F405884

General Info

Members Datasets Scaffolds Average Seq Length
321 157 642 198

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100029514|Ga0070665_1000295142
Length 212
Sequence MPKPFVIGLTGSIGMGKSETAKLFAAEGVPVHDADAVIAQLYGKGGAAVDIVAREFPGAVKDGVVDRGALSAAVTNNPAALKKLENLVHPLVAAERDGFLETTTAPIILFDIPLLFETGADADVNAIVVVSAPEAVQRARVLSRPGMTAEKFDALKSRQLDDAQKRQQAHYVVITDKGLEHAREQVKMILADIRAKLPAFARAKAAKENPHA

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
109 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
116 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
124 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
125 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
151 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
152 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
153 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
154 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
155 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.74
Nodule 0
Rhizoplane 0.31
Rhizosphere 94.39
Stem 0
Stem Tuber 0
Unclassified 5.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100029514 3300005548 Bacteria 5520
2 JGI25165J46597_1000035 3300003214 Bacteria 290723
3 JGI25153J46596_10000400 3300003215 Bacteria 29140
4 Ga0070658_10026178 3300005327 Bacteria 4679
5 Ga0070658_10121667 3300005327 Bacteria 2169
6 Ga0070683_100277401 3300005329 Bacteria 1595
7 Ga0070690_100173892 3300005330 Bacteria 1484
8 Ga0070670_100244034 3300005331 Bacteria 1564
9 Ga0070670_100314686 3300005331 Bacteria 1371
10 Ga0070677_10258349 3300005333 Bacteria 868
11 Ga0068869_100190397 3300005334 Unclassified 1613
12 Ga0070666_10025750 3300005335 Bacteria 3837
13 Ga0070680_100337688 3300005336 Bacteria 1280
14 Ga0070682_100561517 3300005337 Bacteria 895
15 Ga0068868_100030938 3300005338 Bacteria 4107
16 Ga0070660_100527630 3300005339 Bacteria 984
17 Ga0070661_100330274 3300005344 Bacteria 1193
18 Ga0070671_100182056 3300005355 Unclassified 1779
19 Ga0070671_100426146 3300005355 Bacteria 1137
20 Ga0070673_100139574 3300005364 Bacteria 2043
21 Ga0070688_100282080 3300005365 Bacteria 1194
22 Ga0070659_100273107 3300005366 Bacteria 1405
23 Ga0070667_100038420 3300005367 Bacteria 4013
24 Ga0070667_100292653 3300005367 Bacteria 1465
25 Ga0070711_100075432 3300005439 Bacteria 2388
26 Ga0070681_10091408 3300005458 Bacteria 2994
27 Ga0070681_10175321 3300005458 Bacteria 2066
28 Ga0070679_100006583 3300005530 Bacteria 10825
29 Ga0070679_100009794 3300005530 Bacteria 9065
30 Ga0070679_100364404 3300005530 Bacteria 1392
31 Ga0068853_100194654 3300005539 Bacteria 1843
32 Ga0068853_100600821 3300005539 Bacteria 1045
33 Ga0070672_100564732 3300005543 Bacteria 989
34 Ga0070693_100383616 3300005547 Bacteria 970
35 Ga0070665_100001302 3300005548 Bacteria 29816
36 Ga0070665_100129073 3300005548 Bacteria 2530
37 Ga0070665_100323916 3300005548 Bacteria 1545
38 Ga0070665_100329415 3300005548 Bacteria 1531
39 Ga0070665_100368349 3300005548 Bacteria 1443
40 Ga0070665_100468239 3300005548 Bacteria 1270
41 Ga0068855_100060220 3300005563 Bacteria 4441
42 Ga0068855_100072950 3300005563 Bacteria 3989
43 Ga0068855_100092930 3300005563 Bacteria 3479
44 Ga0068855_100118411 3300005563 Bacteria 3033
