F405695

General Info

Members Datasets Scaffolds Average Seq Length
320 224 278 216

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0002808|Ga0495686_0002808_7002_7784
Length 260
Sequence MRSNFRRPHAVATPGNPFVARADTARDRDRMMFIEAYTSPGIDNDMTSPKTRILAGISVPDTALVNAAIDFAGRACEPYLFNHVMRSWLFAVRIGELESIAHDAGVVAAGTLLHDITLNDRFVGPRRFEVEAADMARHFATNAGLDDRRVQLIWESVALNSTPSIGLYKEAEVALCTAGICFDVVGLRYNRIPSSDVKAVVDEFPRLGMKRKMTACFCHIAQTHPETTYDNFVRDFGERLVSGYRVPSSVDLVAAAPFDD

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
3 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
4 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
5 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
6 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
7 2643221618 Ensifer sp. Root231 Isolate Unclassified
8 2643221626 Ensifer sp. Root31 Isolate Unclassified
9 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
10 2643221655 Ensifer sp. Root1252 Isolate Unclassified
11 2643221659 Ensifer sp. Root127 Isolate Unclassified
12 2643221688 Rhizobium sp. Root482 Isolate Unclassified
13 2643221698 Ensifer sp. Root142 Isolate Unclassified
14 2643221712 Ensifer sp. Root258 Isolate Unclassified
15 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
16 2738541293 Rhizobium sp. GV031 Isolate Unclassified
17 2773857925 Microvirga vignae BR3299 Isolate Unclassified
18 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
19 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
20 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
21 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
22 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
23 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
24 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
25 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
26 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
27 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
28 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
29 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
30 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
31 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
32 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
33 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
34 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
35 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
36 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
37 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
38 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
39 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
40 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
41 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
42 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
43 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
44 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
45 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
46 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
47 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
98 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
99 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
100 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
125 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
138 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
151 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
180 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
181 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
200 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
201 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
202 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
203 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
204 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
205 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
206 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
207 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
208 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
209 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
210 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
211 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
212 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
213 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
