F405785

General Info

Members Datasets Scaffolds Average Seq Length
321 168 642 151

Family's Representative Sequence

Representative Sequence 3300000546|LJNas_1000489|LJNas_10004897
Length 151
Sequence MKLADTIALVLRNKDNSRVLSIGPGQSVFEAIEKMAVEGVGALLVVSEGKLVGILSERDYARKVILKGHSSKETMVREIMTSPVVFVTPRQTVDECMSIMTKHRFRHLPVMGDDDRVIGVISLGDLVKWIISGQAQQIEELEGYITGRYPG

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
78 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
122 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
127 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
134 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.57
Metatranscriptomes 3.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.3
Rhizosphere 94.39
Stem 0
Stem Tuber 0
Unclassified 32.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000489 3300000546 Bacteria 6934
2 Ga0058861_10477821 3300004800 Bacteria 539
3 Ga0058862_12187448 3300004803 Bacteria 526
4 Ga0065715_10297587 3300005293 Unclassified 1049
5 Ga0070658_10164194 3300005327 Bacteria 1864
6 Ga0070658_10396327 3300005327 Bacteria 1185
7 Ga0070683_100488198 3300005329 Bacteria 1176
8 Ga0070680_100055636 3300005336 Unclassified 3234
9 Ga0068868_100031029 3300005338 Bacteria 4101
10 Ga0068868_100031624 3300005338 Bacteria 4068
11 Ga0070660_100026090 3300005339 Bacteria 4350
12 Ga0070671_101272134 3300005355 Unclassified 648
13 Ga0070673_100114858 3300005364 Unclassified 2238
14 Ga0070688_100476859 3300005365 Bacteria 937
15 Ga0070659_100881604 3300005366 Bacteria 781
16 Ga0070659_101040115 3300005366 Bacteria 720
17 Ga0070667_100171267 3300005367 Unclassified 1917
18 Ga0070709_10274024 3300005434 Bacteria 1224
19 Ga0070709_11011806 3300005434 Unclassified 661
20 Ga0070709_11110167 3300005434 Unclassified 633
21 Ga0070714_100032211 3300005435 Bacteria 4375
22 Ga0070714_100266026 3300005435 Bacteria 1589
23 Ga0070714_100657090 3300005435 Bacteria 1009
24 Ga0070714_100738516 3300005435 Unclassified 951
25 Ga0070714_101987659 3300005435 Bacteria 567
26 Ga0070713_100002924 3300005436 Bacteria 11196
27 Ga0070713_100010251 3300005436 Bacteria 6765
28 Ga0070713_100246190 3300005436 Bacteria 1629
29 Ga0070713_100989210 3300005436 Unclassified 811
30 Ga0070713_101216212 3300005436 Unclassified 729
31 Ga0070710_10023222 3300005437 Bacteria 3256
32 Ga0070710_10058020 3300005437 Unclassified 2195
33 Ga0070710_10108001 3300005437 Unclassified 1667
34 Ga0070710_10198878 3300005437 Bacteria 1264
35 Ga0070710_10772859 3300005437 Unclassified 684
36 Ga0070711_100001955 3300005439 Bacteria 11566
37 Ga0070711_100001981 3300005439 Bacteria 11507
38 Ga0070711_100124622 3300005439 Bacteria 1911
39 Ga0070711_100722566 3300005439 Unclassified 840
40 Ga0070711_100940797 3300005439 Bacteria 739
41 Ga0070708_100017328 3300005445 Bacteria 6006
42 Ga0070708_100125566 3300005445 Bacteria 2371
43 Ga0070708_100184732 3300005445 Bacteria 1949
44 Ga0070708_100300293 3300005445 Unclassified 1512
45 Ga0070708_100513255 3300005445 Bacteria 1130
46 Ga0070681_10012331 3300005458 Bacteria 8475
47 Ga0070681_10167227 3300005458 Bacteria 2122
48 Ga0068867_101309739 3300005459 Unclassified 669
49 Ga0070706_100018211 3300005467 Bacteria 6480
50 Ga0070706_100090794 3300005467 Bacteria 2833
51 Ga0070706_100194619 3300005467 Bacteria 1894
52 Ga0070707_100008663 3300005468 Bacteria 9438
53 Ga0070707_100090101 3300005468 Bacteria 2968
54 Ga0070707_100117268 3300005468 Unclassified 2584