45 Ga0068855_100157429 3300005563 Bacteria 2580
46 Ga0068855_100270191 3300005563 Bacteria 1891
47 Ga0068855_100886188 3300005563 Bacteria 943
48 Ga0070664_100938366 3300005564 Bacteria 812
49 Ga0068857_100154755 3300005577 Bacteria 2079
50 Ga0068857_100338534 3300005577 Bacteria 1392
51 Ga0068857_100398313 3300005577 Bacteria 1281
52 Ga0068856_100259924 3300005614 Bacteria 1751
53 Ga0068852_101328299 3300005616 Bacteria 741
54 Ga0068861_100081000 3300005719 Bacteria 2541
55 Ga0068863_100570395 3300005841 Bacteria 1118
56 Ga0068858_100024622 3300005842 Bacteria 5608
57 Ga0068860_100040788 3300005843 Bacteria 4435
58 Ga0097621_100013492 3300006237 Bacteria 6091
59 Ga0097621_100069705 3300006237 Unclassified 2903
60 Ga0097621_100182972 3300006237 Bacteria 1811
61 Ga0068871_100014898 3300006358 Bacteria 5811
62 Ga0068871_100097983 3300006358 Bacteria 2452
63 Ga0068871_100125698 3300006358 Bacteria 2170
64 Ga0068865_100067787 3300006881 Bacteria 2521
65 Ga0105240_10021361 3300009093 Bacteria 8611
66 Ga0105240_10044536 3300009093 Bacteria 5638
67 Ga0105240_10093480 3300009093 Bacteria 3670
68 Ga0105240_10145714 3300009093 Bacteria 2826
69 Ga0105240_10203164 3300009093 Bacteria 2321
70 Ga0105240_10289803 3300009093 Bacteria 1877
71 Ga0105240_10402715 3300009093 Bacteria 1541
72 Ga0105240_10877867 3300009093 Bacteria 966
73 Ga0105240_10922432 3300009093 Unclassified 938
74 Ga0105245_10003481 3300009098 Bacteria 14084
75 Ga0105245_10047039 3300009098 Bacteria 3857
76 Ga0105245_10545784 3300009098 Bacteria 1181
77 Ga0105247_10309401 3300009101 Bacteria 1099
78 Ga0105241_10139335 3300009174 Bacteria 1973
79 Ga0105241_10203593 3300009174 Bacteria 1655
80 Ga0105241_10315182 3300009174 Bacteria 1347
81 Ga0105241_10661206 3300009174 Bacteria 950
82 Ga0105241_10759400 3300009174 Bacteria 890
83 Ga0105248_10629484 3300009177 Bacteria 1210
84 Ga0105248_10746012 3300009177 Bacteria 1105
85 Ga0105237_10091070 3300009545 Bacteria 3039
86 Ga0105237_10140410 3300009545 Bacteria 2410
87 Ga0105237_10466081 3300009545 Bacteria 1269
88 Ga0105237_10537034 3300009545 Bacteria 1176
89 Ga0105238_10090893 3300009551 Bacteria 3040
90 Ga0105238_10170560 3300009551 Bacteria 2152
91 Ga0105238_10171603 3300009551 Bacteria 2145
92 Ga0105238_10433887 3300009551 Bacteria 1310
93 Ga0105238_10624962 3300009551 Bacteria 1086
94 Ga0105239_10184587 3300010375 Bacteria 2334
95 Ga0105239_10335079 3300010375 Unclassified 1707
96 Ga0105239_10387530 3300010375 Bacteria 1580
97 Ga0105239_10554206 3300010375 Bacteria 1309
98 Ga0105239_10703610 3300010375 Bacteria 1155
99 Ga0105239_11008271 3300010375 Bacteria 957
100 Ga0105246_10020319 3300011119 Bacteria 4258
101 Ga0157370_10025977 3300013104 Bacteria 5788
102 Ga0157370_10063084 3300013104 Bacteria 3512
103 Ga0157370_10258530 3300013104 Bacteria 1609
104 Ga0157369_10402409 3300013105 Bacteria 1420
105 Ga0157369_10458538 3300013105 Bacteria 1320
106 Ga0157374_10076748 3300013296 Bacteria 3160
107 Ga0157374_10332787 3300013296 Unclassified 1506
108 Ga0157374_10663280 3300013296 Bacteria 1055
109 Ga0157378_10232980 3300013297 Bacteria 1756
110 Ga0157378_10754769 3300013297 Bacteria 996
111 Ga0163162_10016765 3300013306 Bacteria 7161
112 Ga0163162_10039415 3300013306 Bacteria 4721
113 Ga0157372_10205533 3300013307 Bacteria 2282
114 Ga0157375_11075436 3300013308 Bacteria 941
115 Ga0157375_11150439 3300013308 Bacteria 909
116 Ga0163163_10000012 3300014325 Bacteria 257369
117 Ga0163163_10146550 3300014325 Bacteria 2405
118 Ga0157379_10017806 3300014968 Bacteria 6258
119 Ga0157379_11155309 3300014968 Bacteria 743
120 Ga0157376_10383388 3300014969 Bacteria 1355
121 Ga0157376_10482426 3300014969 Bacteria 1215
122 Ga0157376_10699633 3300014969 Bacteria 1018
123 Ga0157376_10718034 3300014969 Bacteria 1006
124 Ga0157376_11043538 3300014969 Bacteria 841
125 Ga0163161_10082160 3300017792 Unclassified 2374
126 Ga0209233_1000006 3300025261 Bacteria 1473685
127 Ga0209233_1002462 3300025261 Bacteria 6795
128 Ga0209758_1000008 3300025297 Bacteria 1215263
129 Ga0207645_10386018 3300025907 Unclassified 941
130 Ga0207705_10184182 3300025909 Bacteria 1577
131 Ga0207705_10268009 3300025909 Bacteria 1305
132 Ga0207705_10484082 3300025909 Bacteria 960
133 Ga0207705_10729224 3300025909 Bacteria 770
134 Ga0207654_10132136 3300025911 Unclassified 1581
135 Ga0207654_10200197 3300025911 Bacteria 1314
136 Ga0207707_10745122 3300025912 Bacteria 820
137 Ga0207695_10016956 3300025913 Bacteria 8499
138 Ga0207695_10029594 3300025913 Bacteria 6046
139 Ga0207695_10079383 3300025913 Bacteria 3326
140 Ga0207695_10079746 3300025913 Bacteria 3317
141 Ga0207695_10099239 3300025913 Bacteria 2910
142 Ga0207695_10124728 3300025913 Unclassified 2539
143 Ga0207695_10238784 3300025913 Bacteria 1719
144 Ga0207695_10500860 3300025913 Bacteria 1097
145 Ga0207695_10662037 3300025913 Unclassified 925
146 Ga0207695_11162909 3300025913 Bacteria 652
147 Ga0207671_10345507 3300025914 Bacteria 1179
148 Ga0207663_10049896 3300025916 Bacteria 2599
149 Ga0207660_10018485 3300025917 Bacteria 4646
150 Ga0207657_10041036 3300025919 Bacteria 4095
151 Ga0207657_10110016 3300025919 Bacteria 2276
152 Ga0207649_10075629 3300025920 Unclassified 2165
153 Ga0207652_10056064 3300025921 Bacteria 3392
154 Ga0207694_10269891 3300025924 Bacteria 1395
155 Ga0207694_10339343 3300025924 Bacteria 1242
156 Ga0207687_10058230 3300025927 Bacteria 2717
157 Ga0207687_10106496 3300025927 Bacteria 2073
158 Ga0207700_10031638 3300025928 Bacteria 3762
159 Ga0207644_10377976 3300025931 Unclassified 1155
160 Ga0207644_10693755 3300025931 Bacteria 849
161 Ga0207690_10227298 3300025932 Bacteria 1431
162 Ga0207686_10083684 3300025934 Bacteria 2089
163 Ga0207704_10235947 3300025938 Bacteria 1363
164 Ga0207711_10437304 3300025941 Bacteria 1217
165 Ga0207711_10457331 3300025941 Bacteria 1188
166 Ga0207689_10036584 3300025942 Bacteria 4075
167 Ga0207689_10325579 3300025942 Unclassified 1276
168 Ga0207689_10426359 3300025942 Bacteria 1107
169 Ga0207661_11101440 3300025944 Bacteria 731
170 Ga0207667_10540537 3300025949 Bacteria 1179
171 Ga0207667_11192563 3300025949 Bacteria 741
172 Ga0207651_10070990 3300025960 Bacteria 2466
173 Ga0207712_10348962 3300025961 Bacteria 1229
174 Ga0207677_10027703 3300026023 Bacteria 3574
175 Ga0207677_10719558 3300026023 Bacteria 887
176 Ga0207702_10121661 3300026078 Bacteria 2337
177 Ga0207702_10330086 3300026078 Bacteria 1455