214 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
215 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
216 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
217 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
218 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
219 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
220 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
221 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
222 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
223 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
224 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.88
Metatranscriptomes 0
Isolates 13.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.94
Nodule 8.44
Rhizoplane 3.44
Rhizosphere 56.88
Stem 0
Stem Tuber 0
Unclassified 15.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1000041 3300002774 Bacteria 84550
2 JGI25151J46595_10000169 3300003187 Bacteria 84550
3 JGI25153J46596_10001520 3300003215 Bacteria 13826
4 JGI25160J50197_1024867 3300003354 Bacteria 1689
5 Ga0055526_1038348 3300003771 Bacteria 1236
6 Ga0055528_1005948 3300003790 Bacteria 5590
7 Ga0068869_100039055 3300005334 Bacteria 3387
8 Ga0070666_10069477 3300005335 Bacteria 2395
9 Ga0068868_100013523 3300005338 Bacteria 5986
10 Ga0068868_100221264 3300005338 Bacteria 1585
11 Ga0070660_100796432 3300005339 Bacteria 795
12 Ga0070661_100018279 3300005344 Bacteria 4982
13 Ga0070661_100256023 3300005344 Bacteria 1352
14 Ga0070668_100057696 3300005347 Bacteria 3001
15 Ga0070668_100230443 3300005347 Bacteria 1531
16 Ga0070671_100166137 3300005355 Bacteria 1866
17 Ga0070673_100124125 3300005364 Bacteria 2158
18 Ga0070673_100232834 3300005364 Unclassified 1598
19 Ga0070659_100092872 3300005366 Bacteria 2421
20 Ga0070667_100001288 3300005367 Bacteria 22660
21 Ga0070663_100443481 3300005455 Bacteria 1069
22 Ga0070663_100737103 3300005455 Bacteria 840
23 Ga0070662_100034279 3300005457 Bacteria 3579
24 Ga0068867_100509752 3300005459 Bacteria 1035
25 Ga0070665_100071373 3300005548 Bacteria 3479
26 Ga0070665_100178524 3300005548 Bacteria 2124
27 Ga0070665_100213392 3300005548 Bacteria 1931
28 Ga0068859_100000068 3300005617 Bacteria 96701
29 Ga0068864_100006278 3300005618 Bacteria 9748
30 Ga0068861_100061569 3300005719 Bacteria 2881
31 Ga0068863_100003596 3300005841 Bacteria 15299
32 Ga0068858_100001079 3300005842 Bacteria 28254
33 Ga0068860_100008023 3300005843 Bacteria 10529
34 Ga0068860_100035646 3300005843 Bacteria 4770
35 Ga0068862_100017665 3300005844 Bacteria 5938
36 Ga0075365_10068475 3300006038 Bacteria 2385
37 Ga0075364_10286889 3300006051 Bacteria 1120
38 Ga0070712_100202800 3300006175 Bacteria 1559
39 Ga0075369_10061214 3300006186 Bacteria 1643
40 Ga0075370_10283496 3300006353 Unclassified 984
41 Ga0068865_100093807 3300006881 Bacteria 2183
42 Ga0097620_100000068 3300006931 Bacteria 96701
43 Ga0075435_100354438 3300007076 Bacteria 1258
44 Ga0105251_10167993 3300009011 Bacteria 988
45 Ga0105250_10045651 3300009092 Bacteria 1757
46 Ga0105240_10366217 3300009093 Bacteria 1631
47 Ga0105240_10672658 3300009093 Bacteria 1133
48 Ga0105247_10052691 3300009101 Bacteria 2510
49 Ga0114129_11763934 3300009147 Bacteria 754
50 Ga0105241_10150803 3300009174 Bacteria 1902
51 Ga0105241_10463908 3300009174 Unclassified 1123
52 Ga0105242_10502527 3300009176 Bacteria 1153
53 Ga0105248_10000071 3300009177 Bacteria 118281
54 Ga0105248_10033819 3300009177 Bacteria 5712
55 Ga0105248_10514276 3300009177 Bacteria 1350
56 Ga0105237_10233818 3300009545 Bacteria 1839
57 Ga0105237_10592329 3300009545 Bacteria 1116
58 Ga0105249_10017282 3300009553 Bacteria 6403
59 Ga0105249_10253546 3300009553 Bacteria 1745
60 Ga0105249_10416475 3300009553 Bacteria 1376
61 Ga0105249_10597975 3300009553 Bacteria 1157
62 Ga0105246_10778124 3300011119 Bacteria 847
63 Ga0157373_10109603 3300013100 Bacteria 1941
64 Ga0157370_10251053 3300013104 Bacteria 1636
65 Ga0157378_10739477 3300013297 Bacteria 1006
66 Ga0163162_10060106 3300013306 Bacteria 3834
67 Ga0163162_10425450 3300013306 Bacteria 1460
68 Ga0157372_10388393 3300013307 Bacteria 1626
69 Ga0163163_10000002 3300014325 Bacteria 609846
70 Ga0163163_10000612 3300014325 Bacteria 31054
71 Ga0157379_10055810 3300014968 Bacteria 3529
72 Ga0157376_10063595 3300014969 Bacteria 3109