55 Ga0070707_100399461 3300005468 Unclassified 1334
56 Ga0070707_100518944 3300005468 Bacteria 1153
57 Ga0070698_100025371 3300005471 Bacteria 6179
58 Ga0070698_100150239 3300005471 Bacteria 2277
59 Ga0070699_100007490 3300005518 Bacteria 9496
60 Ga0070699_100028037 3300005518 Bacteria 4856
61 Ga0070679_100000945 3300005530 Bacteria 25224
62 Ga0070679_100572955 3300005530 Bacteria 1072
63 Ga0070697_100007982 3300005536 Bacteria 8254
64 Ga0070697_100208849 3300005536 Unclassified 1662
65 Ga0068853_100569227 3300005539 Unclassified 1074
66 Ga0070672_100509834 3300005543 Unclassified 1041
67 Ga0070686_100152690 3300005544 Unclassified 1619
68 Ga0070695_100096855 3300005545 Bacteria 1980
69 Ga0068855_100018409 3300005563 Bacteria 8392
70 Ga0068855_100463788 3300005563 Unclassified 1381
71 Ga0068855_100564837 3300005563 Bacteria 1230
72 Ga0068857_100483246 3300005577 Bacteria 1161
73 Ga0068857_100995195 3300005577 Bacteria 807
74 Ga0068856_100070015 3300005614 Bacteria 3469
75 Ga0068856_100324954 3300005614 Unclassified 1556
76 Ga0068852_100086093 3300005616 Bacteria 2800
77 Ga0068852_100791880 3300005616 Bacteria 962
78 Ga0068859_100266870 3300005617 Unclassified 1803
79 Ga0068861_100130257 3300005719 Unclassified 2041
80 Ga0068863_100082167 3300005841 Bacteria 3053
81 Ga0068858_100002594 3300005842 Bacteria 18196
82 Ga0068860_100008431 3300005843 Bacteria 10266
83 Ga0068860_100056508 3300005843 Bacteria 3730
84 Ga0068862_100136947 3300005844 Unclassified 2171
85 Ga0070717_10003700 3300006028 Bacteria 10991
86 Ga0070717_10030037 3300006028 Bacteria 4365
87 Ga0070717_10061477 3300006028 Bacteria 3113
88 Ga0070717_10086559 3300006028 Bacteria 2638
89 Ga0070717_10106576 3300006028 Bacteria 2386
90 Ga0070717_10117842 3300006028 Unclassified 2271
91 Ga0070717_10158302 3300006028 Bacteria 1963
92 Ga0070717_10219937 3300006028 Bacteria 1669
93 Ga0070717_10441637 3300006028 Unclassified 1172
94 Ga0070717_10672002 3300006028 Unclassified 940
95 Ga0070717_11218604 3300006028 Unclassified 685
96 Ga0070715_10075115 3300006163 Unclassified 1520
97 Ga0070715_10613560 3300006163 Bacteria 639
98 Ga0070716_100047880 3300006173 Bacteria 2414
99 Ga0070716_100053638 3300006173 Bacteria 2300
100 Ga0070716_100054483 3300006173 Bacteria 2284
101 Ga0070716_100160322 3300006173 Bacteria 1457
102 Ga0070716_100535751 3300006173 Unclassified 870
103 Ga0070716_100613607 3300006173 Bacteria 820
104 Ga0070712_100000894 3300006175 Bacteria 17873
105 Ga0070712_100001925 3300006175 Bacteria 12700
106 Ga0070712_100245408 3300006175 Bacteria 1428
107 Ga0097621_100110692 3300006237 Unclassified 2320
108 Ga0097621_100434948 3300006237 Unclassified 1180
109 Ga0097621_101016004 3300006237 Unclassified 776
110 Ga0068871_100102309 3300006358 Bacteria 2401
111 Ga0068871_100144481 3300006358 Unclassified 2024
112 Ga0075433_10045807 3300006852 Unclassified 3803
113 Ga0075434_100020420 3300006871 Bacteria 6426
114 Ga0068865_100067538 3300006881 Bacteria 2526
115 Ga0097620_100266869 3300006931 Unclassified 1803
116 Ga0075435_100083346 3300007076 Unclassified 2629
117 Ga0099794_10066349 3300007265 Unclassified 1761
118 Ga0099795_10165625 3300007788 Unclassified 915
119 Ga0105240_10191719 3300009093 Bacteria 2403
120 Ga0105240_10249279 3300009093 Bacteria 2054
121 Ga0105245_10030412 3300009098 Bacteria 4775
122 Ga0105245_10083506 3300009098 Bacteria 2924
123 Ga0105247_10006440 3300009101 Bacteria 7270
124 Ga0105241_10022648 3300009174 Unclassified 4655
125 Ga0105248_10024997 3300009177 Bacteria 6639
126 Ga0105248_10092755 3300009177 Bacteria 3401
127 Ga0105237_10079283 3300009545 Unclassified 3274
128 Ga0105237_10136206 3300009545 Bacteria 2450
129 Ga0105237_10782673 3300009545 Bacteria 961
130 Ga0105238_10021687 3300009551 Bacteria 6544
131 Ga0105238_10103631 3300009551 Unclassified 2826
132 Ga0105238_10493313 3300009551 Unclassified 1225
133 Ga0105249_10387180 3300009553 Unclassified 1425
134 Ga0105239_10006151 3300010375 Bacteria 13968
135 Ga0105239_10540059 3300010375 Unclassified 1327
136 Ga0157371_11009301 3300013102 Bacteria 635
137 Ga0157370_10495256 3300013104 Bacteria 1122
138 Ga0157369_10099906 3300013105 Bacteria 3093
139 Ga0157369_10748385 3300013105 Unclassified 1005
140 Ga0157374_10047552 3300013296 Bacteria 3978
141 Ga0157374_10097436 3300013296 Bacteria 2814
142 Ga0157378_10020553 3300013297 Bacteria 5805
143 Ga0157378_10097109 3300013297 Unclassified 2685
144 Ga0163162_10002614 3300013306 Bacteria 17077
145 Ga0163162_10057264 3300013306 Bacteria 3925
146 Ga0163162_10566628 3300013306 Bacteria 1263
147 Ga0163162_12301755 3300013306 Unclassified 619
148 Ga0157372_10043893 3300013307 Bacteria 4952
149 Ga0157372_10759353 3300013307 Unclassified 1127
150 Ga0163163_10308179 3300014325 Unclassified 1636
151 Ga0157377_10076072 3300014745 Unclassified 1951
152 Ga0157379_10058523 3300014968 Bacteria 3446
153 Ga0157379_10103613 3300014968 Unclassified 2553
154 Ga0157379_10110303 3300014968 Bacteria 2471
155 Ga0157376_10029930 3300014969 Bacteria 4340
156 Ga0157376_10095991 3300014969 Bacteria 2579
157 Ga0157376_10216187 3300014969 Bacteria 1772
158 Ga0163161_10279251 3300017792 Bacteria 1310
159 Ga0206355_1638195 3300020076 Bacteria 721
160 Ga0206352_10238356 3300020078 Bacteria 566
161 Ga0206350_10554491 3300020080 Bacteria 873
162 Ga0206353_10058479 3300020082 Bacteria 634
163 Ga0154015_1410510 3300020610 Bacteria 700
164 Ga0224712_10248384 3300022467 Bacteria 821
165 Ga0224712_10489572 3300022467 Bacteria 593
166 Ga0228598_1001638 3300024227 Bacteria 4891
167 Ga0207692_10031723 3300025898 Bacteria 2533
168 Ga0207692_10056939 3300025898 Unclassified 2007
169 Ga0207692_10169645 3300025898 Bacteria 1264
170 Ga0207642_10177862 3300025899 Bacteria 1157
171 Ga0207710_10018341 3300025900 Unclassified 2975
172 Ga0207647_10002472 3300025904 Bacteria 14007
173 Ga0207685_10044675 3300025905 Unclassified 1676
174 Ga0207699_10257982 3300025906 Bacteria 1204
175 Ga0207699_10346538 3300025906 Unclassified 1048
176 Ga0207699_10349725 3300025906 Unclassified 1043
177 Ga0207699_10366140 3300025906 Unclassified 1020
178 Ga0207699_10663787 3300025906 Bacteria 762
179 Ga0207705_10010468 3300025909 Bacteria 6744
180 Ga0207705_10717416 3300025909 Bacteria 777
181 Ga0207684_10009549 3300025910 Bacteria 8555
182 Ga0207684_10055969 3300025910 Bacteria 3346
183 Ga0207654_10019318 3300025911 Unclassified 3595
184 Ga0207707_10018917 3300025912 Bacteria 6005
185 Ga0207707_10567072 3300025912 Bacteria 963
186 Ga0207695_10037145 3300025913 Bacteria 5257
187 Ga0207695_10320369 3300025913 Unclassified 1440
188 Ga0207693_10000020 3300025915 Bacteria 132847
189 Ga0207693_10026369 3300025915 Bacteria 4599
190 Ga0207693_10250248 3300025915 Bacteria 1391
191 Ga0207693_10296749 3300025915 Bacteria 1266
192 Ga0207693_10372600 3300025915 Unclassified 1117
193 Ga0207663_10012175 3300025916 Bacteria 4642