178 Ga0207641_11423898 3300026088 Bacteria 694
179 Ga0207648_10670627 3300026089 Bacteria 959
180 Ga0207676_10234272 3300026095 Unclassified 1643
181 Ga0207676_10439341 3300026095 Bacteria 1228
182 Ga0207674_10017108 3300026116 Bacteria 7915
183 Ga0207674_10068533 3300026116 Bacteria 3570
184 Ga0207674_10194218 3300026116 Bacteria 1979
185 Ga0207683_10012265 3300026121 Bacteria 7315
186 Ga0207683_10052759 3300026121 Bacteria 3564
187 Ga0268266_10000847 3300028379 Bacteria 39858
188 Ga0268266_10093767 3300028379 Bacteria 2634
189 Ga0268266_10097147 3300028379 Bacteria 2590
190 Ga0268266_10110632 3300028379 Bacteria 2433
191 Ga0268266_10113081 3300028379 Bacteria 2407
192 Ga0268266_10180243 3300028379 Bacteria 1923
193 Ga0268266_10374653 3300028379 Bacteria 1341
194 Ga0268266_11081434 3300028379 Bacteria 776
195 Ga0265318_10000842 3300028577 Bacteria 20159
196 Ga0265338_10004163 3300028800 Bacteria 19762
197 Ga0265330_10028396 3300031235 Bacteria 2522
198 Ga0265330_10070551 3300031235 Bacteria 1512
199 Ga0265330_10183040 3300031235 Bacteria 887
200 Ga0265332_10027732 3300031238 Bacteria 2480
201 Ga0265332_10042776 3300031238 Bacteria 1957
202 Ga0265332_10123298 3300031238 Bacteria 1088
203 Ga0265328_10051128 3300031239 Bacteria 1517
204 Ga0265325_10001683 3300031241 Bacteria 15359
205 Ga0265339_10006313 3300031249 Bacteria 7791
206 Ga0265339_10121222 3300031249 Bacteria 1344
207 Ga0265331_10013000 3300031250 Bacteria 4486
208 Ga0265331_10021867 3300031250 Bacteria 3268
209 Ga0265331_10061571 3300031250 Unclassified 1771
210 Ga0265331_10099302 3300031250 Bacteria 1341
211 Ga0265327_10162633 3300031251 Bacteria 1030
212 Ga0265316_10019292 3300031344 Bacteria 5837
213 Ga0265316_10196940 3300031344 Bacteria 1495
214 Ga0265316_10310795 3300031344 Bacteria 1146
215 Ga0307513_10328029 3300031456 Bacteria 1286
216 Ga0265313_10000968 3300031595 Bacteria 28412
217 Ga0265313_10001041 3300031595 Bacteria 26994
218 Ga0265314_10007761 3300031711 Bacteria 9278
219 Ga0265314_10011958 3300031711 Bacteria 7119
220 Ga0265314_10012288 3300031711 Bacteria 6997
221 Ga0265314_10055280 3300031711 Bacteria 2742
222 Ga0265342_10051845 3300031712 Bacteria 2447
223 Ga0265342_10125017 3300031712 Bacteria 1445
224 Ga0307516_10006557 3300031730 Bacteria 13616
225 Ga0307510_10364047 3300033180 Bacteria 894
226 Ga0373934_0187497 3300035086 Bacteria 851
227 Ga0395900_0044159 3300037418 Bacteria 4593
228 Ga0395900_0067681 3300037418 Bacteria 3669
229 Ga0395898_0043248 3300037466 Bacteria 4439
230 Ga0395898_0239299 3300037466 Bacteria 1731
231 Ga0395901_0007907 3300038443 Bacteria 10728
232 Ga0436365_0088878 3300039437 Bacteria 1381
233 Ga0436361_0777345 3300039447 Bacteria 1155
234 Ga0436361_0966023 3300039447 Bacteria 815
235 Ga0451793_0927935 3300041452 Bacteria 2028
236 Ga0466971_0432878 3300044719 Bacteria 644
237 Ga0466957_0152430 3300044842 Bacteria 1496
238 Ga0466967_0301103 3300045976 Bacteria 1543
239 Ga0495627_083418 3300046453 Bacteria 924
240 Ga0495606_0081211 3300046507 Bacteria 2016
241 Ga0495654_0031268 3300046530 Bacteria 2703
242 Ga0495587_0047982 3300046536 Bacteria 2531
243 Ga0495611_0076851 3300046648 Bacteria 1531
244 Ga0495681_0134046 3300047470 Bacteria 1052
245 Ga0496121_0001324 3300048924 Bacteria 42408
246 Ga0501031_0007877 3300049568 Bacteria 6933
247 Ga0501032_0108115 3300049569 Bacteria 1841
248 Ga0501032_0225170 3300049569 Bacteria 1220
249 Ga0501033_0025488 3300049570 Bacteria 4455
250 Ga0501033_0062610 3300049570 Bacteria 2739
251 Ga0501033_0070306 3300049570 Bacteria 2572
252 Ga0501033_0089582 3300049570 Bacteria 2250
253 Ga0501033_0099725 3300049570 Bacteria 2120
254 Ga0501033_0326022 3300049570 Bacteria 1078
255 Ga0501034_0088413 3300049571 Bacteria 3096
256 Ga0501034_0106206 3300049571 Bacteria 2801
257 Ga0501034_0114056 3300049571 Bacteria 2691
258 Ga0501034_0535348 3300049571 Bacteria 1082
259 Ga0501036_0021259 3300049572 Bacteria 5452
260 Ga0501036_0182595 3300049572 Bacteria 1766
261 Ga0501036_0548359 3300049572 Bacteria 961
262 Ga0501037_0002338 3300049573 Bacteria 13695
263 Ga0501037_0126327 3300049573 Bacteria 1836
264 Ga0501038_0103232 3300049574 Bacteria 2371
265 Ga0501038_0111574 3300049574 Bacteria 2265
266 Ga0501038_0135166 3300049574 Bacteria 2021
267 Ga0501038_0195078 3300049574 Bacteria 1628
268 Ga0501038_0593053 3300049574 Unclassified 839
269 Ga0501039_0001379 3300049575 Bacteria 17823
270 Ga0501042_0127801 3300049578 Bacteria 1830
271 Ga0501043_0029545 3300049579 Bacteria 4307
272 Ga0501043_0079279 3300049579 Bacteria 2580
273 Ga0501043_0153345 3300049579 Bacteria 1802
274 Ga0501043_0377357 3300049579 Bacteria 1074
275 Ga0501043_0428446 3300049579 Bacteria 997
276 Ga0501046_0003688 3300049580 Bacteria 14030
277 Ga0501046_0018738 3300049580 Bacteria 5752
278 Ga0501047_0005373 3300049581 Bacteria 12039
279 Ga0501047_0013462 3300049581 Bacteria 7754
280 Ga0501047_0075621 3300049581 Bacteria 3240
281 Ga0501047_0126831 3300049581 Bacteria 2432
282 Ga0501047_0172361 3300049581 Bacteria 2032
283 Ga0501047_0615798 3300049581 Bacteria 906
284 Ga0501048_0056947 3300049582 Bacteria 2772
285 Ga0501048_0553205 3300049582 Bacteria 826
286 Ga0501067_0001970 3300049583 Bacteria 11308
287 Ga0501070_0008382 3300049586 Bacteria 8731
288 Ga0501072_0421198 3300049588 Bacteria 1058
289 Ga0501073_0025294 3300049589 Bacteria 4259
290 Ga0501073_0094208 3300049589 Bacteria 2080
291 Ga0501073_0372767 3300049589 Bacteria 986
292 Ga0501074_0014023 3300049590 Bacteria 5825
293 Ga0501079_0004716 3300049741 Bacteria 10093
294 Ga0501080_0163531 3300049742 Bacteria 2055
295 Ga0501080_0170217 3300049742 Bacteria 2009
296 Ga0501080_0330920 3300049742 Bacteria 1377
297 Ga0501080_0599063 3300049742 Bacteria 978
298 Ga0501083_0081093 3300049744 Bacteria 2151
299 Ga0501083_0295209 3300049744 Bacteria 1054
300 Ga0501035_0006156 3300049822 Bacteria 11294
301 Ga0501035_0034206 3300049822 Bacteria 4619
302 Ga0501035_0051230 3300049822 Bacteria 3697
303 Ga0501044_0002877 3300049823 Bacteria 19588
304 Ga0501044_0044748 3300049823 Bacteria 4591
305 Ga0501044_0052838 3300049823 Bacteria 4183
306 Ga0501044_0059347 3300049823 Bacteria 3919
307 Ga0501044_0095403 3300049823 Bacteria 2997
308 Ga0501044_0135545 3300049823 Bacteria 2453
309 Ga0501044_0290512 3300049823 Bacteria 1566
310 Ga0501044_0415925 3300049823 Bacteria 1255
311 Ga0501044_0486216 3300049823 Bacteria 1137
312 Ga0501045_0018318 3300049824 Bacteria 4980
313 Ga0500595_003834 3300053119 Bacteria 6912
314 Ga0500595_061185 3300053119 Bacteria 1137
315 Ga0500614_013553 3300053123 Bacteria 1793
316 Ga0500559_0102460 3300053136 Bacteria 1320
317 Ga0500568_0236844 3300053139 Bacteria 666
318 Ga0500573_0000067 3300053140 Bacteria 61890
319 Ga0500639_054881 3300053163 Bacteria 2068
320 Ga0501084_0003057 3300054114 Bacteria 13556
321 Ga0501082_0009507 3300060353 Bacteria 8367
322 Ga0070665_100029514
323 JGI25165J46597_1000035
324 JGI25153J46596_10000400
325 Ga0070658_10026178
326 Ga0070658_10121667
327 Ga0070683_100277401
328 Ga0070690_100173892
329 Ga0070670_100244034
330 Ga0070670_100314686
331 Ga0070677_10258349
332 Ga0068869_100190397
333 Ga0070666_10025750
334 Ga0070680_100337688
335 Ga0070682_100561517
336 Ga0068868_100030938
337 Ga0070660_100527630
338 Ga0070661_100330274
339 Ga0070671_100182056
340 Ga0070671_100426146
341 Ga0070673_100139574
342 Ga0070688_100282080
343 Ga0070659_100273107
344 Ga0070667_100038420
345 Ga0070667_100292653
346 Ga0070711_100075432
347 Ga0070681_10091408
348 Ga0070681_10175321
349 Ga0070679_100006583
350 Ga0070679_100009794
351 Ga0070679_100364404
352 Ga0068853_100194654
353 Ga0068853_100600821
354 Ga0070672_100564732
355 Ga0070693_100383616
356 Ga0070665_100001302
357 Ga0070665_100129073
358 Ga0070665_100323916
359 Ga0070665_100329415
360 Ga0070665_100368349
361 Ga0070665_100468239
362 Ga0068855_100060220
363 Ga0068855_100072950
364 Ga0068855_100092930
365 Ga0068855_100118411
366 Ga0068855_100157429
367 Ga0068855_100270191
368 Ga0068855_100886188
369 Ga0070664_100938366
370 Ga0068857_100154755
371 Ga0068857_100338534
372 Ga0068857_100398313
373 Ga0068856_100259924
374 Ga0068852_101328299
375 Ga0068861_100081000
376 Ga0068863_100570395
377 Ga0068858_100024622
378 Ga0068860_100040788
379 Ga0097621_100013492
380 Ga0097621_100069705
381 Ga0097621_100182972
382 Ga0068871_100014898
383 Ga0068871_100097983
384 Ga0068871_100125698
385 Ga0068865_100067787
386 Ga0105240_10021361
387 Ga0105240_10044536
388 Ga0105240_10093480
389 Ga0105240_10145714
390 Ga0105240_10203164
391 Ga0105240_10289803
392 Ga0105240_10402715
393 Ga0105240_10877867
394 Ga0105240_10922432
395 Ga0105245_10003481
396 Ga0105245_10047039
397 Ga0105245_10545784
398 Ga0105247_10309401
399 Ga0105241_10139335
400 Ga0105241_10203593
401 Ga0105241_10315182
402 Ga0105241_10661206
403 Ga0105241_10759400
404 Ga0105248_10629484
405 Ga0105248_10746012
406 Ga0105237_10091070
407 Ga0105237_10140410
408 Ga0105237_10466081
409 Ga0105237_10537034
410 Ga0105238_10090893
411 Ga0105238_10170560
412 Ga0105238_10171603
413 Ga0105238_10433887
414 Ga0105238_10624962
415 Ga0105239_10184587
416 Ga0105239_10335079
417 Ga0105239_10387530
418 Ga0105239_10554206
419 Ga0105239_10703610
420 Ga0105239_11008271
421 Ga0105246_10020319
422 Ga0157370_10025977
423 Ga0157370_10063084
424 Ga0157370_10258530
425 Ga0157369_10402409
426 Ga0157369_10458538
427 Ga0157374_10076748
428 Ga0157374_10332787
429 Ga0157374_10663280
430 Ga0157378_10232980
431 Ga0157378_10754769
432 Ga0163162_10016765
433 Ga0163162_10039415
434 Ga0157372_10205533
435 Ga0157375_11075436
436 Ga0157375_11150439
437 Ga0163163_10000012
438 Ga0163163_10146550
439 Ga0157379_10017806
440 Ga0157379_11155309
441 Ga0157376_10383388
442 Ga0157376_10482426
443 Ga0157376_10699633
444 Ga0157376_10718034
445 Ga0157376_11043538
446 Ga0163161_10082160
447 Ga0209233_1000006
448 Ga0209233_1002462
449 Ga0209758_1000008
450 Ga0207645_10386018
451 Ga0207705_10184182
452 Ga0207705_10268009
453 Ga0207705_10484082
454 Ga0207705_10729224
455 Ga0207654_10132136
456 Ga0207654_10200197
457 Ga0207707_10745122
458 Ga0207695_10016956
459 Ga0207695_10029594
460 Ga0207695_10079383
461 Ga0207695_10079746
462 Ga0207695_10099239
463 Ga0207695_10124728
464 Ga0207695_10238784
465 Ga0207695_10500860
466 Ga0207695_10662037
467 Ga0207695_11162909
468 Ga0207671_10345507
469 Ga0207663_10049896
470 Ga0207660_10018485
471 Ga0207657_10041036
472 Ga0207657_10110016
473 Ga0207649_10075629
474 Ga0207652_10056064
475 Ga0207694_10269891
476 Ga0207694_10339343
477 Ga0207687_10058230
478 Ga0207687_10106496
479 Ga0207700_10031638
480 Ga0207644_10377976
481 Ga0207644_10693755
482 Ga0207690_10227298
483 Ga0207686_10083684
484 Ga0207704_10235947
485 Ga0207711_10437304
486 Ga0207711_10457331
487 Ga0207689_10036584
488 Ga0207689_10325579
489 Ga0207689_10426359
490 Ga0207661_11101440
491 Ga0207667_10540537
492 Ga0207667_11192563
493 Ga0207651_10070990
494 Ga0207712_10348962
495 Ga0207677_10027703
496 Ga0207677_10719558
497 Ga0207702_10121661
498 Ga0207702_10330086
499 Ga0207641_11423898
500 Ga0207648_10670627
501 Ga0207676_10234272
502 Ga0207676_10439341
503 Ga0207674_10017108
504 Ga0207674_10068533
505 Ga0207674_10194218
506 Ga0207683_10012265
507 Ga0207683_10052759
508 Ga0268266_10000847
509 Ga0268266_10093767
510 Ga0268266_10097147
511 Ga0268266_10110632
512 Ga0268266_10113081
513 Ga0268266_10180243
514 Ga0268266_10374653
515 Ga0268266_11081434
516 Ga0265318_10000842
517 Ga0265338_10004163
518 Ga0265330_10028396
519 Ga0265330_10070551
520 Ga0265330_10183040
521 Ga0265332_10027732
522 Ga0265332_10042776
523 Ga0265332_10123298
524 Ga0265328_10051128
525 Ga0265325_10001683
526 Ga0265339_10006313
527 Ga0265339_10121222
528 Ga0265331_10013000
529 Ga0265331_10021867
530 Ga0265331_10061571
531 Ga0265331_10099302
532 Ga0265327_10162633
533 Ga0265316_10019292
534 Ga0265316_10196940
535 Ga0265316_10310795
536 Ga0307513_10328029
537 Ga0265313_10000968
538 Ga0265313_10001041
539 Ga0265314_10007761
540 Ga0265314_10011958
541 Ga0265314_10012288
542 Ga0265314_10055280
543 Ga0265342_10051845
544 Ga0265342_10125017
545 Ga0307516_10006557
546 Ga0307510_10364047
547 Ga0373934_0187497
548 Ga0395900_0044159
549 Ga0395900_0067681
550 Ga0395898_0043248
551 Ga0395898_0239299
552 Ga0395901_0007907
553 Ga0436365_0088878
554 Ga0436361_0777345
555 Ga0436361_0966023
556 Ga0451793_0927935
557 Ga0466971_0432878
558 Ga0466957_0152430
559 Ga0466967_0301103
560 Ga0495627_083418
561 Ga0495606_0081211
562 Ga0495654_0031268
563 Ga0495587_0047982
564 Ga0495611_0076851
565 Ga0495681_0134046
566 Ga0496121_0001324
567 Ga0501031_0007877
568 Ga0501032_0108115
569 Ga0501032_0225170
570 Ga0501033_0025488
571 Ga0501033_0062610
572 Ga0501033_0070306
573 Ga0501033_0089582
574 Ga0501033_0099725
575 Ga0501033_0326022
576 Ga0501034_0088413
577 Ga0501034_0106206
578 Ga0501034_0114056
579 Ga0501034_0535348
580 Ga0501036_0021259
581 Ga0501036_0182595
582 Ga0501036_0548359
583 Ga0501037_0002338
584 Ga0501037_0126327
585 Ga0501038_0103232
586 Ga0501038_0111574
587 Ga0501038_0135166
588 Ga0501038_0195078
589 Ga0501038_0593053
590 Ga0501039_0001379
591 Ga0501042_0127801
592 Ga0501043_0029545
593 Ga0501043_0079279
594 Ga0501043_0153345
595 Ga0501043_0377357
596 Ga0501043_0428446
597 Ga0501046_0003688
598 Ga0501046_0018738
599 Ga0501047_0005373
600 Ga0501047_0013462
601 Ga0501047_0075621
602 Ga0501047_0126831
603 Ga0501047_0172361
604 Ga0501047_0615798
605 Ga0501048_0056947
606 Ga0501048_0553205
607 Ga0501067_0001970
608 Ga0501070_0008382
609 Ga0501072_0421198
610 Ga0501073_0025294
611 Ga0501073_0094208
612 Ga0501073_0372767
613 Ga0501074_0014023
614 Ga0501079_0004716
615 Ga0501080_0163531
616 Ga0501080_0170217
617 Ga0501080_0330920
618 Ga0501080_0599063
619 Ga0501083_0081093
620 Ga0501083_0295209
621 Ga0501035_0006156
622 Ga0501035_0034206
623 Ga0501035_0051230
624 Ga0501044_0002877
625 Ga0501044_0044748
626 Ga0501044_0052838
627 Ga0501044_0059347
628 Ga0501044_0095403
629 Ga0501044_0135545
630 Ga0501044_0290512
631 Ga0501044_0415925
632 Ga0501044_0486216
633 Ga0501045_0018318
634 Ga0500595_003834
635 Ga0500595_061185
636 Ga0500614_013553
637 Ga0500559_0102460
638 Ga0500568_0236844
639 Ga0500573_0000067
640 Ga0500639_054881
641 Ga0501084_0003057
642 Ga0501082_0009507

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01121

CoaE

Dephospho-CoA kinase

5

181

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n3b-assembly1.cif.gz_C crystal structure of dephosphocoenzyme a kinase from escherichia coli 0.9302 5 189
1vhl-assembly2.cif.gz_B crystal structure of dephospho-coa kinase with adenosine-5'-diphosphate 0.9262 5 189
4i1u-assembly1.cif.gz_A apo crystal structure of a dephospho-coa kinase from burkholderia vietnamiensis 0.9175 3 186
2f6r-assembly1.cif.gz_A crystal structure of bifunctional coenzyme a synthase (coa synthase): (18044849) from mus musculus at 1.70 a resolution 0.9055 1 192
1uf9-assembly3.cif.gz_C crystal structure of tt1252 from thermus thermophilus 0.8893 5 189
ID Description Score Start End Superfamily
af_O74414_1_201_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9384 6 188 3.40.50.300
4i1uA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9175 3 186 3.40.50.300
af_Q13057_357_562_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9143 5 192 3.40.50.300
af_P34558_5_214_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9127 2 191 3.40.50.300
2f6rA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9055 1 192 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A363TYU9-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.993 6 191 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A8B3KYQ0-F1-model_v4 Dephospho-CoA kinase 0.9905 9 100 GO:0004140
GO:0005524
GO:0015937
AF-A0A258D3K7-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9897 5 193 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A7W6MRL7-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9859 6 192 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A2E1CVV2-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9854 5 192 GO:0004140
GO:0005524
GO:0005737
GO:0015937

Map