73 Ga0213876_10006176 3300021384 Bacteria 6535
74 Ga0228711_1005330 3300022739 Bacteria 19584
75 Ga0228710_1005535 3300022740 Bacteria 19585
76 Ga0207425_1000096 3300025245 Bacteria 84780
77 Ga0209129_1000188 3300025258 Bacteria 84780
78 Ga0209025_1000419 3300025294 Bacteria 84780
79 Ga0209025_1027350 3300025294 Bacteria 2830
80 Ga0209758_1000347 3300025297 Bacteria 84775
81 Ga0209758_1032067 3300025297 Bacteria 2142
82 Ga0209758_1089550 3300025297 Bacteria 905
83 Ga0209758_1102757 3300025297 Bacteria 808
84 Ga0207426_1000638 3300025302 Bacteria 43881
85 Ga0207710_10147551 3300025900 Bacteria 1139
86 Ga0207647_10281294 3300025904 Bacteria 949
87 Ga0207645_10005352 3300025907 Bacteria 9329
88 Ga0207695_10185026 3300025913 Bacteria 2003
89 Ga0207695_10511867 3300025913 Bacteria 1082
90 Ga0207671_10080800 3300025914 Bacteria 2437
91 Ga0207693_10193129 3300025915 Bacteria 1602
92 Ga0207657_10124078 3300025919 Bacteria 2122
93 Ga0207694_10180916 3300025924 Bacteria 1710
94 Ga0207644_10203615 3300025931 Bacteria 1562
95 Ga0207644_10706236 3300025931 Bacteria 841
96 Ga0207704_10047806 3300025938 Bacteria 2561
97 Ga0207704_10783438 3300025938 Bacteria 795
98 Ga0207711_10000046 3300025941 Bacteria 153238
99 Ga0207711_10022598 3300025941 Bacteria 5262
100 Ga0207711_10227050 3300025941 Bacteria 1709
101 Ga0207711_10277798 3300025941 Bacteria 1542
102 Ga0207689_10262456 3300025942 Bacteria 1429
103 Ga0207661_10035264 3300025944 Bacteria 3897
104 Ga0207651_10109332 3300025960 Bacteria 2071
105 Ga0207651_10161998 3300025960 Unclassified 1755
106 Ga0207668_10060165 3300025972 Bacteria 2665
107 Ga0207668_10210968 3300025972 Bacteria 1553
108 Ga0207668_11085322 3300025972 Bacteria 717
109 Ga0207658_10003511 3300025986 Bacteria 11067
110 Ga0207658_10422481 3300025986 Bacteria 1176
111 Ga0207677_10007531 3300026023 Bacteria 6035
112 Ga0207703_10001528 3300026035 Bacteria 21013
113 Ga0207703_10747035 3300026035 Bacteria 932
114 Ga0207641_10000534 3300026088 Bacteria 42657
115 Ga0207676_10000449 3300026095 Bacteria 34863
116 Ga0209281_1001106 3300027111 Bacteria 19584
117 Ga0209282_1000700 3300027666 Bacteria 16730
118 Ga0268266_10037430 3300028379 Bacteria 4133
119 Ga0268266_10670916 3300028379 Bacteria 998
120 Ga0268266_10702825 3300028379 Bacteria 974
121 Ga0268265_10003173 3300028380 Bacteria 11949
122 Ga0268265_10037627 3300028380 Bacteria 3553
123 Ga0268264_10000395 3300028381 Bacteria 62904
124 Ga0268264_10271884 3300028381 Bacteria 1583
125 Ga0307515_10082417 3300028794 Bacteria 4161
126 Ga0307513_10386404 3300031456 Bacteria 1138
127 Ga0307408_100435290 3300031548 Unclassified 1134
128 Ga0307406_10143463 3300031901 Unclassified 1694
129 Ga0307412_10296900 3300031911 Bacteria 1275
130 Ga0315914_1000095 3300031967 Bacteria 74092
131 Ga0307409_100190764 3300031995 Bacteria 1824
132 Ga0307411_10112287 3300032005 Bacteria 1953
133 Ga0315913_1003885 3300033430 Bacteria 18005
134 Ga0315915_1000023 3300033464 Bacteria 119157
135 Ga0395899_0003407 3300037312 Bacteria 12614
136 Ga0395899_0025824 3300037312 Bacteria 4434
137 Ga0395900_0000130 3300037418 Bacteria 126231
138 Ga0395900_0003895 3300037418 Bacteria 15942
139 Ga0395900_0037676 3300037418 Bacteria 4985
140 Ga0395900_0048848 3300037418 Bacteria 4357
141 Ga0395900_0050083 3300037418 Bacteria 4303
142 Ga0395900_0080975 3300037418 Bacteria 3336
143 Ga0395900_0122777 3300037418 Bacteria 2664
144 Ga0395900_0285098 3300037418 Bacteria 1642
145 Ga0395898_0000274 3300037466 Bacteria 125922
146 Ga0395898_0010287 3300037466 Bacteria 9791
147 Ga0395898_0017479 3300037466 Bacteria 7322
148 Ga0395898_0043496 3300037466 Bacteria 4425
149 Ga0395898_0122471 3300037466 Bacteria 2492
150 Ga0395898_0584216 3300037466 Bacteria 1059
151 Ga0395905_0000287 3300037471 Bacteria 73803
152 Ga0395905_0011694 3300037471 Bacteria 8473
153 Ga0395905_0013648 3300037471 Bacteria 7783
154 Ga0395905_0017889 3300037471 Bacteria 6734
155 Ga0395905_0018130 3300037471 Bacteria 6680
156 Ga0395905_0020531 3300037471 Bacteria 6256
157 Ga0395905_0045309 3300037471 Bacteria 4125
158 Ga0395905_0057107 3300037471 Bacteria 3651
159 Ga0395905_0064906 3300037471 Bacteria 3417
160 Ga0395905_0074425 3300037471 Bacteria 3183
161 Ga0395905_0075052 3300037471 Bacteria 3169
162 Ga0395905_0667012 3300037471 Bacteria 942
163 Ga0395905_0698192 3300037471 Unclassified 917
164 Ga0395901_0000613 3300038443 Bacteria 41465
165 Ga0395901_0017657 3300038443 Bacteria 7284
166 Ga0395901_0040376 3300038443 Bacteria 4832
167 Ga0395901_0066177 3300038443 Bacteria 3764
168 Ga0395901_0187072 3300038443 Bacteria 2172
169 Ga0395901_0188288 3300038443 Bacteria 2164
170 Ga0395901_0194745 3300038443 Bacteria 2125
171 Ga0395901_0244012 3300038443 Bacteria 1872
172 Ga0395901_0269952 3300038443 Bacteria 1769
173 Ga0237816_04028 3300039145 Bacteria 1041
174 Ga0436365_0286234 3300039437 Bacteria 10730
175 Ga0466967_0006754 3300045976 Bacteria 8169
176 Ga0495592_0054815 3300046454 Bacteria 2952
177 Ga0495638_0009241 3300046460 Bacteria 6930
178 Ga0495585_0166683 3300046492 Unclassified 1140
179 Ga0495607_0032651 3300046501 Bacteria 3175
180 Ga0495583_0014513 3300046506 Bacteria 4344
181 Ga0495606_0002576 3300046507 Bacteria 20766
182 Ga0495606_0236118 3300046507 Bacteria 1022
183 Ga0495610_0024951 3300046512 Bacteria 3219
184 Ga0495610_0037025 3300046512 Bacteria 2487
185 Ga0495616_0043745 3300046513 Bacteria 2274
186 Ga0495616_0150603 3300046513 Bacteria 1053
187 Ga0495620_0079750 3300046515 Bacteria 1326
188 Ga0495632_0016123 3300046519 Bacteria 4166
189 Ga0495654_0058020 3300046530 Bacteria 1869
190 Ga0495597_0082140 3300046542 Bacteria 1377
191 Ga0495622_0007581 3300046557 Bacteria 5040
192 Ga0495668_0048371 3300046616 Bacteria 2360
193 Ga0495668_0076515 3300046616 Bacteria 1837
194 Ga0495625_0001951 3300046660 Bacteria 23339
195 Ga0495661_0003247 3300046665 Bacteria 12111
196 Ga0495599_0048159 3300046678 Bacteria 2672
197 Ga0495669_0037165 3300046684 Bacteria 2154
198 Ga0495670_0008491 3300046691 Bacteria 5054
199 Ga0495660_0141736 3300046810 Bacteria 1195
200 Ga0495686_0002808 3300047472 Bacteria 15793
201 Ga0495686_0059161 3300047472 Bacteria 2386
202 Ga0495626_0086291 3300048091 Bacteria 1387
203 Ga0496100_0137545 3300048903 Bacteria 1728
204 Ga0496101_0822134 3300048904 Bacteria 732
205 Ga0496102_0221104 3300048905 Bacteria 1785
206 Ga0496103_0208620 3300048906 Bacteria 1256
207 Ga0496104_0003102 3300048907 Bacteria 14327
208 Ga0496105_0025168 3300048908 Bacteria 4841
209 Ga0496106_0012062 3300048909 Bacteria 6377
210 Ga0496110_0710270 3300048913 Bacteria 907
211 Ga0496111_0012129 3300048914 Bacteria 5829
212 Ga0496113_0161664 3300048916 Bacteria 1770
213 Ga0496113_0520364 3300048916 Bacteria 955
214 Ga0496116_0003769 3300048919 Bacteria 14814
215 Ga0496116_0047194 3300048919 Bacteria 2900
216 Ga0496116_0058605 3300048919 Bacteria 2510
217 Ga0496116_0104500 3300048919 Bacteria 1683
218 Ga0496117_0022386 3300048920 Bacteria 5070
219 Ga0496117_0055655 3300048920 Bacteria 2762
220 Ga0496118_0022289 3300048921 Bacteria 5545
221 Ga0496118_0085836 3300048921 Bacteria 2190
222 Ga0496119_0016067 3300048922 Bacteria 5717
223 Ga0496119_0276847 3300048922 Bacteria 836
224 Ga0496120_0050968 3300048923 Bacteria 2367
225 Ga0496121_0012621 3300048924 Bacteria 9179
226 Ga0496121_0069841 3300048924 Bacteria 2832
227 Ga0496121_0092196 3300048924 Bacteria 2362
228 Ga0496121_0442064 3300048924 Bacteria 840
229 Ga0496122_0017842 3300048925 Bacteria 6599
230 Ga0496122_0086625 3300048925 Bacteria 2155
231 Ga0496122_0235968 3300048925 Bacteria 1035
232 Ga0496123_0008314 3300048926 Bacteria 9553
233 Ga0496123_0050095 3300048926 Bacteria 2793
234 Ga0496124_0012785 3300048927 Bacteria 8249
235 Ga0496124_0064318 3300048927 Bacteria 3063
236 Ga0496124_0242245 3300048927 Bacteria 1340
237 Ga0496125_0001558 3300048928 Bacteria 32726
238 Ga0496125_0007272 3300048928 Bacteria 11793
239 Ga0496125_0010637 3300048928 Bacteria 9289
240 Ga0496126_0055302 3300048929 Bacteria 3591
241 Ga0501034_0125472 3300049571 Bacteria 2552
242 Ga0501070_0287418 3300049586 Bacteria 1341
243 Ga0501035_0815011 3300049822 Bacteria 745
244 Ga0501044_0792138 3300049823 Bacteria 828
245 nmdc:mga0yw44_32484_c1 3300050492 Bacteria 3042
246 nmdc:mga07m45_8639_c2 3300050496 Bacteria 3351
247 nmdc:mga0rr50_358041_c1 3300050513 Bacteria 1228
248 nmdc:mga0sz30_36674_c1 3300050516 Bacteria 2050
249 Ga0495601_0061521 3300053077 Bacteria 2383
250 Ga0500578_0218158 3300053086 Bacteria 1161
251 Ga0500643_043995 3300053087 Bacteria 1300
252 Ga0500644_0062840 3300053088 Bacteria 1314
253 Ga0500581_059537 3300053089 Bacteria 1936
254 Ga0500646_0005758 3300053090 Bacteria 3141
255 Ga0500651_0022096 3300053093 Bacteria 3973
