c1_584_1003 | 120 |
| 286 | 3300050496 | nmdc:mga07m45_29370_c1 | nmdc:mga07m45_29370_c1_845_1264 | 120 |
| 287 | 3300050496 | nmdc:mga07m45_55760_c1 | nmdc:mga07m45_55760_c1_96_515 | 120 |
| 288 | 3300050496 | nmdc:mga07m45_62487_c1 | nmdc:mga07m45_62487_c1_869_1288 | 120 |
| 289 | 3300050496 | nmdc:mga07m45_701988_c1 | nmdc:mga07m45_701988_c1_38_457 | 120 |
| 290 | 3300053086 | Ga0500578_0001754 | Ga0500578_0001754_1699_2061 | 120 |
| 291 | 3300053086 | Ga0500578_0261551 | Ga0500578_0261551_249_611 | 120 |
| 292 | 3300053088 | Ga0500644_0056744 | Ga0500644_0056744_722_1084 | 120 |
| 293 | 3300053090 | Ga0500646_0007985 | Ga0500646_0007985_511_873 | 120 |
| 294 | 3300053092 | Ga0500583_0271180 | Ga0500583_0271180_322_684 | 120 |
| 295 | 3300053092 | Ga0500583_0404072 | Ga0500583_0404072_139_501 | 120 |
| 296 | 3300053096 | Ga0500641_0331366 | Ga0500641_0331366_214_576 | 120 |
| 297 | 3300053098 | Ga0500650_0092196 | Ga0500650_0092196_235_597 | 120 |
| 298 | 3300053108 | Ga0500562_070317 | Ga0500562_070317_452_814 | 120 |
| 299 | 3300053127 | Ga0500623_182260 | Ga0500623_182260_30_392 | 120 |
| 300 | 3300053129 | Ga0500628_166677 | Ga0500628_166677_63_425 | 120 |
| 301 | 3300053130 | Ga0500642_0037802 | Ga0500642_0037802_136_498 | 120 |
| 302 | 3300053131 | Ga0500652_003921 | Ga0500652_003921_3492_3854 | 120 |
| 303 | 3300053133 | Ga0500655_018952 | Ga0500655_018952_202_564 | 120 |
| 304 | 3300053142 | Ga0500577_0016091 | Ga0500577_0016091_1708_2070 | 120 |
| 305 | 3300053143 | Ga0500579_139830 | Ga0500579_139830_32_394 | 120 |
| 306 | 3300053151 | Ga0500604_0156066 | Ga0500604_0156066_30_392 | 120 |
| 307 | 3300053156 | Ga0500622_0000125 | Ga0500622_0000125_75008_75370 | 120 |
| 308 | 3300053156 | Ga0500622_0007470 | Ga0500622_0007470_5760_6122 | 120 |
| 309 | 3300053158 | Ga0500627_0421802 | Ga0500627_0421802_11_373 | 120 |
| 310 | 3300053724 | Ga0500570_082175 | Ga0500570_082175_886_1248 | 120 |
| 311 | 3300053726 | Ga0500584_115855 | Ga0500584_115855_635_997 | 120 |
| 312 | 3300053739 | Ga0500587_000033 | Ga0500587_000033_12654_13016 | 120 |
| 313 | iso_pu_bacteria | 2585428057 | 2587725265 | 120 |
| 314 | 3300001979 | JGI24740J21852_10000651 | JGI24740J21852_100006514 | 121 |
| 315 | 3300003316 | rootH1_10058709 | rootH1_100587092 | 121 |
| 316 | 3300003322 | rootL2_10089280 | rootL2_100892802 | 121 |
| 317 | 3300006186 | Ga0075369_10041137 | Ga0075369_100411372 | 121 |
| 318 | 3300031507 | Ga0307509_10583248 | Ga0307509_105832482 | 121 |
| 319 | 3300046471 | Ga0495650_0138489 | Ga0495650_0138489_278_646 | 121 |
| 320 | 3300050516 | nmdc:mga0sz30_381912_c1 | nmdc:mga0sz30_381912_c1_225_590 | 121 |
| 321 | 3300053154 | Ga0500619_000006 | Ga0500619_000006_38740_39108 | 121 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ew4-assembly1.cif.gz_A | crystal structure of escherichia coli cyay protein reveals a novel fold for the frataxin family | 0.9396 | 10 | 116 |
| 4jpd-assembly1.cif.gz_A | the structure of cyay from burkholderia cenocepacia | 0.9285 | 9 | 118 |
| 1ew4-assembly1.cif.gz_A | crystal structure of escherichia coli cyay protein reveals a novel fold for the frataxin family | 0.9228 | 10 | 116 |
| 4jpd-assembly1.cif.gz_A | the structure of cyay from burkholderia cenocepacia | 0.9204 | 9 | 118 |
| 4hs5-assembly2.cif.gz_B | frataxin from psychromonas ingrahamii as a model to study stability modulation within cyay protein family | 0.9202 | 10 | 116 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2p1xA00 | Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY | 0.9384 | 10 | 116 | 3.30.920.10 |
| 4jpdA00 | Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY | 0.9285 | 9 | 118 | 3.30.920.10 |
| 2p1xA00 | Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY | 0.9216 | 10 | 116 | 3.30.920.10 |
| 4jpdA00 | Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY | 0.9204 | 9 | 118 | 3.30.920.10 |
| af_Q54C45_74_193_3.30.920.10 | Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY | 0.8937 | 7 | 113 | 3.30.920.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V1UF61-F1-model_v4 | Iron-sulfur cluster assembly protein CyaY | 0.9836 | 10 | 116 |
GO:0005829
GO:0008198 GO:0008199 GO:0016226 |
| AF-A0A0G3BI29-F1-model_v4 | Iron-sulfur cluster assembly protein CyaY | 0.9752 | 6 | 118 |
GO:0005829
GO:0008198 GO:0008199 GO:0016226 |
| AF-A0A4V1UF61-F1-model_v4 | Iron-sulfur cluster assembly protein CyaY | 0.9745 | 10 | 116 |
GO:0005829
GO:0008198 GO:0008199 GO:0016226 |
| AF-A0A257LQS6-F1-model_v4 | Iron-sulfur cluster assembly protein CyaY | 0.9702 | 10 | 119 |
GO:0005737
GO:0008199 GO:0016226 |
| AF-A0A3N7CCP5-F1-model_v4 | Iron-sulfur cluster assembly protein CyaY | 0.9677 | 6 | 119 |
GO:0005737
GO:0008199 GO:0016226 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar