F405695
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 320 | 224 | 278 | 216 |
Family's Representative Sequence
| Representative Sequence | 3300047472|Ga0495686_0002808|Ga0495686_0002808_7002_7784 |
| Length | 260 |
| Sequence | MRSNFRRPHAVATPGNPFVARADTARDRDRMMFIEAYTSPGIDNDMTSPKTRILAGISVPDTALVNAAIDFAGRACEPYLFNHVMRSWLFAVRIGELESIAHDAGVVAAGTLLHDITLNDRFVGPRRFEVEAADMARHFATNAGLDDRRVQLIWESVALNSTPSIGLYKEAEVALCTAGICFDVVGLRYNRIPSSDVKAVVDEFPRLGMKRKMTACFCHIAQTHPETTYDNFVRDFGERLVSGYRVPSSVDLVAAAPFDD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 3 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 4 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 5 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 6 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 7 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 8 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 9 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 10 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 11 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 12 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 13 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 14 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 15 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 16 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 17 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 18 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 19 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 20 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 21 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 22 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 23 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 24 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 25 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 26 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 27 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 28 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 29 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 30 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 31 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 32 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 33 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 34 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 35 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 36 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 37 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 38 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 39 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 40 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 41 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 42 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 43 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 44 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 45 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 46 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 47 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 49 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 73 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 97 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 98 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 99 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 125 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 126 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 130 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 131 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 132 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 133 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 134 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 135 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 136 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 137 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 138 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 139 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 140 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 141 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 142 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 143 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 144 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 145 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 146 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 147 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 172 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 173 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 174 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 175 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 176 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 177 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 178 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 179 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 180 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 181 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 182 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 183 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 184 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 185 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 186 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 187 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 188 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 189 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 190 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 195 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 196 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 198 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 200 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 201 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 202 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 203 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 204 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 205 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 206 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 207 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 208 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 209 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 210 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 211 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 212 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 213 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 214 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 215 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 216 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 217 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 218 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 219 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 220 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 221 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 222 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 223 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 224 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.88 |
| Metatranscriptomes | 0 |
| Isolates | 13.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.94 |
| Nodule | 8.44 |
| Rhizoplane | 3.44 |
| Rhizosphere | 56.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25150J39212_1000041 | 3300002774 | Bacteria | 84550 |
| 2 | JGI25151J46595_10000169 | 3300003187 | Bacteria | 84550 |
| 3 | JGI25153J46596_10001520 | 3300003215 | Bacteria | 13826 |
| 4 | JGI25160J50197_1024867 | 3300003354 | Bacteria | 1689 |
| 5 | Ga0055526_1038348 | 3300003771 | Bacteria | 1236 |
| 6 | Ga0055528_1005948 | 3300003790 | Bacteria | 5590 |
| 7 | Ga0068869_100039055 | 3300005334 | Bacteria | 3387 |
| 8 | Ga0070666_10069477 | 3300005335 | Bacteria | 2395 |
| 9 | Ga0068868_100013523 | 3300005338 | Bacteria | 5986 |
| 10 | Ga0068868_100221264 | 3300005338 | Bacteria | 1585 |
| 11 | Ga0070660_100796432 | 3300005339 | Bacteria | 795 |
| 12 | Ga0070661_100018279 | 3300005344 | Bacteria | 4982 |
| 13 | Ga0070661_100256023 | 3300005344 | Bacteria | 1352 |
| 14 | Ga0070668_100057696 | 3300005347 | Bacteria | 3001 |
| 15 | Ga0070668_100230443 | 3300005347 | Bacteria | 1531 |
| 16 | Ga0070671_100166137 | 3300005355 | Bacteria | 1866 |
| 17 | Ga0070673_100124125 | 3300005364 | Bacteria | 2158 |
| 18 | Ga0070673_100232834 | 3300005364 | Unclassified | 1598 |
| 19 | Ga0070659_100092872 | 3300005366 | Bacteria | 2421 |
| 20 | Ga0070667_100001288 | 3300005367 | Bacteria | 22660 |
| 21 | Ga0070663_100443481 | 3300005455 | Bacteria | 1069 |
| 22 | Ga0070663_100737103 | 3300005455 | Bacteria | 840 |
| 23 | Ga0070662_100034279 | 3300005457 | Bacteria | 3579 |
| 24 | Ga0068867_100509752 | 3300005459 | Bacteria | 1035 |
| 25 | Ga0070665_100071373 | 3300005548 | Bacteria | 3479 |
| 26 | Ga0070665_100178524 | 3300005548 | Bacteria | 2124 |
| 27 | Ga0070665_100213392 | 3300005548 | Bacteria | 1931 |
| 28 | Ga0068859_100000068 | 3300005617 | Bacteria | 96701 |
| 29 | Ga0068864_100006278 | 3300005618 | Bacteria | 9748 |
| 30 | Ga0068861_100061569 | 3300005719 | Bacteria | 2881 |
| 31 | Ga0068863_100003596 | 3300005841 | Bacteria | 15299 |
| 32 | Ga0068858_100001079 | 3300005842 | Bacteria | 28254 |
| 33 | Ga0068860_100008023 | 3300005843 | Bacteria | 10529 |
| 34 | Ga0068860_100035646 | 3300005843 | Bacteria | 4770 |
| 35 | Ga0068862_100017665 | 3300005844 | Bacteria | 5938 |
| 36 | Ga0075365_10068475 | 3300006038 | Bacteria | 2385 |
| 37 | Ga0075364_10286889 | 3300006051 | Bacteria | 1120 |
| 38 | Ga0070712_100202800 | 3300006175 | Bacteria | 1559 |
| 39 | Ga0075369_10061214 | 3300006186 | Bacteria | 1643 |
| 40 | Ga0075370_10283496 | 3300006353 | Unclassified | 984 |
| 41 | Ga0068865_100093807 | 3300006881 | Bacteria | 2183 |
| 42 | Ga0097620_100000068 | 3300006931 | Bacteria | 96701 |
| 43 | Ga0075435_100354438 | 3300007076 | Bacteria | 1258 |
| 44 | Ga0105251_10167993 | 3300009011 | Bacteria | 988 |
| 45 | Ga0105250_10045651 | 3300009092 | Bacteria | 1757 |
| 46 | Ga0105240_10366217 | 3300009093 | Bacteria | 1631 |
| 47 | Ga0105240_10672658 | 3300009093 | Bacteria | 1133 |
| 48 | Ga0105247_10052691 | 3300009101 | Bacteria | 2510 |
| 49 | Ga0114129_11763934 | 3300009147 | Bacteria | 754 |
| 50 | Ga0105241_10150803 | 3300009174 | Bacteria | 1902 |
| 51 | Ga0105241_10463908 | 3300009174 | Unclassified | 1123 |
| 52 | Ga0105242_10502527 | 3300009176 | Bacteria | 1153 |
| 53 | Ga0105248_10000071 | 3300009177 | Bacteria | 118281 |
| 54 | Ga0105248_10033819 | 3300009177 | Bacteria | 5712 |
| 55 | Ga0105248_10514276 | 3300009177 | Bacteria | 1350 |
| 56 | Ga0105237_10233818 | 3300009545 | Bacteria | 1839 |
| 57 | Ga0105237_10592329 | 3300009545 | Bacteria | 1116 |
| 58 | Ga0105249_10017282 | 3300009553 | Bacteria | 6403 |
| 59 | Ga0105249_10253546 | 3300009553 | Bacteria | 1745 |
| 60 | Ga0105249_10416475 | 3300009553 | Bacteria | 1376 |
| 61 | Ga0105249_10597975 | 3300009553 | Bacteria | 1157 |
| 62 | Ga0105246_10778124 | 3300011119 | Bacteria | 847 |
| 63 | Ga0157373_10109603 | 3300013100 | Bacteria | 1941 |
| 64 | Ga0157370_10251053 | 3300013104 | Bacteria | 1636 |
| 65 | Ga0157378_10739477 | 3300013297 | Bacteria | 1006 |
| 66 | Ga0163162_10060106 | 3300013306 | Bacteria | 3834 |
| 67 | Ga0163162_10425450 | 3300013306 | Bacteria | 1460 |
| 68 | Ga0157372_10388393 | 3300013307 | Bacteria | 1626 |
| 69 | Ga0163163_10000002 | 3300014325 | Bacteria | 609846 |
| 70 | Ga0163163_10000612 | 3300014325 | Bacteria | 31054 |
| 71 | Ga0157379_10055810 | 3300014968 | Bacteria | 3529 |
| 72 | Ga0157376_10063595 | 3300014969 | Bacteria | 3109 |
| 73 | Ga0213876_10006176 | 3300021384 | Bacteria | 6535 |
| 74 | Ga0228711_1005330 | 3300022739 | Bacteria | 19584 |
| 75 | Ga0228710_1005535 | 3300022740 | Bacteria | 19585 |
| 76 | Ga0207425_1000096 | 3300025245 | Bacteria | 84780 |
| 77 | Ga0209129_1000188 | 3300025258 | Bacteria | 84780 |
| 78 | Ga0209025_1000419 | 3300025294 | Bacteria | 84780 |
| 79 | Ga0209025_1027350 | 3300025294 | Bacteria | 2830 |
| 80 | Ga0209758_1000347 | 3300025297 | Bacteria | 84775 |
| 81 | Ga0209758_1032067 | 3300025297 | Bacteria | 2142 |
| 82 | Ga0209758_1089550 | 3300025297 | Bacteria | 905 |
| 83 | Ga0209758_1102757 | 3300025297 | Bacteria | 808 |
| 84 | Ga0207426_1000638 | 3300025302 | Bacteria | 43881 |
| 85 | Ga0207710_10147551 | 3300025900 | Bacteria | 1139 |
| 86 | Ga0207647_10281294 | 3300025904 | Bacteria | 949 |
| 87 | Ga0207645_10005352 | 3300025907 | Bacteria | 9329 |
| 88 | Ga0207695_10185026 | 3300025913 | Bacteria | 2003 |
| 89 | Ga0207695_10511867 | 3300025913 | Bacteria | 1082 |
| 90 | Ga0207671_10080800 | 3300025914 | Bacteria | 2437 |
| 91 | Ga0207693_10193129 | 3300025915 | Bacteria | 1602 |
| 92 | Ga0207657_10124078 | 3300025919 | Bacteria | 2122 |
| 93 | Ga0207694_10180916 | 3300025924 | Bacteria | 1710 |
| 94 | Ga0207644_10203615 | 3300025931 | Bacteria | 1562 |
| 95 | Ga0207644_10706236 | 3300025931 | Bacteria | 841 |
| 96 | Ga0207704_10047806 | 3300025938 | Bacteria | 2561 |
| 97 | Ga0207704_10783438 | 3300025938 | Bacteria | 795 |
| 98 | Ga0207711_10000046 | 3300025941 | Bacteria | 153238 |
| 99 | Ga0207711_10022598 | 3300025941 | Bacteria | 5262 |
| 100 | Ga0207711_10227050 | 3300025941 | Bacteria | 1709 |
| 101 | Ga0207711_10277798 | 3300025941 | Bacteria | 1542 |
| 102 | Ga0207689_10262456 | 3300025942 | Bacteria | 1429 |
| 103 | Ga0207661_10035264 | 3300025944 | Bacteria | 3897 |
| 104 | Ga0207651_10109332 | 3300025960 | Bacteria | 2071 |
| 105 | Ga0207651_10161998 | 3300025960 | Unclassified | 1755 |
| 106 | Ga0207668_10060165 | 3300025972 | Bacteria | 2665 |
| 107 | Ga0207668_10210968 | 3300025972 | Bacteria | 1553 |
| 108 | Ga0207668_11085322 | 3300025972 | Bacteria | 717 |
| 109 | Ga0207658_10003511 | 3300025986 | Bacteria | 11067 |
| 110 | Ga0207658_10422481 | 3300025986 | Bacteria | 1176 |
| 111 | Ga0207677_10007531 | 3300026023 | Bacteria | 6035 |
| 112 | Ga0207703_10001528 | 3300026035 | Bacteria | 21013 |
| 113 | Ga0207703_10747035 | 3300026035 | Bacteria | 932 |
| 114 | Ga0207641_10000534 | 3300026088 | Bacteria | 42657 |
| 115 | Ga0207676_10000449 | 3300026095 | Bacteria | 34863 |
| 116 | Ga0209281_1001106 | 3300027111 | Bacteria | 19584 |
| 117 | Ga0209282_1000700 | 3300027666 | Bacteria | 16730 |
| 118 | Ga0268266_10037430 | 3300028379 | Bacteria | 4133 |
| 119 | Ga0268266_10670916 | 3300028379 | Bacteria | 998 |
| 120 | Ga0268266_10702825 | 3300028379 | Bacteria | 974 |
| 121 | Ga0268265_10003173 | 3300028380 | Bacteria | 11949 |
| 122 | Ga0268265_10037627 | 3300028380 | Bacteria | 3553 |
| 123 | Ga0268264_10000395 | 3300028381 | Bacteria | 62904 |
| 124 | Ga0268264_10271884 | 3300028381 | Bacteria | 1583 |
| 125 | Ga0307515_10082417 | 3300028794 | Bacteria | 4161 |
| 126 | Ga0307513_10386404 | 3300031456 | Bacteria | 1138 |
| 127 | Ga0307408_100435290 | 3300031548 | Unclassified | 1134 |
| 128 | Ga0307406_10143463 | 3300031901 | Unclassified | 1694 |
| 129 | Ga0307412_10296900 | 3300031911 | Bacteria | 1275 |
| 130 | Ga0315914_1000095 | 3300031967 | Bacteria | 74092 |
| 131 | Ga0307409_100190764 | 3300031995 | Bacteria | 1824 |
| 132 | Ga0307411_10112287 | 3300032005 | Bacteria | 1953 |
| 133 | Ga0315913_1003885 | 3300033430 | Bacteria | 18005 |
| 134 | Ga0315915_1000023 | 3300033464 | Bacteria | 119157 |
| 135 | Ga0395899_0003407 | 3300037312 | Bacteria | 12614 |
| 136 | Ga0395899_0025824 | 3300037312 | Bacteria | 4434 |
| 137 | Ga0395900_0000130 | 3300037418 | Bacteria | 126231 |
| 138 | Ga0395900_0003895 | 3300037418 | Bacteria | 15942 |
| 139 | Ga0395900_0037676 | 3300037418 | Bacteria | 4985 |
| 140 | Ga0395900_0048848 | 3300037418 | Bacteria | 4357 |
| 141 | Ga0395900_0050083 | 3300037418 | Bacteria | 4303 |
| 142 | Ga0395900_0080975 | 3300037418 | Bacteria | 3336 |
| 143 | Ga0395900_0122777 | 3300037418 | Bacteria | 2664 |
| 144 | Ga0395900_0285098 | 3300037418 | Bacteria | 1642 |
| 145 | Ga0395898_0000274 | 3300037466 | Bacteria | 125922 |
| 146 | Ga0395898_0010287 | 3300037466 | Bacteria | 9791 |
| 147 | Ga0395898_0017479 | 3300037466 | Bacteria | 7322 |
| 148 | Ga0395898_0043496 | 3300037466 | Bacteria | 4425 |
| 149 | Ga0395898_0122471 | 3300037466 | Bacteria | 2492 |
| 150 | Ga0395898_0584216 | 3300037466 | Bacteria | 1059 |
| 151 | Ga0395905_0000287 | 3300037471 | Bacteria | 73803 |
| 152 | Ga0395905_0011694 | 3300037471 | Bacteria | 8473 |
| 153 | Ga0395905_0013648 | 3300037471 | Bacteria | 7783 |
| 154 | Ga0395905_0017889 | 3300037471 | Bacteria | 6734 |
| 155 | Ga0395905_0018130 | 3300037471 | Bacteria | 6680 |
| 156 | Ga0395905_0020531 | 3300037471 | Bacteria | 6256 |
| 157 | Ga0395905_0045309 | 3300037471 | Bacteria | 4125 |
| 158 | Ga0395905_0057107 | 3300037471 | Bacteria | 3651 |
| 159 | Ga0395905_0064906 | 3300037471 | Bacteria | 3417 |
| 160 | Ga0395905_0074425 | 3300037471 | Bacteria | 3183 |
| 161 | Ga0395905_0075052 | 3300037471 | Bacteria | 3169 |
| 162 | Ga0395905_0667012 | 3300037471 | Bacteria | 942 |
| 163 | Ga0395905_0698192 | 3300037471 | Unclassified | 917 |
| 164 | Ga0395901_0000613 | 3300038443 | Bacteria | 41465 |
| 165 | Ga0395901_0017657 | 3300038443 | Bacteria | 7284 |
| 166 | Ga0395901_0040376 | 3300038443 | Bacteria | 4832 |
| 167 | Ga0395901_0066177 | 3300038443 | Bacteria | 3764 |
| 168 | Ga0395901_0187072 | 3300038443 | Bacteria | 2172 |
| 169 | Ga0395901_0188288 | 3300038443 | Bacteria | 2164 |
| 170 | Ga0395901_0194745 | 3300038443 | Bacteria | 2125 |
| 171 | Ga0395901_0244012 | 3300038443 | Bacteria | 1872 |
| 172 | Ga0395901_0269952 | 3300038443 | Bacteria | 1769 |
| 173 | Ga0237816_04028 | 3300039145 | Bacteria | 1041 |
| 174 | Ga0436365_0286234 | 3300039437 | Bacteria | 10730 |
| 175 | Ga0466967_0006754 | 3300045976 | Bacteria | 8169 |
| 176 | Ga0495592_0054815 | 3300046454 | Bacteria | 2952 |
| 177 | Ga0495638_0009241 | 3300046460 | Bacteria | 6930 |
| 178 | Ga0495585_0166683 | 3300046492 | Unclassified | 1140 |
| 179 | Ga0495607_0032651 | 3300046501 | Bacteria | 3175 |
| 180 | Ga0495583_0014513 | 3300046506 | Bacteria | 4344 |
| 181 | Ga0495606_0002576 | 3300046507 | Bacteria | 20766 |
| 182 | Ga0495606_0236118 | 3300046507 | Bacteria | 1022 |
| 183 | Ga0495610_0024951 | 3300046512 | Bacteria | 3219 |
| 184 | Ga0495610_0037025 | 3300046512 | Bacteria | 2487 |
| 185 | Ga0495616_0043745 | 3300046513 | Bacteria | 2274 |
| 186 | Ga0495616_0150603 | 3300046513 | Bacteria | 1053 |
| 187 | Ga0495620_0079750 | 3300046515 | Bacteria | 1326 |
| 188 | Ga0495632_0016123 | 3300046519 | Bacteria | 4166 |
| 189 | Ga0495654_0058020 | 3300046530 | Bacteria | 1869 |
| 190 | Ga0495597_0082140 | 3300046542 | Bacteria | 1377 |
| 191 | Ga0495622_0007581 | 3300046557 | Bacteria | 5040 |
| 192 | Ga0495668_0048371 | 3300046616 | Bacteria | 2360 |
| 193 | Ga0495668_0076515 | 3300046616 | Bacteria | 1837 |
| 194 | Ga0495625_0001951 | 3300046660 | Bacteria | 23339 |
| 195 | Ga0495661_0003247 | 3300046665 | Bacteria | 12111 |
| 196 | Ga0495599_0048159 | 3300046678 | Bacteria | 2672 |
| 197 | Ga0495669_0037165 | 3300046684 | Bacteria | 2154 |
| 198 | Ga0495670_0008491 | 3300046691 | Bacteria | 5054 |
| 199 | Ga0495660_0141736 | 3300046810 | Bacteria | 1195 |
| 200 | Ga0495686_0002808 | 3300047472 | Bacteria | 15793 |
| 201 | Ga0495686_0059161 | 3300047472 | Bacteria | 2386 |
| 202 | Ga0495626_0086291 | 3300048091 | Bacteria | 1387 |
| 203 | Ga0496100_0137545 | 3300048903 | Bacteria | 1728 |
| 204 | Ga0496101_0822134 | 3300048904 | Bacteria | 732 |
| 205 | Ga0496102_0221104 | 3300048905 | Bacteria | 1785 |
| 206 | Ga0496103_0208620 | 3300048906 | Bacteria | 1256 |
| 207 | Ga0496104_0003102 | 3300048907 | Bacteria | 14327 |
| 208 | Ga0496105_0025168 | 3300048908 | Bacteria | 4841 |
| 209 | Ga0496106_0012062 | 3300048909 | Bacteria | 6377 |
| 210 | Ga0496110_0710270 | 3300048913 | Bacteria | 907 |
| 211 | Ga0496111_0012129 | 3300048914 | Bacteria | 5829 |
| 212 | Ga0496113_0161664 | 3300048916 | Bacteria | 1770 |
| 213 | Ga0496113_0520364 | 3300048916 | Bacteria | 955 |
| 214 | Ga0496116_0003769 | 3300048919 | Bacteria | 14814 |
| 215 | Ga0496116_0047194 | 3300048919 | Bacteria | 2900 |
| 216 | Ga0496116_0058605 | 3300048919 | Bacteria | 2510 |
| 217 | Ga0496116_0104500 | 3300048919 | Bacteria | 1683 |
| 218 | Ga0496117_0022386 | 3300048920 | Bacteria | 5070 |
| 219 | Ga0496117_0055655 | 3300048920 | Bacteria | 2762 |
| 220 | Ga0496118_0022289 | 3300048921 | Bacteria | 5545 |
| 221 | Ga0496118_0085836 | 3300048921 | Bacteria | 2190 |
| 222 | Ga0496119_0016067 | 3300048922 | Bacteria | 5717 |
| 223 | Ga0496119_0276847 | 3300048922 | Bacteria | 836 |
| 224 | Ga0496120_0050968 | 3300048923 | Bacteria | 2367 |
| 225 | Ga0496121_0012621 | 3300048924 | Bacteria | 9179 |
| 226 | Ga0496121_0069841 | 3300048924 | Bacteria | 2832 |
| 227 | Ga0496121_0092196 | 3300048924 | Bacteria | 2362 |
| 228 | Ga0496121_0442064 | 3300048924 | Bacteria | 840 |
| 229 | Ga0496122_0017842 | 3300048925 | Bacteria | 6599 |
| 230 | Ga0496122_0086625 | 3300048925 | Bacteria | 2155 |
| 231 | Ga0496122_0235968 | 3300048925 | Bacteria | 1035 |
| 232 | Ga0496123_0008314 | 3300048926 | Bacteria | 9553 |
| 233 | Ga0496123_0050095 | 3300048926 | Bacteria | 2793 |
| 234 | Ga0496124_0012785 | 3300048927 | Bacteria | 8249 |
| 235 | Ga0496124_0064318 | 3300048927 | Bacteria | 3063 |
| 236 | Ga0496124_0242245 | 3300048927 | Bacteria | 1340 |
| 237 | Ga0496125_0001558 | 3300048928 | Bacteria | 32726 |
| 238 | Ga0496125_0007272 | 3300048928 | Bacteria | 11793 |
| 239 | Ga0496125_0010637 | 3300048928 | Bacteria | 9289 |
| 240 | Ga0496126_0055302 | 3300048929 | Bacteria | 3591 |
| 241 | Ga0501034_0125472 | 3300049571 | Bacteria | 2552 |
| 242 | Ga0501070_0287418 | 3300049586 | Bacteria | 1341 |
| 243 | Ga0501035_0815011 | 3300049822 | Bacteria | 745 |
| 244 | Ga0501044_0792138 | 3300049823 | Bacteria | 828 |
| 245 | nmdc:mga0yw44_32484_c1 | 3300050492 | Bacteria | 3042 |
| 246 | nmdc:mga07m45_8639_c2 | 3300050496 | Bacteria | 3351 |
| 247 | nmdc:mga0rr50_358041_c1 | 3300050513 | Bacteria | 1228 |
| 248 | nmdc:mga0sz30_36674_c1 | 3300050516 | Bacteria | 2050 |
| 249 | Ga0495601_0061521 | 3300053077 | Bacteria | 2383 |
| 250 | Ga0500578_0218158 | 3300053086 | Bacteria | 1161 |
| 251 | Ga0500643_043995 | 3300053087 | Bacteria | 1300 |
| 252 | Ga0500644_0062840 | 3300053088 | Bacteria | 1314 |
| 253 | Ga0500581_059537 | 3300053089 | Bacteria | 1936 |
| 254 | Ga0500646_0005758 | 3300053090 | Bacteria | 3141 |
| 255 | Ga0500651_0022096 | 3300053093 | Bacteria | 3973 |
| 256 | Ga0500651_0039260 | 3300053093 | Bacteria | 2981 |
| 257 | Ga0500641_0003501 | 3300053096 | Bacteria | 5547 |
| 258 | Ga0500650_0000191 | 3300053098 | Bacteria | 14752 |
| 259 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 260 | Ga0500557_073578 | 3300053105 | Bacteria | 1123 |
| 261 | Ga0500562_005971 | 3300053108 | Bacteria | 3066 |
| 262 | Ga0500593_181516 | 3300053117 | Bacteria | 781 |
| 263 | Ga0500595_001867 | 3300053119 | Bacteria | 10879 |
| 264 | Ga0500642_0000066 | 3300053130 | Bacteria | 56496 |
| 265 | Ga0500652_011088 | 3300053131 | Bacteria | 3113 |
| 266 | Ga0500658_0015671 | 3300053134 | Bacteria | 2817 |
| 267 | Ga0500568_0000404 | 3300053139 | Bacteria | 32949 |
| 268 | Ga0500568_0001092 | 3300053139 | Bacteria | 18246 |
| 269 | Ga0500573_0000002 | 3300053140 | Bacteria | 407088 |
| 270 | Ga0500577_0067327 | 3300053142 | Bacteria | 1395 |
| 271 | Ga0500604_0007517 | 3300053151 | Bacteria | 2885 |
| 272 | Ga0500604_0020914 | 3300053151 | Bacteria | 1846 |
| 273 | Ga0500622_0000102 | 3300053156 | Bacteria | 86452 |
| 274 | Ga0500622_0002408 | 3300053156 | Bacteria | 13519 |
| 275 | Ga0500627_0015145 | 3300053158 | Bacteria | 2972 |
| 276 | Ga0500633_0000131 | 3300053160 | Bacteria | 10118 |
| 277 | Ga0500634_0126973 | 3300053161 | Bacteria | 1231 |
| 278 | Ga0500611_001382 | 3300053727 | Bacteria | 2654 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009011 | Ga0105251_10167993 | Ga0105251_101679932 | 208 |
| 2 | 3300039145 | Ga0237816_04028 | Ga0237816_04028_239_865 | 208 |
| 3 | 3300046506 | Ga0495583_0014513 | Ga0495583_0014513_3577_4206 | 208 |
| 4 | 3300046512 | Ga0495610_0024951 | Ga0495610_0024951_2154_2783 | 208 |
| 5 | 3300046513 | Ga0495616_0150603 | Ga0495616_0150603_250_879 | 208 |
| 6 | 3300048091 | Ga0495626_0086291 | Ga0495626_0086291_667_1296 | 208 |
| 7 | 3300048919 | Ga0496116_0058605 | Ga0496116_0058605_1030_1659 | 208 |
| 8 | 3300048920 | Ga0496117_0022386 | Ga0496117_0022386_2708_3337 | 208 |
| 9 | 3300048921 | Ga0496118_0022289 | Ga0496118_0022289_3442_4071 | 208 |
| 10 | 3300048924 | Ga0496121_0069841 | Ga0496121_0069841_824_1453 | 208 |
| 11 | 3300048925 | Ga0496122_0017842 | Ga0496122_0017842_2471_3100 | 208 |
| 12 | 3300048927 | Ga0496124_0242245 | Ga0496124_0242245_471_1100 | 208 |
| 13 | 3300048928 | Ga0496125_0007272 | Ga0496125_0007272_2780_3409 | 208 |
| 14 | 3300053086 | Ga0500578_0218158 | Ga0500578_0218158_413_1042 | 208 |
| 15 | 3300053156 | Ga0500622_0000102 | Ga0500622_0000102_41405_42034 | 208 |
| 16 | 3300009177 | Ga0105248_10514276 | Ga0105248_105142762 | 210 |
| 17 | 3300048903 | Ga0496100_0137545 | Ga0496100_0137545_520_1155 | 210 |
| 18 | 3300048904 | Ga0496101_0822134 | Ga0496101_0822134_37_672 | 210 |
| 19 | 3300048905 | Ga0496102_0221104 | Ga0496102_0221104_516_1151 | 210 |
| 20 | 3300048906 | Ga0496103_0208620 | Ga0496103_0208620_79_714 | 210 |
| 21 | 3300048907 | Ga0496104_0003102 | Ga0496104_0003102_6581_7216 | 210 |
| 22 | 3300048908 | Ga0496105_0025168 | Ga0496105_0025168_796_1431 | 210 |
| 23 | 3300048909 | Ga0496106_0012062 | Ga0496106_0012062_4460_5095 | 210 |
| 24 | 3300048914 | Ga0496111_0012129 | Ga0496111_0012129_4454_5089 | 210 |
| 25 | 3300048916 | Ga0496113_0161664 | Ga0496113_0161664_450_1085 | 210 |
| 26 | 3300048919 | Ga0496116_0047194 | Ga0496116_0047194_442_1077 | 210 |
| 27 | 3300048921 | Ga0496118_0085836 | Ga0496118_0085836_658_1293 | 210 |
| 28 | 3300048922 | Ga0496119_0016067 | Ga0496119_0016067_1510_2145 | 210 |
| 29 | 3300048923 | Ga0496120_0050968 | Ga0496120_0050968_212_847 | 210 |
| 30 | 3300048924 | Ga0496121_0092196 | Ga0496121_0092196_900_1535 | 210 |
| 31 | 3300048925 | Ga0496122_0235968 | Ga0496122_0235968_283_918 | 210 |
| 32 | 3300048926 | Ga0496123_0050095 | Ga0496123_0050095_1433_2068 | 210 |
| 33 | 3300048927 | Ga0496124_0012785 | Ga0496124_0012785_5775_6410 | 210 |
| 34 | 3300048928 | Ga0496125_0010637 | Ga0496125_0010637_6915_7550 | 210 |
| 35 | iso_pu_bacteria | 2643221688 | 2644492884 | 210 |
| 36 | 3300013306 | Ga0163162_10060106 | Ga0163162_100601063 | 211 |
| 37 | iso_pu_bacteria | 2508501050 | 2508725938 | 211 |
| 38 | iso_pu_bacteria | 2513237160 | 2514006800 | 211 |
| 39 | iso_pu_bacteria | 2582581294 | 2585203222 | 211 |
| 40 | iso_pu_bacteria | 2582581298 | 2585226562 | 211 |
| 41 | iso_pu_bacteria | 2585427529 | 2585549636 | 211 |
| 42 | iso_pu_bacteria | 2585427633 | 2585992652 | 211 |
| 43 | iso_pu_bacteria | 2643221618 | 2644106734 | 211 |
| 44 | iso_pu_bacteria | 2643221626 | 2644148085 | 211 |
| 45 | iso_pu_bacteria | 2643221655 | 2644310038 | 211 |
| 46 | iso_pu_bacteria | 2643221659 | 2644331987 | 211 |
| 47 | iso_pu_bacteria | 2643221698 | 2644543904 | 211 |
| 48 | iso_pu_bacteria | 2643221712 | 2644616256 | 211 |
| 49 | iso_pu_bacteria | 2687453392 | 2688595059 | 211 |
| 50 | iso_pu_bacteria | 2738541293 | 2738805130 | 211 |
| 51 | iso_pu_bacteria | 2773857925 | 2774874697 | 211 |
| 52 | iso_pu_bacteria | 2802428859 | 2802727503 | 211 |
| 53 | iso_pu_bacteria | 2839993093 | 2839998167 | 211 |
| 54 | iso_pu_bacteria | 2841846520 | 2841850905 | 211 |
| 55 | iso_pu_bacteria | 2842124991 | 2842129709 | 211 |
| 56 | iso_pu_bacteria | 2856328259 | 2856332970 | 211 |
| 57 | iso_pu_bacteria | 2857524615 | 2857528357 | 211 |
| 58 | iso_pu_bacteria | 2869271264 | 2869277994 | 211 |
| 59 | iso_pu_bacteria | 2876399893 | 2876401015 | 211 |
| 60 | iso_pu_bacteria | 2881161766 | 2881162025 | 211 |
| 61 | iso_pu_bacteria | 2916061851 | 2916063272 | 211 |
| 62 | iso_pu_bacteria | 2919073203 | 2919075784 | 211 |
| 63 | iso_pu_bacteria | 2919100787 | 2919106071 | 211 |
| 64 | iso_pu_bacteria | 2957437181 | 2957441502 | 211 |
| 65 | iso_pu_bacteria | 2960591022 | 2960594019 | 211 |
| 66 | iso_pu_bacteria | 2961136820 | 2961141836 | 211 |
| 67 | iso_pu_bacteria | 2965025482 | 2965027185 | 211 |
| 68 | iso_pu_bacteria | 2965047637 | 2965053145 | 211 |
| 69 | iso_pu_bacteria | 2965102966 | 2965105218 | 211 |
| 70 | iso_pu_bacteria | 2970122695 | 2970127730 | 211 |
| 71 | iso_pu_bacteria | 2970547951 | 2970551131 | 211 |
| 72 | iso_pu_bacteria | 2987652177 | 2987653056 | 211 |
| 73 | iso_pu_bacteria | 2987666974 | 2987669587 | 211 |
| 74 | iso_pu_bacteria | 2989771324 | 2989776242 | 211 |
| 75 | iso_pu_bacteria | 637000159 | 637074105 | 211 |
| 76 | 3300005548 | Ga0070665_100213392 | Ga0070665_1002133923 | 212 |
| 77 | 3300037466 | Ga0395898_0043496 | Ga0395898_0043496_3061_3702 | 212 |
| 78 | 3300037471 | Ga0395905_0045309 | Ga0395905_0045309_3045_3686 | 212 |
| 79 | 3300037471 | Ga0395905_0698192 | Ga0395905_0698192_195_833 | 212 |
| 80 | 3300038443 | Ga0395901_0188288 | Ga0395901_0188288_915_1556 | 212 |
| 81 | iso_pu_bacteria | 2643221634 | 2644196818 | 212 |
| 82 | 3300009553 | Ga0105249_10416475 | Ga0105249_104164751 | 213 |
| 83 | 3300049586 | Ga0501070_0287418 | Ga0501070_0287418_106_750 | 214 |
| 84 | 3300002774 | JGI25150J39212_1000041 | JGI25150J39212_100004175 | 215 |
| 85 | 3300003187 | JGI25151J46595_10000169 | JGI25151J46595_1000016914 | 215 |
| 86 | 3300003215 | JGI25153J46596_10001520 | JGI25153J46596_1000152011 | 215 |
| 87 | 3300003354 | JGI25160J50197_1024867 | JGI25160J50197_10248672 | 215 |
| 88 | 3300003771 | Ga0055526_1038348 | Ga0055526_10383481 | 215 |
| 89 | 3300003790 | Ga0055528_1005948 | Ga0055528_10059483 | 215 |
| 90 | 3300005334 | Ga0068869_100039055 | Ga0068869_1000390552 | 215 |
| 91 | 3300005335 | Ga0070666_10069477 | Ga0070666_100694772 | 215 |
| 92 | 3300005338 | Ga0068868_100013523 | Ga0068868_1000135234 | 215 |
| 93 | 3300005338 | Ga0068868_100221264 | Ga0068868_1002212642 | 215 |
| 94 | 3300005339 | Ga0070660_100796432 | Ga0070660_1007964321 | 215 |
| 95 | 3300005344 | Ga0070661_100018279 | Ga0070661_1000182796 | 215 |
| 96 | 3300005344 | Ga0070661_100256023 | Ga0070661_1002560232 | 215 |
| 97 | 3300005347 | Ga0070668_100057696 | Ga0070668_1000576963 | 215 |
| 98 | 3300005347 | Ga0070668_100230443 | Ga0070668_1002304432 | 215 |
| 99 | 3300005355 | Ga0070671_100166137 | Ga0070671_1001661372 | 215 |
| 100 | 3300005364 | Ga0070673_100124125 | Ga0070673_1001241252 | 215 |
| 101 | 3300005364 | Ga0070673_100232834 | Ga0070673_1002328342 | 215 |
| 102 | 3300005366 | Ga0070659_100092872 | Ga0070659_1000928723 | 215 |
| 103 | 3300005367 | Ga0070667_100001288 | Ga0070667_10000128812 | 215 |
| 104 | 3300005455 | Ga0070663_100443481 | Ga0070663_1004434811 | 215 |
| 105 | 3300005455 | Ga0070663_100737103 | Ga0070663_1007371032 | 215 |
| 106 | 3300005457 | Ga0070662_100034279 | Ga0070662_1000342791 | 215 |
| 107 | 3300005459 | Ga0068867_100509752 | Ga0068867_1005097521 | 215 |
| 108 | 3300005548 | Ga0070665_100071373 | Ga0070665_1000713733 | 215 |
| 109 | 3300005548 | Ga0070665_100178524 | Ga0070665_1001785242 | 215 |
| 110 | 3300005617 | Ga0068859_100000068 | Ga0068859_10000006826 | 215 |
| 111 | 3300005618 | Ga0068864_100006278 | Ga0068864_1000062786 | 215 |
| 112 | 3300005719 | Ga0068861_100061569 | Ga0068861_1000615694 | 215 |
| 113 | 3300005841 | Ga0068863_100003596 | Ga0068863_1000035968 | 215 |
| 114 | 3300005842 | Ga0068858_100001079 | Ga0068858_10000107915 | 215 |
| 115 | 3300005843 | Ga0068860_100008023 | Ga0068860_1000080237 | 215 |
| 116 | 3300005843 | Ga0068860_100035646 | Ga0068860_1000356465 | 215 |
| 117 | 3300005844 | Ga0068862_100017665 | Ga0068862_1000176655 | 215 |
| 118 | 3300006038 | Ga0075365_10068475 | Ga0075365_100684752 | 215 |
| 119 | 3300006051 | Ga0075364_10286889 | Ga0075364_102868891 | 215 |
| 120 | 3300006175 | Ga0070712_100202800 | Ga0070712_1002028002 | 215 |
| 121 | 3300006186 | Ga0075369_10061214 | Ga0075369_100612142 | 215 |
| 122 | 3300006353 | Ga0075370_10283496 | Ga0075370_102834961 | 215 |
| 123 | 3300006881 | Ga0068865_100093807 | Ga0068865_1000938072 | 215 |
| 124 | 3300006931 | Ga0097620_100000068 | Ga0097620_10000006826 | 215 |
| 125 | 3300007076 | Ga0075435_100354438 | Ga0075435_1003544382 | 215 |
| 126 | 3300009092 | Ga0105250_10045651 | Ga0105250_100456512 | 215 |
| 127 | 3300009093 | Ga0105240_10366217 | Ga0105240_103662173 | 215 |
| 128 | 3300009093 | Ga0105240_10672658 | Ga0105240_106726582 | 215 |
| 129 | 3300009101 | Ga0105247_10052691 | Ga0105247_100526913 | 215 |
| 130 | 3300009147 | Ga0114129_11763934 | Ga0114129_117639341 | 215 |
| 131 | 3300009174 | Ga0105241_10150803 | Ga0105241_101508031 | 215 |
| 132 | 3300009174 | Ga0105241_10463908 | Ga0105241_104639082 | 215 |
| 133 | 3300009176 | Ga0105242_10502527 | Ga0105242_105025272 | 215 |
| 134 | 3300009177 | Ga0105248_10000071 | Ga0105248_10000071101 | 215 |
| 135 | 3300009177 | Ga0105248_10033819 | Ga0105248_100338193 | 215 |
| 136 | 3300009545 | Ga0105237_10233818 | Ga0105237_102338182 | 215 |
| 137 | 3300009545 | Ga0105237_10592329 | Ga0105237_105923292 | 215 |
| 138 | 3300009553 | Ga0105249_10017282 | Ga0105249_100172826 | 215 |
| 139 | 3300009553 | Ga0105249_10253546 | Ga0105249_102535462 | 215 |
| 140 | 3300009553 | Ga0105249_10597975 | Ga0105249_105979751 | 215 |
| 141 | 3300011119 | Ga0105246_10778124 | Ga0105246_107781241 | 215 |
| 142 | 3300013100 | Ga0157373_10109603 | Ga0157373_101096033 | 215 |
| 143 | 3300013104 | Ga0157370_10251053 | Ga0157370_102510532 | 215 |
| 144 | 3300013297 | Ga0157378_10739477 | Ga0157378_107394772 | 215 |
| 145 | 3300013306 | Ga0163162_10425450 | Ga0163162_104254502 | 215 |
| 146 | 3300013307 | Ga0157372_10388393 | Ga0157372_103883932 | 215 |
| 147 | 3300014325 | Ga0163163_10000002 | Ga0163163_10000002189 | 215 |
| 148 | 3300014325 | Ga0163163_10000612 | Ga0163163_1000061210 | 215 |
| 149 | 3300014968 | Ga0157379_10055810 | Ga0157379_100558104 | 215 |
| 150 | 3300014969 | Ga0157376_10063595 | Ga0157376_100635955 | 215 |
| 151 | 3300021384 | Ga0213876_10006176 | Ga0213876_100061763 | 215 |
| 152 | 3300022739 | Ga0228711_1005330 | Ga0228711_10053304 | 215 |
| 153 | 3300022740 | Ga0228710_1005535 | Ga0228710_10055354 | 215 |
| 154 | 3300025245 | Ga0207425_1000096 | Ga0207425_100009672 | 215 |
| 155 | 3300025258 | Ga0209129_1000188 | Ga0209129_100018872 | 215 |
| 156 | 3300025294 | Ga0209025_1000419 | Ga0209025_100041972 | 215 |
| 157 | 3300025294 | Ga0209025_1027350 | Ga0209025_10273503 | 215 |
| 158 | 3300025297 | Ga0209758_1000347 | Ga0209758_100034712 | 215 |
| 159 | 3300025297 | Ga0209758_1032067 | Ga0209758_10320672 | 215 |
| 160 | 3300025297 | Ga0209758_1089550 | Ga0209758_10895501 | 215 |
| 161 | 3300025297 | Ga0209758_1102757 | Ga0209758_11027572 | 215 |
| 162 | 3300025302 | Ga0207426_1000638 | Ga0207426_100063822 | 215 |
| 163 | 3300025900 | Ga0207710_10147551 | Ga0207710_101475512 | 215 |
| 164 | 3300025904 | Ga0207647_10281294 | Ga0207647_102812941 | 215 |
| 165 | 3300025907 | Ga0207645_10005352 | Ga0207645_100053529 | 215 |
| 166 | 3300025913 | Ga0207695_10185026 | Ga0207695_101850264 | 215 |
| 167 | 3300025913 | Ga0207695_10511867 | Ga0207695_105118671 | 215 |
| 168 | 3300025914 | Ga0207671_10080800 | Ga0207671_100808002 | 215 |
| 169 | 3300025915 | Ga0207693_10193129 | Ga0207693_101931292 | 215 |
| 170 | 3300025919 | Ga0207657_10124078 | Ga0207657_101240782 | 215 |
| 171 | 3300025924 | Ga0207694_10180916 | Ga0207694_101809162 | 215 |
| 172 | 3300025931 | Ga0207644_10203615 | Ga0207644_102036152 | 215 |
| 173 | 3300025931 | Ga0207644_10706236 | Ga0207644_107062362 | 215 |
| 174 | 3300025938 | Ga0207704_10047806 | Ga0207704_100478062 | 215 |
| 175 | 3300025938 | Ga0207704_10783438 | Ga0207704_107834381 | 215 |
| 176 | 3300025941 | Ga0207711_10000046 | Ga0207711_1000004674 | 215 |
| 177 | 3300025941 | Ga0207711_10022598 | Ga0207711_100225983 | 215 |
| 178 | 3300025941 | Ga0207711_10227050 | Ga0207711_102270503 | 215 |
| 179 | 3300025941 | Ga0207711_10277798 | Ga0207711_102777982 | 215 |
| 180 | 3300025942 | Ga0207689_10262456 | Ga0207689_102624562 | 215 |
| 181 | 3300025944 | Ga0207661_10035264 | Ga0207661_100352643 | 215 |
| 182 | 3300025960 | Ga0207651_10109332 | Ga0207651_101093322 | 215 |
| 183 | 3300025960 | Ga0207651_10161998 | Ga0207651_101619981 | 215 |
| 184 | 3300025972 | Ga0207668_10060165 | Ga0207668_100601653 | 215 |
| 185 | 3300025972 | Ga0207668_10210968 | Ga0207668_102109682 | 215 |
| 186 | 3300025972 | Ga0207668_11085322 | Ga0207668_110853221 | 215 |
| 187 | 3300025986 | Ga0207658_10003511 | Ga0207658_100035116 | 215 |
| 188 | 3300025986 | Ga0207658_10422481 | Ga0207658_104224811 | 215 |
| 189 | 3300026023 | Ga0207677_10007531 | Ga0207677_100075313 | 215 |
| 190 | 3300026035 | Ga0207703_10001528 | Ga0207703_1000152814 | 215 |
| 191 | 3300026035 | Ga0207703_10747035 | Ga0207703_107470352 | 215 |
| 192 | 3300026088 | Ga0207641_10000534 | Ga0207641_1000053426 | 215 |
| 193 | 3300026095 | Ga0207676_10000449 | Ga0207676_1000044929 | 215 |
| 194 | 3300027111 | Ga0209281_1001106 | Ga0209281_10011064 | 215 |
| 195 | 3300027666 | Ga0209282_1000700 | Ga0209282_10007003 | 215 |
| 196 | 3300028379 | Ga0268266_10037430 | Ga0268266_100374304 | 215 |
| 197 | 3300028379 | Ga0268266_10670916 | Ga0268266_106709162 | 215 |
| 198 | 3300028379 | Ga0268266_10702825 | Ga0268266_107028252 | 215 |
| 199 | 3300028380 | Ga0268265_10003173 | Ga0268265_100031737 | 215 |
| 200 | 3300028380 | Ga0268265_10037627 | Ga0268265_100376274 | 215 |
| 201 | 3300028381 | Ga0268264_10000395 | Ga0268264_1000039542 | 215 |
| 202 | 3300028381 | Ga0268264_10271884 | Ga0268264_102718842 | 215 |
| 203 | 3300028794 | Ga0307515_10082417 | Ga0307515_100824174 | 215 |
| 204 | 3300031456 | Ga0307513_10386404 | Ga0307513_103864042 | 215 |
| 205 | 3300031548 | Ga0307408_100435290 | Ga0307408_1004352902 | 215 |
| 206 | 3300031901 | Ga0307406_10143463 | Ga0307406_101434632 | 215 |
| 207 | 3300031911 | Ga0307412_10296900 | Ga0307412_102969002 | 215 |
| 208 | 3300031967 | Ga0315914_1000095 | Ga0315914_100009522 | 215 |
| 209 | 3300031995 | Ga0307409_100190764 | Ga0307409_1001907643 | 215 |
| 210 | 3300032005 | Ga0307411_10112287 | Ga0307411_101122872 | 215 |
| 211 | 3300033430 | Ga0315913_1003885 | Ga0315913_100388521 | 215 |
| 212 | 3300033464 | Ga0315915_1000023 | Ga0315915_100002322 | 215 |
| 213 | 3300037312 | Ga0395899_0003407 | Ga0395899_0003407_8632_9315 | 215 |
| 214 | 3300037312 | Ga0395899_0025824 | Ga0395899_0025824_2504_3151 | 215 |
| 215 | 3300037418 | Ga0395900_0000130 | Ga0395900_0000130_44207_44890 | 215 |
| 216 | 3300037418 | Ga0395900_0003895 | Ga0395900_0003895_2793_3440 | 215 |
| 217 | 3300037418 | Ga0395900_0037676 | Ga0395900_0037676_4245_4919 | 215 |
| 218 | 3300037418 | Ga0395900_0048848 | Ga0395900_0048848_357_1004 | 215 |
| 219 | 3300037418 | Ga0395900_0050083 | Ga0395900_0050083_2335_2982 | 215 |
| 220 | 3300037418 | Ga0395900_0080975 | Ga0395900_0080975_350_997 | 215 |
| 221 | 3300037418 | Ga0395900_0122777 | Ga0395900_0122777_1475_2128 | 215 |
| 222 | 3300037418 | Ga0395900_0285098 | Ga0395900_0285098_619_1266 | 215 |
| 223 | 3300037466 | Ga0395898_0000274 | Ga0395898_0000274_114169_114852 | 215 |
| 224 | 3300037466 | Ga0395898_0010287 | Ga0395898_0010287_2052_2699 | 215 |
| 225 | 3300037466 | Ga0395898_0017479 | Ga0395898_0017479_4664_5338 | 215 |
| 226 | 3300037466 | Ga0395898_0122471 | Ga0395898_0122471_1562_2209 | 215 |
| 227 | 3300037466 | Ga0395898_0584216 | Ga0395898_0584216_283_930 | 215 |
| 228 | 3300037471 | Ga0395905_0000287 | Ga0395905_0000287_12066_12749 | 215 |
| 229 | 3300037471 | Ga0395905_0011694 | Ga0395905_0011694_813_1460 | 215 |
| 230 | 3300037471 | Ga0395905_0013648 | Ga0395905_0013648_3875_4522 | 215 |
| 231 | 3300037471 | Ga0395905_0017889 | Ga0395905_0017889_331_978 | 215 |
| 232 | 3300037471 | Ga0395905_0018130 | Ga0395905_0018130_1529_2176 | 215 |
| 233 | 3300037471 | Ga0395905_0020531 | Ga0395905_0020531_4424_5098 | 215 |
| 234 | 3300037471 | Ga0395905_0057107 | Ga0395905_0057107_2591_3238 | 215 |
| 235 | 3300037471 | Ga0395905_0064906 | Ga0395905_0064906_1266_1919 | 215 |
| 236 | 3300037471 | Ga0395905_0074425 | Ga0395905_0074425_2115_2783 | 215 |
| 237 | 3300037471 | Ga0395905_0075052 | Ga0395905_0075052_1121_1768 | 215 |
| 238 | 3300037471 | Ga0395905_0667012 | Ga0395905_0667012_194_841 | 215 |
| 239 | 3300038443 | Ga0395901_0000613 | Ga0395901_0000613_35832_36515 | 215 |
| 240 | 3300038443 | Ga0395901_0017657 | Ga0395901_0017657_866_1513 | 215 |
| 241 | 3300038443 | Ga0395901_0040376 | Ga0395901_0040376_3504_4151 | 215 |
| 242 | 3300038443 | Ga0395901_0066177 | Ga0395901_0066177_813_1460 | 215 |
| 243 | 3300038443 | Ga0395901_0187072 | Ga0395901_0187072_359_1012 | 215 |
| 244 | 3300038443 | Ga0395901_0194745 | Ga0395901_0194745_1277_1924 | 215 |
| 245 | 3300038443 | Ga0395901_0244012 | Ga0395901_0244012_270_917 | 215 |
| 246 | 3300038443 | Ga0395901_0269952 | Ga0395901_0269952_278_952 | 215 |
| 247 | 3300039437 | Ga0436365_0286234 | Ga0436365_0286234_1279_1926 | 215 |
| 248 | 3300045976 | Ga0466967_0006754 | Ga0466967_0006754_4959_5633 | 215 |
| 249 | 3300046454 | Ga0495592_0054815 | Ga0495592_0054815_1355_2008 | 215 |
| 250 | 3300046460 | Ga0495638_0009241 | Ga0495638_0009241_3029_3685 | 215 |
| 251 | 3300046492 | Ga0495585_0166683 | Ga0495585_0166683_323_970 | 215 |
| 252 | 3300046501 | Ga0495607_0032651 | Ga0495607_0032651_2335_2991 | 215 |
| 253 | 3300046507 | Ga0495606_0002576 | Ga0495606_0002576_445_1095 | 215 |
| 254 | 3300046507 | Ga0495606_0236118 | Ga0495606_0236118_171_827 | 215 |
| 255 | 3300046512 | Ga0495610_0037025 | Ga0495610_0037025_714_1370 | 215 |
| 256 | 3300046513 | Ga0495616_0043745 | Ga0495616_0043745_934_1590 | 215 |
| 257 | 3300046515 | Ga0495620_0079750 | Ga0495620_0079750_160_816 | 215 |
| 258 | 3300046519 | Ga0495632_0016123 | Ga0495632_0016123_3415_4071 | 215 |
| 259 | 3300046530 | Ga0495654_0058020 | Ga0495654_0058020_788_1444 | 215 |
| 260 | 3300046542 | Ga0495597_0082140 | Ga0495597_0082140_27_683 | 215 |
| 261 | 3300046557 | Ga0495622_0007581 | Ga0495622_0007581_2906_3568 | 215 |
| 262 | 3300046616 | Ga0495668_0048371 | Ga0495668_0048371_766_1422 | 215 |
| 263 | 3300046616 | Ga0495668_0076515 | Ga0495668_0076515_1061_1708 | 215 |
| 264 | 3300046660 | Ga0495625_0001951 | Ga0495625_0001951_22151_22798 | 215 |
| 265 | 3300046665 | Ga0495661_0003247 | Ga0495661_0003247_11056_11712 | 215 |
| 266 | 3300046678 | Ga0495599_0048159 | Ga0495599_0048159_240_893 | 215 |
| 267 | 3300046684 | Ga0495669_0037165 | Ga0495669_0037165_590_1237 | 215 |
| 268 | 3300046691 | Ga0495670_0008491 | Ga0495670_0008491_2055_2711 | 215 |
| 269 | 3300046810 | Ga0495660_0141736 | Ga0495660_0141736_174_830 | 215 |
| 270 | 3300047472 | Ga0495686_0002808 | Ga0495686_0002808_7002_7784 | 215 |
| 271 | 3300047472 | Ga0495686_0059161 | Ga0495686_0059161_723_1379 | 215 |
| 272 | 3300048913 | Ga0496110_0710270 | Ga0496110_0710270_160_807 | 215 |
| 273 | 3300048916 | Ga0496113_0520364 | Ga0496113_0520364_114_761 | 215 |
| 274 | 3300048919 | Ga0496116_0003769 | Ga0496116_0003769_2363_3010 | 215 |
| 275 | 3300048919 | Ga0496116_0104500 | Ga0496116_0104500_347_1003 | 215 |
| 276 | 3300048920 | Ga0496117_0055655 | Ga0496117_0055655_1996_2652 | 215 |
| 277 | 3300048922 | Ga0496119_0276847 | Ga0496119_0276847_116_766 | 215 |
| 278 | 3300048924 | Ga0496121_0012621 | Ga0496121_0012621_8189_8839 | 215 |
| 279 | 3300048924 | Ga0496121_0442064 | Ga0496121_0442064_68_715 | 215 |
| 280 | 3300048925 | Ga0496122_0086625 | Ga0496122_0086625_438_1085 | 215 |
| 281 | 3300048926 | Ga0496123_0008314 | Ga0496123_0008314_7020_7676 | 215 |
| 282 | 3300048927 | Ga0496124_0064318 | Ga0496124_0064318_951_1598 | 215 |
| 283 | 3300048928 | Ga0496125_0001558 | Ga0496125_0001558_4212_4868 | 215 |
| 284 | 3300048929 | Ga0496126_0055302 | Ga0496126_0055302_550_1206 | 215 |
| 285 | 3300049571 | Ga0501034_0125472 | Ga0501034_0125472_1333_1980 | 215 |
| 286 | 3300049822 | Ga0501035_0815011 | Ga0501035_0815011_46_696 | 215 |
| 287 | 3300049823 | Ga0501044_0792138 | Ga0501044_0792138_81_731 | 215 |
| 288 | 3300050492 | nmdc:mga0yw44_32484_c1 | nmdc:mga0yw44_32484_c1_421_1077 | 215 |
| 289 | 3300050496 | nmdc:mga07m45_8639_c2 | nmdc:mga07m45_8639_c2_2554_3201 | 215 |
| 290 | 3300050513 | nmdc:mga0rr50_358041_c1 | nmdc:mga0rr50_358041_c1_409_1056 | 215 |
| 291 | 3300050516 | nmdc:mga0sz30_36674_c1 | nmdc:mga0sz30_36674_c1_1338_1994 | 215 |
| 292 | 3300053077 | Ga0495601_0061521 | Ga0495601_0061521_1600_2253 | 215 |
| 293 | 3300053087 | Ga0500643_043995 | Ga0500643_043995_146_802 | 215 |
| 294 | 3300053088 | Ga0500644_0062840 | Ga0500644_0062840_39_689 | 215 |
| 295 | 3300053089 | Ga0500581_059537 | Ga0500581_059537_378_1034 | 215 |
| 296 | 3300053090 | Ga0500646_0005758 | Ga0500646_0005758_1694_2350 | 215 |
| 297 | 3300053093 | Ga0500651_0022096 | Ga0500651_0022096_1171_1827 | 215 |
| 298 | 3300053093 | Ga0500651_0039260 | Ga0500651_0039260_2064_2714 | 215 |
| 299 | 3300053096 | Ga0500641_0003501 | Ga0500641_0003501_2371_3027 | 215 |
| 300 | 3300053098 | Ga0500650_0000191 | Ga0500650_0000191_12672_13328 | 215 |
| 301 | 3300053104 | Ga0500556_0000002 | Ga0500556_0000002_260079_260735 | 215 |
| 302 | 3300053105 | Ga0500557_073578 | Ga0500557_073578_371_1027 | 215 |
| 303 | 3300053108 | Ga0500562_005971 | Ga0500562_005971_1880_2536 | 215 |
| 304 | 3300053117 | Ga0500593_181516 | Ga0500593_181516_78_734 | 215 |
| 305 | 3300053119 | Ga0500595_001867 | Ga0500595_001867_8733_9395 | 215 |
| 306 | 3300053130 | Ga0500642_0000066 | Ga0500642_0000066_11571_12227 | 215 |
| 307 | 3300053131 | Ga0500652_011088 | Ga0500652_011088_1414_2070 | 215 |
| 308 | 3300053134 | Ga0500658_0015671 | Ga0500658_0015671_493_1143 | 215 |
| 309 | 3300053139 | Ga0500568_0000404 | Ga0500568_0000404_26965_27615 | 215 |
| 310 | 3300053139 | Ga0500568_0001092 | Ga0500568_0001092_4721_5377 | 215 |
| 311 | 3300053140 | Ga0500573_0000002 | Ga0500573_0000002_172031_172678 | 215 |
| 312 | 3300053142 | Ga0500577_0067327 | Ga0500577_0067327_158_814 | 215 |
| 313 | 3300053151 | Ga0500604_0007517 | Ga0500604_0007517_1527_2183 | 215 |
| 314 | 3300053151 | Ga0500604_0020914 | Ga0500604_0020914_1157_1807 | 215 |
| 315 | 3300053156 | Ga0500622_0002408 | Ga0500622_0002408_6859_7515 | 215 |
| 316 | 3300053158 | Ga0500627_0015145 | Ga0500627_0015145_1457_2104 | 215 |
| 317 | 3300053160 | Ga0500633_0000131 | Ga0500633_0000131_3059_3709 | 215 |
| 318 | 3300053161 | Ga0500634_0126973 | Ga0500634_0126973_319_975 | 215 |
| 319 | 3300053727 | Ga0500611_001382 | Ga0500611_001382_1519_2175 | 215 |
| 320 | iso_pu_bacteria | 2882456835 | 2882461034 | 215 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6dk9-assembly4.cif.gz_F | yeast ddi2 cyanamide hydratase | 0.8039 | 6 | 201 |
| 6dkd-assembly2.cif.gz_C | yeast ddi2 cyanamide hydratase | 0.8025 | 6 | 195 |
| 6dka-assembly4.cif.gz_F | yeast ddi2 cyanamide hydratase | 0.7985 | 6 | 200 |
| 6dk9-assembly4.cif.gz_F | yeast ddi2 cyanamide hydratase | 0.7344 | 6 | 201 |
| 6dka-assembly4.cif.gz_F | yeast ddi2 cyanamide hydratase | 0.7258 | 6 | 200 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0CH63_33_194_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.9212 | 16 | 171 | 1.10.3210.10 |
| af_P0CH63_33_194_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.8834 | 16 | 171 | 1.10.3210.10 |
| af_Q59066_3_118_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.6862 | 61 | 130 | 1.10.3210.10 |
| af_Q58247_43_183_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.6591 | 30 | 138 | 1.10.3210.10 |
| af_Q58426_28_188_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.623 | 18 | 135 | 1.10.3210.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9X7X6-F1-model_v4 | HD domain-containing protein | 0.9539 | 7 | 161 |
|
| AF-A0A530LD03-F1-model_v4 | HD domain-containing protein | 0.953 | 1 | 194 |
|
| AF-A0A530LD03-F1-model_v4 | HD domain-containing protein | 0.9481 | 1 | 194 |
|
| AF-A0A2V9X7X6-F1-model_v4 | HD domain-containing protein | 0.9479 | 7 | 161 |
|
| AF-A0A069P2D5-F1-model_v4 | Phosphohydrolase | 0.9474 | 36 | 134 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar