F405758

General Info

Members Datasets Scaffolds Average Seq Length
320 187 641 164

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2554235005|2554257628
Length 194
Sequence RKIICSRTARSVRLFHVKPLSEKQIRASFVNCSKGDAARLKLPSDFADLPWEDLDFLGWRDPGAPLRAHIVLPPDALPTGPDGSGGPVGVTLRVPERGRTSAVKSSLCRICLTGHASSGVTLFSAPRAGAAGRDGNTVGLYVCSDLACSLYVRGKREPALRTRYEESLSVEERIDRMRAHLLAFVENVRLPSAA

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
14 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
15 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
16 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
19 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
20 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
21 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
22 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
30 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
31 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
32 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
33 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
34 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
35 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
36 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
37 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
38 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
39 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
40 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
41 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
42 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
43 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
44 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
45 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
46 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
47 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
48 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
49 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
50 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
51 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
52 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
53 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
54 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
55 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
56 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
57 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
58 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
59 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
60 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
61 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
62 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
63 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
64 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
65 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
66 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
67 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
68 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
69 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
70 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
71 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
72 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
73 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
74 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
75 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
76 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
77 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
78 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
79 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
80 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
81 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
82 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
83 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
84 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
85 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
86 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
87 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
88 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
89 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
90 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
91 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
92 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
93 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
94 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
95 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
98 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
99 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
100 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
105 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
106 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
107 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
108 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
109 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
110 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
111 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
112 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
130 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
131 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
144 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
145 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
146 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
147 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
148 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
149 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
150 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
151 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
152 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
153 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
154 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
155 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
159 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
160 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
161 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
162 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
163 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
164 2643221670 Streptomyces sp. Root431 Isolate Unclassified
165 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
166 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
167 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
168 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
169 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
170 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
171 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
172 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
173 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
174 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
175 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
176 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
177 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
178 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
179 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
180 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
181 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
182 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
183 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
184 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
185 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
186 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
187 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.25
Metatranscriptomes 0
Isolates 8.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.62
Nodule 0.62
Rhizoplane 1.25
Rhizosphere 79.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10000975 3300003316 Bacteria 12698
2 rootH1_10000975 3300003323 Bacteria 22074
3 rootH2_10012545 3300003320 Bacteria 6065
4 rootL2_10001246 3300003322 Bacteria 9455
5 rootH1_10026342 3300003323 Bacteria 7978
6 rootH1_10084239 3300003323 Bacteria 1521
7 Ga0070683_100449678 3300005329 Bacteria 1229
8 Ga0070698_100576344 3300005471 Bacteria 1065
9 Ga0068853_100040160 3300005539 Bacteria 3991
10 Ga0070695_100541167 3300005545 Bacteria 906
11 Ga0068855_100232018 3300005563 Bacteria 2066
12 Ga0068856_100118950 3300005614 Bacteria 2643
13 Ga0081455_10511033 3300005937 Bacteria 804
14 Ga0075363_100009691 3300006048 Bacteria 4535
15 Ga0070715_10122570 3300006163 Bacteria 1241
16 Ga0075367_10146448 3300006178 Bacteria 1465
17 Ga0075370_10090300 3300006353 Bacteria 1767
18 Ga0105250_10054243 3300009092 Bacteria 1608
19 Ga0105238_11523646 3300009551 Bacteria 698
20 Ga0157376_10700869 3300014969 Bacteria 1017
21 Ga0183367_1016 3300015688 Bacteria 290198
22 Ga0209758_1005552 3300025297 Bacteria 9615
23 Ga0207426_1013270 3300025302 Bacteria 3059
24 Ga0207647_10091661 3300025904 Bacteria 1812
25 Ga0207685_10145700 3300025905 Bacteria 1066
26 Ga0207671_11076945 3300025914 Bacteria 632
27 Ga0207694_10198366 3300025924 Bacteria 1632
28 Ga0207658_11583820 3300025986 Bacteria 599
29 Ga0207639_10147249 3300026041 Bacteria 1969
30 Ga0207702_10091051 3300026078 Bacteria 2670
31 Ga0307517_10070545 3300028786 Bacteria 3146
32 Ga0307515_10000475 3300028794 Bacteria 96024
33 Ga0307515_10152513 3300028794 Bacteria 2406
34 Ga0307511_10003850 3300030521 Bacteria 15354
35 Ga0307511_10158293 3300030521 Bacteria 1279
36 Ga0307512_10087611 3300030522 Bacteria 2191
37 Ga0307512_10292911 3300030522 Bacteria 766
38 Ga0307513_10122999 3300031456 Bacteria 2557
39 Ga0307513_10499873 3300031456 Bacteria 933
40 Ga0307509_10018021 3300031507 Bacteria 8107
41 Ga0307509_10046851 3300031507 Bacteria 4652
42 Ga0307509_10066993 3300031507 Bacteria 3764
43 Ga0307508_10030752 3300031616 Bacteria 4852
44 Ga0307508_10182800 3300031616 Bacteria 1699
45 Ga0307514_10030438 3300031649 Bacteria 4333
46 Ga0307514_10171375 3300031649 Bacteria 1417
47 Ga0307516_10007753 3300031730 Bacteria 12270
48 Ga0307516_10036103 3300031730 Bacteria 4950
49 Ga0307413_11639941 3300031824 Bacteria 572
50 Ga0307410_10207756 3300031852 Bacteria 1499
51 Ga0307416_100654295 3300032002 Bacteria 1136
52 Ga0307416_101351340 3300032002 Bacteria 818
53 Ga0307416_101386581 3300032002 Bacteria 809
54 Ga0307507_10181176 3300033179 Bacteria 1505
55 Ga0307510_10004173 3300033180 Bacteria 16968
56 Ga0307510_10008450 3300033180 Bacteria 12269
57 Ga0307510_10295456 3300033180 Bacteria 1084
58 Ga0395900_0179595 3300037418 Bacteria 2152
59 Ga0395900_0486382 3300037418 Bacteria 1186
60 Ga0395898_0004571 3300037466 Bacteria 15103
61 Ga0395898_0039812 3300037466 Bacteria 4651
62 Ga0395898_0131814 3300037466 Bacteria 2394
63 Ga0395901_0603869 3300038443 Bacteria 1106
64 Ga0439436_0053833 3300041404 Bacteria 1133
65 Ga0439439_0055756 3300041406 Bacteria 1043
66 Ga0451853_1467230 3300041512 Bacteria 4235
67 Ga0439449_0001204 3300042007 Bacteria 10154
68 Ga0439457_041823 3300042014 Bacteria 1021
69 Ga0450894_001833 3300042131 Bacteria 2955
70 Ga0450896_002255 3300042133 Bacteria 2476
71 Ga0450898_004000 3300042134 Bacteria 2153
72 Ga0450899_017597 3300042135 Bacteria 823
73 Ga0439458_0146268 3300042157 Bacteria 631
74 Ga0466969_0025992 3300044656 Bacteria 3005
75 Ga0466972_0000339 3300044658 Bacteria 25923
76 Ga0466972_0007924 3300044658 Bacteria 5328
77 Ga0466972_0179128 3300044658 Bacteria 994
78 Ga0466972_0252105 3300044658 Bacteria 825
79 Ga0466965_0001090 3300044683 Bacteria 10561
80 Ga0466965_0068436 3300044683 Bacteria 1783
81 Ga0466965_0857577 3300044683 Bacteria 528
82 Ga0466966_0021513 3300044684 Bacteria 4235
83 Ga0466966_0194711 3300044684 Bacteria 1227
84 Ga0466961_0001001 3300044693 Bacteria 17438
85 Ga0466963_0007101 3300044694 Bacteria 6672
86 Ga0466963_0018067 3300044694 Bacteria 4401
87 Ga0466963_1089682 3300044694 Bacteria 562
88 Ga0466964_0003016 3300044706 Bacteria 6103
89 Ga0466971_0002225 3300044719 Bacteria 8205
90 Ga0466971_0025794 3300044719 Bacteria 2625
91 Ga0466968_0071325 3300044735 Bacteria 1513
92 Ga0466970_0005998 3300044765 Bacteria 6056
93 Ga0466970_0064358 3300044765 Bacteria 1966
94 Ga0466970_0193916 3300044765 Bacteria 1129
95 Ga0466957_0013562 3300044842 Bacteria 4729
96 Ga0466957_0073458 3300044842 Bacteria 2119
97 Ga0466960_0085237 3300044901 Bacteria 1600
98 Ga0466959_0036387 3300045049 Bacteria 3637
99 Ga0466958_0091750 3300045836 Bacteria 1880
100 Ga0466958_0497659 3300045836 Bacteria 791
101 Ga0466958_0498277 3300045836 Bacteria 790
102 Ga0466967_0004718 3300045976 Bacteria 9265
103 Ga0466967_0048560 3300045976 Bacteria 3707
104 Ga0466967_0072057 3300045976 Bacteria 3095
105 Ga0466967_0376983 3300045976 Bacteria 1377
106 Ga0466967_0502686 3300045976 Bacteria 1190
107 Ga0466967_0745740 3300045976 Bacteria 971
108 Ga0495592_0033438 3300046454 Bacteria 3878
109 Ga0495603_0001155 3300046455 Bacteria 15387
110 Ga0495603_0010543 3300046455 Bacteria 5598
111 Ga0495603_0013275 3300046455 Bacteria 4980
112 Ga0495603_0066176 3300046455 Bacteria 2128
113 Ga0495629_0004632 3300046459 Bacteria 10295
114 Ga0495629_0020683 3300046459 Bacteria 4699
115 Ga0495629_0047702 3300046459 Bacteria 3004
116 Ga0495629_0104160 3300046459 Bacteria 1979
117 Ga0495629_0237806 3300046459 Bacteria 1254
118 Ga0495651_0003386 3300046462 Bacteria 12235
119 Ga0495582_0027754 3300046473 Bacteria 3104
120 Ga0495662_0001887 3300046476 Bacteria 10513
121 Ga0495662_0034877 3300046476 Bacteria 2428
122 Ga0495664_0000456 3300046477 Bacteria 20099
123 Ga0495594_0003622 3300046499 Bacteria 7944
124 Ga0495594_0025496 3300046499 Bacteria 3178
125 Ga0495594_0053630 3300046499 Bacteria 2221
126 Ga0495618_0022473 3300046514 Bacteria 3896
127 Ga0495628_0336308 3300046516 Bacteria 1112
128 Ga0495630_0019354 3300046517 Bacteria 5003
129 Ga0495652_0223551 3300046529 Bacteria 1413
130 Ga0495640_0054624 3300046533 Bacteria 2735
131 Ga0495640_0694229 3300046533 Bacteria 611
132 Ga0495586_0025260 3300046535 Bacteria 3178
133 Ga0495587_0034730 3300046536 Bacteria 3039
134 Ga0495645_0131141 3300046543 Bacteria 1756
135 Ga0495622_0069334 3300046557 Bacteria 1628
136 Ga0495622_0079042 3300046557 Bacteria 1514
137 Ga0495622_0164115 3300046557 Bacteria 1001
138 Ga0495667_0172112 3300046559 Bacteria 1391
139 Ga0495667_0477367 3300046559 Bacteria 782
140 Ga0495634_0061072 3300046642 Bacteria 2506
141 Ga0495625_0021267 3300046660 Bacteria 4997
142 Ga0495625_0365020 3300046660 Bacteria 909
143 Ga0495635_0008035 3300046663 Bacteria 7371
144 Ga0495588_0006219 3300046674 Bacteria 5366
145 Ga0495588_0006946 3300046674 Bacteria 5131
146 Ga0495588_0281986 3300046674 Bacteria 875
147 Ga0495657_0002040 3300046675 Bacteria 17207
148 Ga0495599_0233067 3300046678 Bacteria 1124
149 Ga0495646_0002703 3300046680 Bacteria 10973
150 Ga0495613_0003278 3300046689 Bacteria 12106
151 Ga0495613_0011702 3300046689 Bacteria 6522
152 Ga0495613_0073910 3300046689 Bacteria 2483
153 Ga0495613_0073983 3300046689 Bacteria 2482
154 Ga0495613_0606660 3300046689 Bacteria 728
155 Ga0495671_0013468 3300046692 Bacteria 4427
156 Ga0495589_0032768 3300046794 Bacteria 2612
157 Ga0495589_0405934 3300046794 Bacteria 625
158 Ga0495600_0062503 3300046809 Bacteria 2432
159 Ga0495581_0016532 3300047315 Bacteria 4287
160 Ga0495581_0028215 3300047315 Bacteria 3254
161 Ga0495604_0001051 3300047317 Bacteria 22934
162 Ga0495604_0063916 3300047317 Bacteria 2806
163 Ga0495636_0002778 3300047318 Bacteria 6755
164 Ga0495636_0011988 3300047318 Bacteria 3435
165 Ga0495636_0102798 3300047318 Bacteria 1251
166 Ga0495636_0342656 3300047318 Bacteria 704
167 Ga0495676_0006854 3300047321 Bacteria 10469
168 Ga0495676_0021231 3300047321 Bacteria 5676
169 Ga0495676_0025985 3300047321 Bacteria 5046
170 Ga0495676_0441072 3300047321 Bacteria 860
171 Ga0495687_001618 3300047443 Bacteria 20303
172 Ga0495687_058965 3300047443 Bacteria 1590
173 Ga0495675_0013520 3300047444 Bacteria 5153
174 Ga0495675_0166279 3300047444 Bacteria 1356
175 Ga0495677_0113004 3300047445 Bacteria 1033
176 Ga0495685_039903 3300047447 Bacteria 1606
177 Ga0495685_055023 3300047447 Bacteria 1346
178 Ga0495681_0001639 3300047470 Bacteria 16612
179 Ga0495684_0404097 3300047471 Bacteria 958
180 Ga0495593_0001421 3300047673 Bacteria 14046
181 Ga0495593_0208947 3300047673 Bacteria 980
182 Ga0495602_0005358 3300048088 Bacteria 13463
183 Ga0495614_0011794 3300048089 Bacteria 3842
184 Ga0495614_0016737 3300048089 Bacteria 3189
185 Ga0495614_0026125 3300048089 Bacteria 2516
186 Ga0495614_0364409 3300048089 Bacteria 675
187 Ga0496104_0841560 3300048907 Bacteria 823
188 Ga0496108_0601369 3300048911 Bacteria 958
189 Ga0496109_0399968 3300048912 Bacteria 1297
190 Ga0496109_1473135 3300048912 Bacteria 616
191 Ga0501031_0003406 3300049568 Bacteria 10205
192 Ga0501031_0003582 3300049568 Bacteria 9989
193 Ga0501032_0009715 3300049569 Bacteria 6966
194 Ga0501032_0435009 3300049569 Bacteria 841
195 Ga0501033_0010040 3300049570 Bacteria 7269
196 Ga0501033_0021088 3300049570 Bacteria 4917
197 Ga0501033_0060807 3300049570 Bacteria 2785
198 Ga0501033_0159948 3300049570 Bacteria 1621
199 Ga0501033_0176782 3300049570 Bacteria 1531
200 Ga0501034_0021606 3300049571 Bacteria 6556
201 Ga0501034_0059378 3300049571 Bacteria 3841
202 Ga0501034_0063620 3300049571 Bacteria 3703
203 Ga0501034_0073348 3300049571 Bacteria 3431
204 Ga0501034_0151251 3300049571 Bacteria 2296
205 Ga0501034_0285735 3300049571 Bacteria 1589
206 Ga0501034_0517450 3300049571 Bacteria 1105
207 Ga0501036_0002814 3300049572 Bacteria 13789
208 Ga0501036_0008274 3300049572 Bacteria 8526
209 Ga0501036_0012543 3300049572 Bacteria 7029
210 Ga0501036_0021108 3300049572 Bacteria 5470
211 Ga0501036_0069010 3300049572 Bacteria 2991
212 Ga0501037_0029106 3300049573 Bacteria 4080
213 Ga0501037_0126473 3300049573 Bacteria 1834
214 Ga0501037_0177684 3300049573 Bacteria 1511
215 Ga0501037_0396417 3300049573 Bacteria 947
216 Ga0501037_0481333 3300049573 Bacteria 844
217 Ga0501038_0002328 3300049574 Bacteria 17685
218 Ga0501038_0020076 3300049574 Bacteria 6013
219 Ga0501038_0048583 3300049574 Bacteria 3671
220 Ga0501038_0154281 3300049574 Bacteria 1870
221 Ga0501039_0149329 3300049575 Bacteria 1836
222 Ga0501039_1023065 3300049575 Bacteria 641
223 Ga0501041_0011717 3300049577 Bacteria 5189
224 Ga0501043_0004122 3300049579 Bacteria 11870
225 Ga0501043_0004565 3300049579 Bacteria 11241
226 Ga0501043_0033231 3300049579 Bacteria 4058
227 Ga0501043_0311173 3300049579 Bacteria 1202
228 Ga0501043_0411319 3300049579 Bacteria 1021
229 Ga0501046_0006314 3300049580 Bacteria 10509
230 Ga0501046_0297232 3300049580 Bacteria 1180
231 Ga0501046_0318340 3300049580 Bacteria 1134
232 Ga0501047_0003312 3300049581 Bacteria 15257
233 Ga0501047_0008536 3300049581 Bacteria 9664
234 Ga0501047_0041395 3300049581 Bacteria 4452
235 Ga0501047_0066996 3300049581 Bacteria 3460
236 Ga0501047_0171223 3300049581 Bacteria 2040
237 Ga0501047_0632672 3300049581 Bacteria 890
238 Ga0501048_0040160 3300049582 Bacteria 3353
239 Ga0501067_0020840 3300049583 Bacteria 3627
240 Ga0501068_0005479 3300049584 Bacteria 6952
241 Ga0501069_0122303 3300049585 Bacteria 1487
242 Ga0501070_0012327 3300049586 Bacteria 7214
243 Ga0501070_0222459 3300049586 Bacteria 1547
244 Ga0501070_0326907 3300049586 Bacteria 1247
245 Ga0501070_1095269 3300049586 Bacteria 615
246 Ga0501072_0045411 3300049588 Bacteria 3454
247 Ga0501073_0029469 3300049589 Bacteria 3921
248 Ga0501073_0950372 3300049589 Bacteria 591
249 Ga0501074_0007872 3300049590 Bacteria 7719
250 Ga0501074_0071200 3300049590 Bacteria 2500
251 Ga0501076_0013457 3300049592 Bacteria 6138
252 Ga0501077_0021460 3300049593 Bacteria 4086
253 Ga0501079_0140609 3300049741 Bacteria 1880
254 Ga0501083_0003271 3300049744 Bacteria 11314
255 Ga0501035_0002990 3300049822 Bacteria 16239
256 Ga0501035_0005835 3300049822 Bacteria 11613
257 Ga0501035_0006152 3300049822 Bacteria 11298
258 Ga0501035_0008674 3300049822 Bacteria 9464
259 Ga0501035_0166777 3300049822 Bacteria 1904
260 Ga0501035_0218847 3300049822 Bacteria 1626
261 Ga0501035_0296656 3300049822 Bacteria 1363
262 Ga0501035_0463118 3300049822 Bacteria 1047
263 Ga0501044_0000894 3300049823 Bacteria 36014
264 Ga0501044_0002818 3300049823 Bacteria 19811
265 Ga0501044_0009101 3300049823 Bacteria 10846
266 Ga0501044_0026782 3300049823 Bacteria 6101
267 Ga0501044_0124119 3300049823 Bacteria 2580
268 Ga0501044_0195252 3300049823 Bacteria 1984
269 Ga0501044_0271698 3300049823 Bacteria 1630
270 Ga0501044_0564954 3300049823 Bacteria 1033
271 Ga0501044_1022408 3300049823 Bacteria 698
272 Ga0501045_1032895 3300049824 Bacteria 602
273 nmdc:mga06z11_160319_c1 3300050494 Bacteria 1285
274 Ga0495612_0082722 3300053078 Bacteria 1350
275 Ga0500610_0182272 3300053079 Bacteria 1027
276 Ga0495619_0129699 3300053085 Bacteria 1732
277 Ga0500644_0029624 3300053088 Bacteria 1723
278 Ga0500583_0172710 3300053092 Bacteria 1076
279 Ga0500640_145048 3300053095 Bacteria 914
280 Ga0500650_0102342 3300053098 Bacteria 1340
281 Ga0500560_011157 3300053107 Bacteria 2282
282 Ga0500572_022848 3300053111 Bacteria 1673
283 Ga0500573_0024441 3300053140 Bacteria 3473
284 Ga0500573_0039093 3300053140 Bacteria 2741
285 Ga0500573_0079986 3300053140 Bacteria 1858
286 Ga0500624_014496 3300053157 Bacteria 1193
287 Ga0500634_0320167 3300053161 Bacteria 606
288 Ga0501084_0043254 3300054114 Bacteria 3768
289 Ga0501082_0153513 3300060353 Bacteria 2000
290 Ga0466962_0019136 3300061719 Bacteria 3288
291 Ga0466962_0048932 3300061719 Bacteria 2020
292 Ga0466962_0228924 3300061719 Bacteria 911
293 Ga0530510_0043701 3300061734 Bacteria 3237
294 2554257628 2554235005 Bacteria 6457341
295 2585315089 2582581314 Bacteria 11452267
296 2616906253 2616644941 Bacteria 8510691
297 2643947229 2643221587 Bacteria 7586415
298 2644386454 2643221670 Bacteria 6497041
299 2644433300 2643221677 Bacteria 7584031
300 2785339316 2784746763 Bacteria 9783172
301 2804846085 2802429296 Bacteria 7227771
302 2811843488 2808606982 Bacteria 7791042
303 2862282773 2862281513 Bacteria 9621493
304 2862384537 2862382967 Bacteria 10317375
305 2863410638 2863404153 Bacteria 9672205
306 2884703849 2884693830 Bacteria 11273186
307 2895448795 2895442618 Bacteria 11027144
308 2912728448 2912723979 Bacteria 8557534
309 2912764505 2912757875 Bacteria 7940295
310 2918501849 2918501144 Bacteria 8668083
311 2935390977 2935390628 Bacteria 7043367
312 2990064396 2990059506 Bacteria 9321252
313 2997453602 2997451912 Bacteria 8492419
314 3003007497 3002998708 Bacteria 11715108
315 3006396460 3006393351 Bacteria 6615579
316 3006491180 3006486233 Bacteria 8157040
317 8008564668 8008558824 Bacteria 10610750
318 8025415714 8025413630 Bacteria 7014048
319 8025534983 8025530807 Bacteria 8495698
320 8048411258 8048406513 Bacteria 8936924
321 8056832317 8056829672 Bacteria 9045328
322 rootH1_10000975
323 rootH2_10012545
324 rootL2_10001246
325 rootH1_10026342
326 rootH1_10084239
327 Ga0070683_100449678
328 Ga0070698_100576344
329 Ga0068853_100040160
330 Ga0070695_100541167
331 Ga0068855_100232018
332 Ga0068856_100118950
333 Ga0081455_10511033
334 Ga0075363_100009691
335 Ga0070715_10122570
336 Ga0075367_10146448
337 Ga0075370_10090300
338 Ga0105250_10054243
339 Ga0105238_11523646
340 Ga0157376_10700869
341 Ga0183367_1016
342 Ga0209758_1005552
343 Ga0207426_1013270
344 Ga0207647_10091661
345 Ga0207685_10145700
346 Ga0207671_11076945
347 Ga0207694_10198366
348 Ga0207658_11583820
349 Ga0207639_10147249
350 Ga0207702_10091051
351 Ga0307517_10070545
352 Ga0307515_10000475
353 Ga0307515_10152513
354 Ga0307511_10003850
355 Ga0307511_10158293
356 Ga0307512_10087611
357 Ga0307512_10292911
358 Ga0307513_10122999
359 Ga0307513_10499873
360 Ga0307509_10018021
361 Ga0307509_10046851
362 Ga0307509_10066993
363 Ga0307508_10030752
364 Ga0307508_10182800
365 Ga0307514_10030438
366 Ga0307514_10171375
367 Ga0307516_10007753
368 Ga0307516_10036103
369 Ga0307413_11639941
370 Ga0307410_10207756
371 Ga0307416_100654295
372 Ga0307416_101351340
373 Ga0307416_101386581
374 Ga0307507_10181176
375 Ga0307510_10004173
376 Ga0307510_10008450
377 Ga0307510_10295456
378 Ga0395900_0179595
379 Ga0395900_0486382
380 Ga0395898_0004571
381 Ga0395898_0039812
382 Ga0395898_0131814
383 Ga0395901_0603869
384 Ga0439436_0053833
385 Ga0439439_0055756
386 Ga0451853_1467230
387 Ga0439449_0001204
388 Ga0439457_041823
389 Ga0450894_001833
390 Ga0450896_002255
391 Ga0450898_004000
392 Ga0450899_017597
393 Ga0439458_0146268
394 Ga0466969_0025992
395 Ga0466972_0000339
396 Ga0466972_0007924
397 Ga0466972_0179128
398 Ga0466972_0252105
399 Ga0466965_0001090
400 Ga0466965_0068436
401 Ga0466965_0857577
402 Ga0466966_0021513
403 Ga0466966_0194711
404 Ga0466961_0001001
405 Ga0466963_0007101
406 Ga0466963_0018067
407 Ga0466963_1089682
408 Ga0466964_0003016
409 Ga0466971_0002225
410 Ga0466971_0025794
411 Ga0466968_0071325
412 Ga0466970_0005998
413 Ga0466970_0064358
414 Ga0466970_0193916
415 Ga0466957_0013562
416 Ga0466957_0073458
417 Ga0466960_0085237
418 Ga0466959_0036387
419 Ga0466958_0091750
420 Ga0466958_0497659
421 Ga0466958_0498277
422 Ga0466967_0004718
423 Ga0466967_0048560
424 Ga0466967_0072057
425 Ga0466967_0376983
426 Ga0466967_0502686
427 Ga0466967_0745740
428 Ga0495592_0033438
429 Ga0495603_0001155
430 Ga0495603_0010543
431 Ga0495603_0013275
432 Ga0495603_0066176
433 Ga0495629_0004632
434 Ga0495629_0020683
435 Ga0495629_0047702
436 Ga0495629_0104160
437 Ga0495629_0237806
438 Ga0495651_0003386
439 Ga0495582_0027754
440 Ga0495662_0001887
441 Ga0495662_0034877
442 Ga0495664_0000456
443 Ga0495594_0003622
444 Ga0495594_0025496
445 Ga0495594_0053630
446 Ga0495618_0022473
447 Ga0495628_0336308
448 Ga0495630_0019354
449 Ga0495652_0223551
450 Ga0495640_0054624
451 Ga0495640_0694229
452 Ga0495586_0025260
453 Ga0495587_0034730
454 Ga0495645_0131141
455 Ga0495622_0069334
456 Ga0495622_0079042
457 Ga0495622_0164115
458 Ga0495667_0172112
459 Ga0495667_0477367
460 Ga0495634_0061072
461 Ga0495625_0021267
462 Ga0495625_0365020
463 Ga0495635_0008035
464 Ga0495588_0006219
465 Ga0495588_0006946
466 Ga0495588_0281986
467 Ga0495657_0002040
468 Ga0495599_0233067
469 Ga0495646_0002703
470 Ga0495613_0003278
471 Ga0495613_0011702
472 Ga0495613_0073910
473 Ga0495613_0073983
474 Ga0495613_0606660
475 Ga0495671_0013468
476 Ga0495589_0032768
477 Ga0495589_0405934
478 Ga0495600_0062503
479 Ga0495581_0016532
480 Ga0495581_0028215
481 Ga0495604_0001051
482 Ga0495604_0063916
483 Ga0495636_0002778
484 Ga0495636_0011988
485 Ga0495636_0102798
486 Ga0495636_0342656
487 Ga0495676_0006854
488 Ga0495676_0021231
489 Ga0495676_0025985
490 Ga0495676_0441072
491 Ga0495687_001618
492 Ga0495687_058965
493 Ga0495675_0013520
494 Ga0495675_0166279
495 Ga0495677_0113004
496 Ga0495685_039903
497 Ga0495685_055023
498 Ga0495681_0001639
499 Ga0495684_0404097
500 Ga0495593_0001421
501 Ga0495593_0208947
502 Ga0495602_0005358
503 Ga0495614_0011794
504 Ga0495614_0016737
505 Ga0495614_0026125
506 Ga0495614_0364409
507 Ga0496104_0841560
508 Ga0496108_0601369
509 Ga0496109_0399968
510 Ga0496109_1473135
511 Ga0501031_0003406
512 Ga0501031_0003582
513 Ga0501032_0009715
514 Ga0501032_0435009
515 Ga0501033_0010040
516 Ga0501033_0021088
517 Ga0501033_0060807
518 Ga0501033_0159948
519 Ga0501033_0176782
520 Ga0501034_0021606
521 Ga0501034_0059378
522 Ga0501034_0063620
523 Ga0501034_0073348
524 Ga0501034_0151251
525 Ga0501034_0285735
526 Ga0501034_0517450
527 Ga0501036_0002814
528 Ga0501036_0008274
529 Ga0501036_0012543
530 Ga0501036_0021108
531 Ga0501036_0069010
532 Ga0501037_0029106
533 Ga0501037_0126473
534 Ga0501037_0177684
535 Ga0501037_0396417
536 Ga0501037_0481333
537 Ga0501038_0002328
538 Ga0501038_0020076
539 Ga0501038_0048583
540 Ga0501038_0154281
541 Ga0501039_0149329
542 Ga0501039_1023065
543 Ga0501041_0011717
544 Ga0501043_0004122
545 Ga0501043_0004565
546 Ga0501043_0033231
547 Ga0501043_0311173
548 Ga0501043_0411319
549 Ga0501046_0006314
550 Ga0501046_0297232
551 Ga0501046_0318340
552 Ga0501047_0003312
553 Ga0501047_0008536
554 Ga0501047_0041395
555 Ga0501047_0066996
556 Ga0501047_0171223
557 Ga0501047_0632672
558 Ga0501048_0040160
559 Ga0501067_0020840
560 Ga0501068_0005479
561 Ga0501069_0122303
562 Ga0501070_0012327
563 Ga0501070_0222459
564 Ga0501070_0326907
565 Ga0501070_1095269
566 Ga0501072_0045411
567 Ga0501073_0029469
568 Ga0501073_0950372
569 Ga0501074_0007872
570 Ga0501074_0071200
571 Ga0501076_0013457
572 Ga0501077_0021460
573 Ga0501079_0140609
574 Ga0501083_0003271
575 Ga0501035_0002990
576 Ga0501035_0005835
577 Ga0501035_0006152
578 Ga0501035_0008674
579 Ga0501035_0166777
580 Ga0501035_0218847
581 Ga0501035_0296656
582 Ga0501035_0463118
583 Ga0501044_0000894
584 Ga0501044_0002818
585 Ga0501044_0009101
586 Ga0501044_0026782
587 Ga0501044_0124119
588 Ga0501044_0195252
589 Ga0501044_0271698
590 Ga0501044_0564954
591 Ga0501044_1022408
592 Ga0501045_1032895
593 nmdc:mga06z11_160319_c1
594 Ga0495612_0082722
595 Ga0500610_0182272
596 Ga0495619_0129699
597 Ga0500644_0029624
598 Ga0500583_0172710
599 Ga0500640_145048
600 Ga0500650_0102342
601 Ga0500560_011157
602 Ga0500572_022848
603 Ga0500573_0024441
604 Ga0500573_0039093
605 Ga0500573_0079986
606 Ga0500624_014496
607 Ga0500634_0320167
608 Ga0501084_0043254
609 Ga0501082_0153513
610 Ga0466962_0019136
611 Ga0466962_0048932
612 Ga0466962_0228924
613 Ga0530510_0043701
614 2554257628
615 2585315089
616 2616906253
617 2643947229
618 2644386454
619 2644433300
620 2785339316
621 2804846085
622 2811843488
623 2862282773
624 2862384537
625 2863410638
626 2884703849
627 2895448795
628 2912728448
629 2912764505
630 2918501849
631 2935390977
632 2990064396
633 2997453602
634 3003007497
635 3006396460
636 3006491180
637 8008564668
638 8025415714
639 8025534983
640 8048411258
641 8056832317

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16571

FBP_C

FBP C-terminal treble-clef zinc-finger

24

188

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8atk-assembly1.cif.gz_A the sh2 domain of mouse sh2b1 0.7233 40 71
6bc0-assembly1.cif.gz_A a complex between ph domain of p190rhogef and activated rhoa bound to a gtp analog 0.7054 39 74
6bc1-assembly2.cif.gz_D a complex between ph domain of p190rhogef and activated rac1 bound to a gtp analog 0.6905 37 74
6wu8-assembly1.cif.gz_A structure of human shp2 in complex with inhibitor iacs-13909 0.6874 38 68
7rct-assembly1.cif.gz_B non-receptor protein tyrosine phosphatase shp2 in complex with allosteric inhibitor rmc-4550 0.6847 38 68
ID Description Score Start End Superfamily
af_Q5FVH4_75_223_3.10.110.10 Alpha Beta;Roll;Ubiquitin Conjugating Enzyme;Ubiquitin Conjugating Enzyme 0.8332 39 73 3.10.110.10
af_Q9P7Y9_578_664_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8048 37 68 2.30.29.30
af_Q18940_12_207_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7777 36 66 3.40.50.300
af_Q54J12_385_545_3.10.110.10 Alpha Beta;Roll;Ubiquitin Conjugating Enzyme;Ubiquitin Conjugating Enzyme 0.7681 38 73 3.10.110.10
af_Q7K4V4_11_175_3.10.110.10 Alpha Beta;Roll;Ubiquitin Conjugating Enzyme;Ubiquitin Conjugating Enzyme 0.7174 38 81 3.10.110.10
ID Description Score Start End GO Terms
AF-A0A7W7RX12-F1-model_v4 Elongation factor G-binding protein C-terminal treble-clef zinc-finger domain-containing protein 0.976 1 164
AF-A0A7Y6AC91-F1-model_v4 FBP domain-containing protein 0.9705 1 128
AF-A0A7W7RX12-F1-model_v4 Elongation factor G-binding protein C-terminal treble-clef zinc-finger domain-containing protein 0.9701 1 164
AF-A0A7C9RW42-F1-model_v4 FBP domain-containing protein 0.9698 1 164
AF-A0A4P7IHC1-F1-model_v4 FBP domain-containing protein 0.9698 1 164

Map