194 Ga0207663_10090876 3300025916 Bacteria 2025
195 Ga0207663_10132819 3300025916 Bacteria 1723
196 Ga0207660_10050809 3300025917 Bacteria 2945
197 Ga0207657_10002216 3300025919 Bacteria 21083
198 Ga0207657_10025350 3300025919 Bacteria 5469
199 Ga0207649_10645081 3300025920 Bacteria 818
200 Ga0207652_10050651 3300025921 Bacteria 3558
201 Ga0207652_10188595 3300025921 Bacteria 1854
202 Ga0207646_10010340 3300025922 Bacteria 9128
203 Ga0207646_10056808 3300025922 Unclassified 3498
204 Ga0207646_10073299 3300025922 Bacteria 3059
205 Ga0207646_10109428 3300025922 Bacteria 2479
206 Ga0207646_10374852 3300025922 Bacteria 1285
207 Ga0207646_10425713 3300025922 Bacteria 1198
208 Ga0207694_10006117 3300025924 Bacteria 9201
209 Ga0207694_10010209 3300025924 Bacteria 7080
210 Ga0207694_10100152 3300025924 Unclassified 2295
211 Ga0207687_10065025 3300025927 Unclassified 2589
212 Ga0207700_10018121 3300025928 Bacteria 4723
213 Ga0207700_10064123 3300025928 Bacteria 2797
214 Ga0207700_10076331 3300025928 Bacteria 2599
215 Ga0207700_10106293 3300025928 Bacteria 2250
216 Ga0207700_10733434 3300025928 Bacteria 883
217 Ga0207700_11029178 3300025928 Unclassified 737
218 Ga0207700_11603035 3300025928 Unclassified 576
219 Ga0207664_10026951 3300025929 Bacteria 4350
220 Ga0207664_10499910 3300025929 Bacteria 1089
221 Ga0207664_10578381 3300025929 Unclassified 1008
222 Ga0207665_10009851 3300025939 Archaea 6271
223 Ga0207665_10033222 3300025939 Bacteria 3418
224 Ga0207665_10052845 3300025939 Bacteria 2738
225 Ga0207665_10306197 3300025939 Unclassified 1189
226 Ga0207665_10444023 3300025939 Bacteria 994
227 Ga0207711_10061744 3300025941 Unclassified 3231
228 Ga0207689_10002317 3300025942 Bacteria 17842
229 Ga0207661_10661803 3300025944 Bacteria 960
230 Ga0207667_10000056 3300025949 Bacteria 206107
231 Ga0207667_10365038 3300025949 Bacteria 1472
232 Ga0207667_10430386 3300025949 Unclassified 1342
233 Ga0207712_11009067 3300025961 Unclassified 739
234 Ga0207658_11696278 3300025986 Unclassified 577
235 Ga0207677_10036055 3300026023 Bacteria 3219
236 Ga0207677_10224044 3300026023 Bacteria 1510
237 Ga0207639_10602084 3300026041 Unclassified 1014
238 Ga0207702_10107287 3300026078 Bacteria 2476
239 Ga0207702_11529185 3300026078 Unclassified 661
240 Ga0207641_10097258 3300026088 Bacteria 2587
241 Ga0207648_11077405 3300026089 Unclassified 753
242 Ga0207674_10917794 3300026116 Bacteria 844
243 Ga0207675_100236504 3300026118 Unclassified 1764
244 Ga0207698_10614214 3300026142 Bacteria 1073
245 Ga0207698_11278402 3300026142 Bacteria 748
246 Ga0265356_1007331 3300028017 Bacteria 1274
247 Ga0265357_1017901 3300028023 Bacteria 762
248 Ga0268266_11323245 3300028379 Unclassified 696
249 Ga0268265_10140081 3300028380 Unclassified 2024
250 Ga0268264_10045664 3300028381 Bacteria 3638
251 Ga0265323_10063005 3300028653 Bacteria 1285
252 Ga0265336_10008367 3300028666 Bacteria 3630
253 Ga0265338_10044749 3300028800 Bacteria 4080
254 Ga0265338_10064720 3300028800 Bacteria 3178
255 Ga0265760_10027131 3300031090 Bacteria 1677
256 Ga0265760_10041261 3300031090 Bacteria 1376
257 Ga0265330_10000299 3300031235 Bacteria 35892
258 Ga0265330_10001688 3300031235 Bacteria 12488
259 Ga0265330_10015909 3300031235 Bacteria 3476
260 Ga0265330_10150907 3300031235 Bacteria 987
261 Ga0265320_10069698 3300031240 Bacteria 1659
262 Ga0265325_10000076 3300031241 Bacteria 69316
263 Ga0265325_10000124 3300031241 Bacteria 53002
264 Ga0265325_10013040 3300031241 Bacteria 4739
265 Ga0265325_10051271 3300031241 Bacteria 2122
266 Ga0265329_10010654 3300031242 Bacteria 3365
267 Ga0265340_10237676 3300031247 Unclassified 813
268 Ga0265340_10353562 3300031247 Bacteria 649
269 Ga0265339_10000704 3300031249 Bacteria 25904
270 Ga0265316_10000629 3300031344 Bacteria 39308
271 Ga0265316_10005986 3300031344 Bacteria 11707
272 Ga0265316_10012048 3300031344 Bacteria 7773
273 Ga0265316_10251875 3300031344 Unclassified 1296
274 Ga0265316_10276166 3300031344 Bacteria 1229
275 Ga0265316_10321764 3300031344 Bacteria 1123
276 Ga0265313_10000502 3300031595 Bacteria 41146
277 Ga0265313_10000588 3300031595 Bacteria 37769
278 Ga0265342_10000574 3300031712 Bacteria 38843
279 Ga0265342_10012214 3300031712 Bacteria 5824
280 Ga0265342_10030894 3300031712 Bacteria 3315
281 Ga0265342_10149592 3300031712 Bacteria 1297
282 Ga0316215_1014244 3300033544 Bacteria 795
283 Ga0373943_0030766 3300035170 Unclassified 2543
284 Ga0373955_0114192 3300035172 Unclassified 1564
285 Ga0373935_0188041 3300035692 Unclassified 1421
286 Ga0373947_0974210 3300035725 Unclassified 579
287 Ga0373937_0222749 3300036401 Unclassified 1776
288 Ga0373937_0635015 3300036401 Unclassified 1013
289 Ga0373937_0993748 3300036401 Bacteria 788
290 Ga0373925_0002624 3300037068 Bacteria 14274
291 Ga0373925_0022931 3300037068 Bacteria 4555
292 Ga0395900_0397729 3300037418 Unclassified 1343
293 Ga0395901_0147462 3300038443 Bacteria 2473
294 Ga0495580_0000535 3300046472 Bacteria 32125
295 Ga0495580_0011120 3300046472 Bacteria 6975
296 Ga0495582_0216775 3300046473 Bacteria 1095
297 Ga0495585_0195736 3300046492 Unclassified 1032
298 Ga0495635_0586306 3300046663 Unclassified 729
299 Ga0495658_0022219 3300046683 Bacteria 3352
300 Ga0495600_0392038 3300046809 Unclassified 865
301 Ga0495593_0323308 3300047673 Unclassified 771
302 Ga0496100_0008609 3300048903 Bacteria 5696
303 Ga0496101_0014950 3300048904 Bacteria 5222
304 Ga0496102_0116968 3300048905 Unclassified 2488
305 Ga0496103_0356313 3300048906 Unclassified 940
306 Ga0496104_0660185 3300048907 Unclassified 954
307 Ga0496104_0887264 3300048907 Unclassified 797
308 Ga0496105_0133676 3300048908 Unclassified 2044
309 Ga0496107_0096858 3300048910 Unclassified 2159
310 Ga0496109_0061179 3300048912 Bacteria 3442
311 Ga0496112_0006329 3300048915 Bacteria 10396
312 Ga0496112_0207054 3300048915 Unclassified 1919
313 Ga0496114_0058198 3300048917 Bacteria 3227
314 Ga0496114_0076552 3300048917 Unclassified 2819
315 Ga0496114_0864870 3300048917 Unclassified 785
316 Ga0496114_1494524 3300048917 Unclassified 563
317 Ga0496115_0053688 3300048918 Bacteria 3234
318 Ga0496115_0127377 3300048918 Bacteria 2098
319 nmdc:mga0n895_105998_c1 3300050512 Unclassified 2824
320 nmdc:mga0rr50_94453_c1 3300050513 Bacteria 2335
321 nmdc:mga0a205_5965_c1 3300050515 Bacteria 10978
322 LJNas_1000489
323 Ga0058861_10477821
324 Ga0058862_12187448
325 Ga0065715_10297587
326 Ga0070658_10164194
327 Ga0070658_10396327
328 Ga0070683_100488198
329 Ga0070680_100055636
330 Ga0068868_100031029
331 Ga0068868_100031624
332 Ga0070660_100026090
333 Ga0070671_101272134
334 Ga0070673_100114858
335 Ga0070688_100476859
336 Ga0070659_100881604
337 Ga0070659_101040115
338 Ga0070667_100171267
339 Ga0070709_10274024
340 Ga0070709_11011806
341 Ga0070709_11110167
342 Ga0070714_100032211
343 Ga0070714_100266026
344 Ga0070714_100657090
345 Ga0070714_100738516
346 Ga0070714_101987659
347 Ga0070713_100002924
348 Ga0070713_100010251
349 Ga0070713_100246190
350 Ga0070713_100989210
351 Ga0070713_101216212
352 Ga0070710_10023222
353 Ga0070710_10058020
354 Ga0070710_10108001
355 Ga0070710_10198878
356 Ga0070710_10772859
357 Ga0070711_100001955
358 Ga0070711_100001981
359 Ga0070711_100124622
360 Ga0070711_100722566
361 Ga0070711_100940797
362 Ga0070708_100017328
363 Ga0070708_100125566
364 Ga0070708_100184732
365 Ga0070708_100300293
366 Ga0070708_100513255
367 Ga0070681_10012331
368 Ga0070681_10167227
369 Ga0068867_101309739
370 Ga0070706_100018211
371 Ga0070706_100090794
372 Ga0070706_100194619
373 Ga0070707_100008663
374 Ga0070707_100090101
375 Ga0070707_100117268
376 Ga0070707_100399461
377 Ga0070707_100518944
378 Ga0070698_100025371
379 Ga0070698_100150239
380 Ga0070699_100007490
381 Ga0070699_100028037
382 Ga0070679_100000945
383 Ga0070679_100572955
384 Ga0070697_100007982
385 Ga0070697_100208849
386 Ga0068853_100569227
387 Ga0070672_100509834
388 Ga0070686_100152690
389 Ga0070695_100096855
390 Ga0068855_100018409
391 Ga0068855_100463788
392 Ga0068855_100564837
393 Ga0068857_100483246
394 Ga0068857_100995195
395 Ga0068856_100070015
396 Ga0068856_100324954
397 Ga0068852_100086093
398 Ga0068852_100791880
399 Ga0068859_100266870
400 Ga0068861_100130257
401 Ga0068863_100082167
402 Ga0068858_100002594
403 Ga0068860_100008431
404 Ga0068860_100056508
405 Ga0068862_100136947
406 Ga0070717_10003700
407 Ga0070717_10030037
408 Ga0070717_10061477
409 Ga0070717_10086559
410 Ga0070717_10106576
411 Ga0070717_10117842
412 Ga0070717_10158302
413 Ga0070717_10219937
414 Ga0070717_10441637
415 Ga0070717_10672002
416 Ga0070717_11218604
417 Ga0070715_10075115
418 Ga0070715_10613560
419 Ga0070716_100047880
420 Ga0070716_100053638
421 Ga0070716_100054483
422 Ga0070716_100160322
423 Ga0070716_100535751
424 Ga0070716_100613607
425 Ga0070712_100000894
426 Ga0070712_100001925
427 Ga0070712_100245408
428 Ga0097621_100110692
429 Ga0097621_100434948
430 Ga0097621_101016004
431 Ga0068871_100102309
432 Ga0068871_100144481
433 Ga0075433_10045807
434 Ga0075434_100020420
435 Ga0068865_100067538
436 Ga0097620_100266869
437 Ga0075435_100083346
438 Ga0099794_10066349
439 Ga0099795_10165625
440 Ga0105240_10191719
441 Ga0105240_10249279
442 Ga0105245_10030412
443 Ga0105245_10083506
444 Ga0105247_10006440
445 Ga0105241_10022648
446 Ga0105248_10024997
447 Ga0105248_10092755
448 Ga0105237_10079283
449 Ga0105237_10136206
450 Ga0105237_10782673
451 Ga0105238_10021687
452 Ga0105238_10103631
453 Ga0105238_10493313
454 Ga0105249_10387180
455 Ga0105239_10006151
456 Ga0105239_10540059
457 Ga0157371_11009301
458 Ga0157370_10495256
459 Ga0157369_10099906
460 Ga0157369_10748385
461 Ga0157374_10047552
462 Ga0157374_10097436
463 Ga0157378_10020553
464 Ga0157378_10097109
465 Ga0163162_10002614
466 Ga0163162_10057264
467 Ga0163162_10566628
468 Ga0163162_12301755
469 Ga0157372_10043893
470 Ga0157372_10759353
471 Ga0163163_10308179
472 Ga0157377_10076072
473 Ga0157379_10058523
474 Ga0157379_10103613
475 Ga0157379_10110303
476 Ga0157376_10029930
477 Ga0157376_10095991
478 Ga0157376_10216187
479 Ga0163161_10279251
480 Ga0206355_1638195
481 Ga0206352_10238356
482 Ga0206350_10554491
483 Ga0206353_10058479
484 Ga0154015_1410510
485 Ga0224712_10248384
486 Ga0224712_10489572
487 Ga0228598_1001638
488 Ga0207692_10031723
489 Ga0207692_10056939
490 Ga0207692_10169645
491 Ga0207642_10177862
492 Ga0207710_10018341
493 Ga0207647_10002472
494 Ga0207685_10044675
495 Ga0207699_10257982
496 Ga0207699_10346538
497 Ga0207699_10349725
498 Ga0207699_10366140
499 Ga0207699_10663787
500 Ga0207705_10010468
501 Ga0207705_10717416
502 Ga0207684_10009549
503 Ga0207684_10055969
504 Ga0207654_10019318
505 Ga0207707_10018917
506 Ga0207707_10567072
507 Ga0207695_10037145
508 Ga0207695_10320369
509 Ga0207693_10000020
510 Ga0207693_10026369
511 Ga0207693_10250248
512 Ga0207693_10296749
513 Ga0207693_10372600
514 Ga0207663_10012175
515 Ga0207663_10090876
516 Ga0207663_10132819
517 Ga0207660_10050809
518 Ga0207657_10002216
519 Ga0207657_10025350
520 Ga0207649_10645081
521 Ga0207652_10050651
522 Ga0207652_10188595
523 Ga0207646_10010340
524 Ga0207646_10056808
525 Ga0207646_10073299
526 Ga0207646_10109428
527 Ga0207646_10374852
528 Ga0207646_10425713
529 Ga0207694_10006117
530 Ga0207694_10010209
531 Ga0207694_10100152
532 Ga0207687_10065025
533 Ga0207700_10018121
534 Ga0207700_10064123
535 Ga0207700_10076331
536 Ga0207700_10106293
537 Ga0207700_10733434
538 Ga0207700_11029178
539 Ga0207700_11603035
540 Ga0207664_10026951
541 Ga0207664_10499910
542 Ga0207664_10578381
543 Ga0207665_10009851
544 Ga0207665_10033222
545 Ga0207665_10052845
546 Ga0207665_10306197
547 Ga0207665_10444023
548 Ga0207711_10061744
549 Ga0207689_10002317
550 Ga0207661_10661803
551 Ga0207667_10000056
552 Ga0207667_10365038
553 Ga0207667_10430386
554 Ga0207712_11009067
555 Ga0207658_11696278
556 Ga0207677_10036055
557 Ga0207677_10224044
558 Ga0207639_10602084
559 Ga0207702_10107287
560 Ga0207702_11529185
561 Ga0207641_10097258
562 Ga0207648_11077405
563 Ga0207674_10917794
564 Ga0207675_100236504
565 Ga0207698_10614214
566 Ga0207698_11278402
567 Ga0265356_1007331
568 Ga0265357_1017901
569 Ga0268266_11323245
570 Ga0268265_10140081
571 Ga0268264_10045664
572 Ga0265323_10063005
573 Ga0265336_10008367
574 Ga0265338_10044749
575 Ga0265338_10064720
576 Ga0265760_10027131
577 Ga0265760_10041261
578 Ga0265330_10000299
579 Ga0265330_10001688
580 Ga0265330_10015909
581 Ga0265330_10150907
582 Ga0265320_10069698
583 Ga0265325_10000076
584 Ga0265325_10000124
585 Ga0265325_10013040
586 Ga0265325_10051271
587 Ga0265329_10010654
588 Ga0265340_10237676
589 Ga0265340_10353562
590 Ga0265339_10000704
591 Ga0265316_10000629
592 Ga0265316_10005986
593 Ga0265316_10012048
594 Ga0265316_10251875
595 Ga0265316_10276166
596 Ga0265316_10321764
597 Ga0265313_10000502
598 Ga0265313_10000588
599 Ga0265342_10000574
600 Ga0265342_10012214
601 Ga0265342_10030894
602 Ga0265342_10149592
603 Ga0316215_1014244
604 Ga0373943_0030766
605 Ga0373955_0114192
606 Ga0373935_0188041
607 Ga0373947_0974210
608 Ga0373937_0222749
609 Ga0373937_0635015
610 Ga0373937_0993748
611 Ga0373925_0002624
612 Ga0373925_0022931
613 Ga0395900_0397729
614 Ga0395901_0147462
615 Ga0495580_0000535
616 Ga0495580_0011120
617 Ga0495582_0216775
618 Ga0495585_0195736
619 Ga0495635_0586306
620 Ga0495658_0022219
621 Ga0495600_0392038
622 Ga0495593_0323308
623 Ga0496100_0008609
624 Ga0496101_0014950
625 Ga0496102_0116968
626 Ga0496103_0356313
627 Ga0496104_0660185
628 Ga0496104_0887264
629 Ga0496105_0133676
630 Ga0496107_0096858
631 Ga0496109_0061179
632 Ga0496112_0006329
633 Ga0496112_0207054
634 Ga0496114_0058198
635 Ga0496114_0076552
636 Ga0496114_0864870
637 Ga0496114_1494524
638 Ga0496115_0053688
639 Ga0496115_0127377
640 nmdc:mga0n895_105998_c1
641 nmdc:mga0rr50_94453_c1
642 nmdc:mga0a205_5965_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00571

CBS

CBS domain

76

132

0.96

PF00571

CBS

CBS domain

15

66

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rc3-assembly2.cif.gz_B crystal structure of cbs domain, ne2398 0.9612 5 131
4fry-assembly1.cif.gz_A the structure of a putative signal-transduction protein with cbs domains from burkholderia ambifaria mc40-6 0.9546 6 134
2rc3-assembly1.cif.gz_D crystal structure of cbs domain, ne2398 0.9481 6 131
1pvm-assembly1.cif.gz_A crystal structure of a conserved cbs domain protein ta0289 of unknown function from thermoplasma acidophilum 0.9327 6 128
2rc3-assembly2.cif.gz_B crystal structure of cbs domain, ne2398 0.9319 5 131
ID Description Score Start End Superfamily
af_O13965_237_391_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9644 6 130 3.10.580.10
3oi8B01 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9578 86 126 3.10.580.10
4fryA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9546 6 134 3.10.580.10
2rc3D00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9481 6 131 3.10.580.10
af_A0A1D6Q1S7_52_188_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9475 4 128 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A6N6XKI0-F1-model_v4 deleted 0.9867 6 131
AF-A0A7V7DYX7-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9833 6 135 GO:0016772
AF-A0A7C4BV57-F1-model_v4 CBS domain-containing protein 0.983 6 136
AF-A0A2E8CK91-F1-model_v4 Histidine kinase 0.9785 6 146 GO:0016301
AF-A0A7Y2K6A9-F1-model_v4 CBS domain-containing protein 0.9774 6 128

Map