256 Ga0500651_0039260 3300053093 Bacteria 2981
257 Ga0500641_0003501 3300053096 Bacteria 5547
258 Ga0500650_0000191 3300053098 Bacteria 14752
259 Ga0500556_0000002 3300053104 Bacteria 773626
260 Ga0500557_073578 3300053105 Bacteria 1123
261 Ga0500562_005971 3300053108 Bacteria 3066
262 Ga0500593_181516 3300053117 Bacteria 781
263 Ga0500595_001867 3300053119 Bacteria 10879
264 Ga0500642_0000066 3300053130 Bacteria 56496
265 Ga0500652_011088 3300053131 Bacteria 3113
266 Ga0500658_0015671 3300053134 Bacteria 2817
267 Ga0500568_0000404 3300053139 Bacteria 32949
268 Ga0500568_0001092 3300053139 Bacteria 18246
269 Ga0500573_0000002 3300053140 Bacteria 407088
270 Ga0500577_0067327 3300053142 Bacteria 1395
271 Ga0500604_0007517 3300053151 Bacteria 2885
272 Ga0500604_0020914 3300053151 Bacteria 1846
273 Ga0500622_0000102 3300053156 Bacteria 86452
274 Ga0500622_0002408 3300053156 Bacteria 13519
275 Ga0500627_0015145 3300053158 Bacteria 2972
276 Ga0500633_0000131 3300053160 Bacteria 10118
277 Ga0500634_0126973 3300053161 Bacteria 1231
278 Ga0500611_001382 3300053727 Bacteria 2654

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009011 Ga0105251_10167993 Ga0105251_101679932 208
2 3300039145 Ga0237816_04028 Ga0237816_04028_239_865 208
3 3300046506 Ga0495583_0014513 Ga0495583_0014513_3577_4206 208
4 3300046512 Ga0495610_0024951 Ga0495610_0024951_2154_2783 208
5 3300046513 Ga0495616_0150603 Ga0495616_0150603_250_879 208
6 3300048091 Ga0495626_0086291 Ga0495626_0086291_667_1296 208
7 3300048919 Ga0496116_0058605 Ga0496116_0058605_1030_1659 208
8 3300048920 Ga0496117_0022386 Ga0496117_0022386_2708_3337 208
9 3300048921 Ga0496118_0022289 Ga0496118_0022289_3442_4071 208
10 3300048924 Ga0496121_0069841 Ga0496121_0069841_824_1453 208
11 3300048925 Ga0496122_0017842 Ga0496122_0017842_2471_3100 208
12 3300048927 Ga0496124_0242245 Ga0496124_0242245_471_1100 208
13 3300048928 Ga0496125_0007272 Ga0496125_0007272_2780_3409 208
14 3300053086 Ga0500578_0218158 Ga0500578_0218158_413_1042 208
15 3300053156 Ga0500622_0000102 Ga0500622_0000102_41405_42034 208
16 3300009177 Ga0105248_10514276 Ga0105248_105142762 210
17 3300048903 Ga0496100_0137545 Ga0496100_0137545_520_1155 210
18 3300048904 Ga0496101_0822134 Ga0496101_0822134_37_672 210
19 3300048905 Ga0496102_0221104 Ga0496102_0221104_516_1151 210
20 3300048906 Ga0496103_0208620 Ga0496103_0208620_79_714 210
21 3300048907 Ga0496104_0003102 Ga0496104_0003102_6581_7216 210
22 3300048908 Ga0496105_0025168 Ga0496105_0025168_796_1431 210
23 3300048909 Ga0496106_0012062 Ga0496106_0012062_4460_5095 210
24 3300048914 Ga0496111_0012129 Ga0496111_0012129_4454_5089 210
25 3300048916 Ga0496113_0161664 Ga0496113_0161664_450_1085 210
26 3300048919 Ga0496116_0047194 Ga0496116_0047194_442_1077 210
27 3300048921 Ga0496118_0085836 Ga0496118_0085836_658_1293 210
28 3300048922 Ga0496119_0016067 Ga0496119_0016067_1510_2145 210
29 3300048923 Ga0496120_0050968 Ga0496120_0050968_212_847 210
30 3300048924 Ga0496121_0092196 Ga0496121_0092196_900_1535 210
31 3300048925 Ga0496122_0235968 Ga0496122_0235968_283_918 210
32 3300048926 Ga0496123_0050095 Ga0496123_0050095_1433_2068 210
33 3300048927 Ga0496124_0012785 Ga0496124_0012785_5775_6410 210
34 3300048928 Ga0496125_0010637 Ga0496125_0010637_6915_7550 210
35 iso_pu_bacteria 2643221688 2644492884 210
36 3300013306 Ga0163162_10060106 Ga0163162_100601063 211
37 iso_pu_bacteria 2508501050 2508725938 211
38 iso_pu_bacteria 2513237160 2514006800 211
39 iso_pu_bacteria 2582581294 2585203222 211
40 iso_pu_bacteria 2582581298 2585226562 211
41 iso_pu_bacteria 2585427529 2585549636 211
42 iso_pu_bacteria 2585427633 2585992652 211
43 iso_pu_bacteria 2643221618 2644106734 211
44 iso_pu_bacteria 2643221626 2644148085 211
45 iso_pu_bacteria 2643221655 2644310038 211
46 iso_pu_bacteria 2643221659 2644331987 211
47 iso_pu_bacteria 2643221698 2644543904 211
48 iso_pu_bacteria 2643221712 2644616256 211
49 iso_pu_bacteria 2687453392 2688595059 211
50 iso_pu_bacteria 2738541293 2738805130 211
51 iso_pu_bacteria 2773857925 2774874697 211
52 iso_pu_bacteria 2802428859 2802727503 211
53 iso_pu_bacteria 2839993093 2839998167 211
54 iso_pu_bacteria 2841846520 2841850905 211
55 iso_pu_bacteria 2842124991 2842129709 211
56 iso_pu_bacteria 2856328259 2856332970 211
57 iso_pu_bacteria 2857524615 2857528357 211
58 iso_pu_bacteria 2869271264 2869277994 211
59 iso_pu_bacteria 2876399893 2876401015 211
60 iso_pu_bacteria 2881161766 2881162025 211
61 iso_pu_bacteria 2916061851 2916063272 211
62 iso_pu_bacteria 2919073203 2919075784 211
63 iso_pu_bacteria 2919100787 2919106071 211
64 iso_pu_bacteria 2957437181 2957441502 211
65 iso_pu_bacteria 2960591022 2960594019 211
66 iso_pu_bacteria 2961136820 2961141836 211
67 iso_pu_bacteria 2965025482 2965027185 211
68 iso_pu_bacteria 2965047637 2965053145 211
69 iso_pu_bacteria 2965102966 2965105218 211
70 iso_pu_bacteria 2970122695 2970127730 211
71 iso_pu_bacteria 2970547951 2970551131 211
72 iso_pu_bacteria 2987652177 2987653056 211
73 iso_pu_bacteria 2987666974 2987669587 211
74 iso_pu_bacteria 2989771324 2989776242 211
75 iso_pu_bacteria 637000159 637074105 211
76 3300005548 Ga0070665_100213392 Ga0070665_1002133923 212
77 3300037466 Ga0395898_0043496 Ga0395898_0043496_3061_3702 212
78 3300037471 Ga0395905_0045309 Ga0395905_0045309_3045_3686 212
79 3300037471 Ga0395905_0698192 Ga0395905_0698192_195_833 212
80 3300038443 Ga0395901_0188288 Ga0395901_0188288_915_1556 212
81 iso_pu_bacteria 2643221634 2644196818 212
82 3300009553 Ga0105249_10416475 Ga0105249_104164751 213
83 3300049586 Ga0501070_0287418 Ga0501070_0287418_106_750 214
84 3300002774 JGI25150J39212_1000041 JGI25150J39212_100004175 215
85 3300003187 JGI25151J46595_10000169 JGI25151J46595_1000016914 215
86 3300003215 JGI25153J46596_10001520 JGI25153J46596_1000152011 215
87 3300003354 JGI25160J50197_1024867 JGI25160J50197_10248672 215
88 3300003771 Ga0055526_1038348 Ga0055526_10383481 215
89 3300003790 Ga0055528_1005948 Ga0055528_10059483 215
90 3300005334 Ga0068869_100039055 Ga0068869_1000390552 215
91 3300005335 Ga0070666_10069477 Ga0070666_100694772 215
92 3300005338 Ga0068868_100013523 Ga0068868_1000135234 215
93 3300005338 Ga0068868_100221264 Ga0068868_1002212642 215
94 3300005339 Ga0070660_100796432 Ga0070660_1007964321 215
95 3300005344 Ga0070661_100018279 Ga0070661_1000182796 215
96 3300005344 Ga0070661_100256023 Ga0070661_1002560232 215
97 3300005347 Ga0070668_100057696 Ga0070668_1000576963 215
98 3300005347 Ga0070668_100230443 Ga0070668_1002304432 215
99 3300005355 Ga0070671_100166137 Ga0070671_1001661372 215
100 3300005364 Ga0070673_100124125 Ga0070673_1001241252 215
101 3300005364 Ga0070673_100232834 Ga0070673_1002328342 215
102 3300005366 Ga0070659_100092872 Ga0070659_1000928723 215
103 3300005367 Ga0070667_100001288 Ga0070667_10000128812 215
104 3300005455 Ga0070663_100443481 Ga0070663_1004434811 215
105 3300005455 Ga0070663_100737103 Ga0070663_1007371032 215
106 3300005457 Ga0070662_100034279 Ga0070662_1000342791 215
107 3300005459 Ga0068867_100509752 Ga0068867_1005097521 215
108 3300005548 Ga0070665_100071373 Ga0070665_1000713733 215
109 3300005548 Ga0070665_100178524 Ga0070665_1001785242 215
110 3300005617 Ga0068859_100000068 Ga0068859_10000006826 215
111 3300005618 Ga0068864_100006278 Ga0068864_1000062786 215
112 3300005719 Ga0068861_100061569 Ga0068861_1000615694 215
113 3300005841 Ga0068863_100003596 Ga0068863_1000035968 215
114 3300005842 Ga0068858_100001079 Ga0068858_10000107915 215
115 3300005843 Ga0068860_100008023 Ga0068860_1000080237 215
116 3300005843 Ga0068860_100035646 Ga0068860_1000356465 215
117 3300005844 Ga0068862_100017665 Ga0068862_1000176655 215
118 3300006038 Ga0075365_10068475 Ga0075365_100684752 215
119 3300006051 Ga0075364_10286889 Ga0075364_102868891 215
120 3300006175 Ga0070712_100202800 Ga0070712_1002028002 215
121 3300006186 Ga0075369_10061214 Ga0075369_100612142 215
122 3300006353 Ga0075370_10283496 Ga0075370_102834961 215
123 3300006881 Ga0068865_100093807 Ga0068865_1000938072 215
124 3300006931 Ga0097620_100000068 Ga0097620_10000006826 215
125 3300007076 Ga0075435_100354438 Ga0075435_1003544382 215
126 3300009092 Ga0105250_10045651 Ga0105250_100456512 215
127 3300009093 Ga0105240_10366217 Ga0105240_103662173 215
128 3300009093 Ga0105240_10672658 Ga0105240_106726582 215
129 3300009101 Ga0105247_10052691 Ga0105247_100526913 215
130 3300009147 Ga0114129_11763934 Ga0114129_117639341 215
131 3300009174 Ga0105241_10150803 Ga0105241_101508031 215
132 3300009174 Ga0105241_10463908 Ga0105241_104639082 215
133 3300009176 Ga0105242_10502527 Ga0105242_105025272 215
134 3300009177 Ga0105248_10000071 Ga0105248_10000071101 215
135 3300009177 Ga0105248_10033819 Ga0105248_100338193 215
136 3300009545 Ga0105237_10233818 Ga0105237_102338182 215
137 3300009545 Ga0105237_10592329 Ga0105237_105923292 215
138 3300009553 Ga0105249_10017282 Ga0105249_100172826 215
139 3300009553 Ga0105249_10253546 Ga0105249_102535462 215
140 3300009553 Ga0105249_10597975 Ga0105249_105979751 215
141 3300011119 Ga0105246_10778124 Ga0105246_107781241 215
142 3300013100 Ga0157373_10109603 Ga0157373_101096033 215
143 3300013104 Ga0157370_10251053 Ga0157370_102510532 215
144 3300013297 Ga0157378_10739477 Ga0157378_107394772 215
145 3300013306 Ga0163162_10425450 Ga0163162_104254502 215
146 3300013307 Ga0157372_10388393 Ga0157372_103883932 215
147 3300014325 Ga0163163_10000002 Ga0163163_10000002189 215
148 3300014325 Ga0163163_10000612 Ga0163163_1000061210 215
149 3300014968 Ga0157379_10055810 Ga0157379_100558104 215
150 3300014969 Ga0157376_10063595 Ga0157376_100635955 215
151 3300021384 Ga0213876_10006176 Ga0213876_100061763 215
152 3300022739 Ga0228711_1005330 Ga0228711_10053304 215
153 3300022740 Ga0228710_1005535 Ga0228710_10055354 215
154 3300025245 Ga0207425_1000096 Ga0207425_100009672 215
155 3300025258 Ga0209129_1000188 Ga0209129_100018872 215
156 3300025294 Ga0209025_1000419 Ga0209025_100041972 215
157 3300025294 Ga0209025_1027350 Ga0209025_10273503 215
158 3300025297 Ga0209758_1000347 Ga0209758_100034712 215
159 3300025297 Ga0209758_1032067 Ga0209758_10320672 215
160 3300025297 Ga0209758_1089550 Ga0209758_10895501 215
161 3300025297 Ga0209758_1102757 Ga0209758_11027572 215
162 3300025302 Ga0207426_1000638 Ga0207426_100063822 215
163 3300025900 Ga0207710_10147551 Ga0207710_101475512 215
164 3300025904 Ga0207647_10281294 Ga0207647_102812941 215
165 3300025907 Ga0207645_10005352 Ga0207645_100053529 215
166 3300025913 Ga0207695_10185026 Ga0207695_101850264 215
167 3300025913 Ga0207695_10511867 Ga0207695_105118671 215
168 3300025914 Ga0207671_10080800 Ga0207671_100808002 215
169 3300025915 Ga0207693_10193129 Ga0207693_101931292 215
170 3300025919 Ga0207657_10124078 Ga0207657_101240782 215
171 3300025924 Ga0207694_10180916 Ga0207694_101809162 215
172 3300025931 Ga0207644_10203615 Ga0207644_102036152 215
173 3300025931 Ga0207644_10706236 Ga0207644_107062362 215
174 3300025938 Ga0207704_10047806 Ga0207704_100478062 215
175 3300025938 Ga0207704_10783438 Ga0207704_107834381 215
176 3300025941 Ga0207711_10000046 Ga0207711_1000004674 215
177 3300025941 Ga0207711_10022598 Ga0207711_100225983 215
178 3300025941 Ga0207711_10227050 Ga0207711_102270503 215
179 3300025941 Ga0207711_10277798 Ga0207711_102777982 215
180 3300025942 Ga0207689_10262456 Ga0207689_102624562 215
181 3300025944 Ga0207661_10035264 Ga0207661_100352643 215
182 3300025960 Ga0207651_10109332 Ga0207651_101093322 215
183 3300025960 Ga0207651_10161998 Ga0207651_101619981 215
184 3300025972 Ga0207668_10060165 Ga0207668_100601653 215
185 3300025972 Ga0207668_10210968 Ga0207668_102109682 215
186 3300025972 Ga0207668_11085322 Ga0207668_110853221 215
187 3300025986 Ga0207658_10003511 Ga0207658_100035116 215
188 3300025986 Ga0207658_10422481 Ga0207658_104224811 215
189 3300026023 Ga0207677_10007531 Ga0207677_100075313 215
190 3300026035 Ga0207703_10001528 Ga0207703_1000152814 215
191 3300026035 Ga0207703_10747035 Ga0207703_107470352 215
192 3300026088 Ga0207641_10000534 Ga0207641_1000053426 215
193 3300026095 Ga0207676_10000449 Ga0207676_1000044929 215
194 3300027111 Ga0209281_1001106 Ga0209281_10011064 215
195 3300027666 Ga0209282_1000700 Ga0209282_10007003 215
196 3300028379 Ga0268266_10037430 Ga0268266_100374304 215
197 3300028379 Ga0268266_10670916 Ga0268266_106709162 215
198 3300028379 Ga0268266_10702825 Ga0268266_107028252 215
199 3300028380 Ga0268265_10003173 Ga0268265_100031737 215
200 3300028380 Ga0268265_10037627 Ga0268265_100376274 215
201 3300028381 Ga0268264_10000395 Ga0268264_1000039542 215
202 3300028381 Ga0268264_10271884 Ga0268264_102718842 215
203 3300028794 Ga0307515_10082417 Ga0307515_100824174 215
204 3300031456 Ga0307513_10386404 Ga0307513_103864042 215
205 3300031548 Ga0307408_100435290 Ga0307408_1004352902 215
206 3300031901 Ga0307406_10143463 Ga0307406_101434632 215
207 3300031911 Ga0307412_10296900 Ga0307412_102969002 215
208 3300031967 Ga0315914_1000095 Ga0315914_100009522 215
209 3300031995 Ga0307409_100190764 Ga0307409_1001907643 215
210 3300032005 Ga0307411_10112287 Ga0307411_101122872 215
211 3300033430 Ga0315913_1003885 Ga0315913_100388521 215
212 3300033464 Ga0315915_1000023 Ga0315915_100002322 215
213 3300037312 Ga0395899_0003407 Ga0395899_0003407_8632_9315 215
214 3300037312 Ga0395899_0025824 Ga0395899_0025824_2504_3151 215
215 3300037418 Ga0395900_0000130 Ga0395900_0000130_44207_44890 215
216 3300037418 Ga0395900_0003895 Ga0395900_0003895_2793_3440 215
217 3300037418 Ga0395900_0037676 Ga0395900_0037676_4245_4919 215
218 3300037418 Ga0395900_0048848 Ga0395900_0048848_357_1004 215
219 3300037418 Ga0395900_0050083 Ga0395900_0050083_2335_2982 215
220 3300037418 Ga0395900_0080975 Ga0395900_0080975_350_997 215
221 3300037418 Ga0395900_0122777 Ga0395900_0122777_1475_2128 215
222 3300037418 Ga0395900_0285098 Ga0395900_0285098_619_1266 215
223 3300037466 Ga0395898_0000274 Ga0395898_0000274_114169_114852 215
224 3300037466 Ga0395898_0010287 Ga0395898_0010287_2052_2699 215
225 3300037466 Ga0395898_0017479 Ga0395898_0017479_4664_5338 215
226 3300037466 Ga0395898_0122471 Ga0395898_0122471_1562_2209 215
227 3300037466 Ga0395898_0584216 Ga0395898_0584216_283_930 215
228 3300037471 Ga0395905_0000287 Ga0395905_0000287_12066_12749 215
229 3300037471 Ga0395905_0011694 Ga0395905_0011694_813_1460 215
230 3300037471 Ga0395905_0013648 Ga0395905_0013648_3875_4522 215
231 3300037471 Ga0395905_0017889 Ga0395905_0017889_331_978 215
232 3300037471 Ga0395905_0018130 Ga0395905_0018130_1529_2176 215
233 3300037471 Ga0395905_0020531 Ga0395905_0020531_4424_5098 215
234 3300037471 Ga0395905_0057107 Ga0395905_0057107_2591_3238 215
235 3300037471 Ga0395905_0064906 Ga0395905_0064906_1266_1919 215
236 3300037471 Ga0395905_0074425 Ga0395905_0074425_2115_2783 215
237 3300037471 Ga0395905_0075052 Ga0395905_0075052_1121_1768 215
238 3300037471 Ga0395905_0667012 Ga0395905_0667012_194_841 215
239 3300038443 Ga0395901_0000613 Ga0395901_0000613_35832_36515 215
240 3300038443 Ga0395901_0017657 Ga0395901_0017657_866_1513 215
241 3300038443 Ga0395901_0040376 Ga0395901_0040376_3504_4151 215
242 3300038443 Ga0395901_0066177 Ga0395901_0066177_813_1460 215
243 3300038443 Ga0395901_0187072 Ga0395901_0187072_359_1012 215
244 3300038443 Ga0395901_0194745 Ga0395901_0194745_1277_1924 215
245 3300038443 Ga0395901_0244012 Ga0395901_0244012_270_917 215
246 3300038443 Ga0395901_0269952 Ga0395901_0269952_278_952 215
247 3300039437 Ga0436365_0286234 Ga0436365_0286234_1279_1926 215
248 3300045976 Ga0466967_0006754 Ga0466967_0006754_4959_5633 215
249 3300046454 Ga0495592_0054815 Ga0495592_0054815_1355_2008 215
250 3300046460 Ga0495638_0009241 Ga0495638_0009241_3029_3685 215
251 3300046492 Ga0495585_0166683 Ga0495585_0166683_323_970 215
252 3300046501 Ga0495607_0032651 Ga0495607_0032651_2335_2991 215
253 3300046507 Ga0495606_0002576 Ga0495606_0002576_445_1095 215
254 3300046507 Ga0495606_0236118 Ga0495606_0236118_171_827 215
255 3300046512 Ga0495610_0037025 Ga0495610_0037025_714_1370 215
256 3300046513 Ga0495616_0043745 Ga0495616_0043745_934_1590 215
257 3300046515 Ga0495620_0079750 Ga0495620_0079750_160_816 215
258 3300046519 Ga0495632_0016123 Ga0495632_0016123_3415_4071 215
259 3300046530 Ga0495654_0058020 Ga0495654_0058020_788_1444 215
260 3300046542 Ga0495597_0082140 Ga0495597_0082140_27_683 215
261 3300046557 Ga0495622_0007581 Ga0495622_0007581_2906_3568 215
262 3300046616 Ga0495668_0048371 Ga0495668_0048371_766_1422 215
263 3300046616 Ga0495668_0076515 Ga0495668_0076515_1061_1708 215
264 3300046660 Ga0495625_0001951 Ga0495625_0001951_22151_22798 215
265 3300046665 Ga0495661_0003247 Ga0495661_0003247_11056_11712 215
266 3300046678 Ga0495599_0048159 Ga0495599_0048159_240_893 215
267 3300046684 Ga0495669_0037165 Ga0495669_0037165_590_1237 215
268 3300046691 Ga0495670_0008491 Ga0495670_0008491_2055_2711 215
269 3300046810 Ga0495660_0141736 Ga0495660_0141736_174_830 215
270 3300047472 Ga0495686_0002808 Ga0495686_0002808_7002_7784 215
271 3300047472 Ga0495686_0059161 Ga0495686_0059161_723_1379 215
272 3300048913 Ga0496110_0710270 Ga0496110_0710270_160_807 215
273 3300048916 Ga0496113_0520364 Ga0496113_0520364_114_761 215
274 3300048919 Ga0496116_0003769 Ga0496116_0003769_2363_3010 215
275 3300048919 Ga0496116_0104500 Ga0496116_0104500_347_1003 215
276 3300048920 Ga0496117_0055655 Ga0496117_0055655_1996_2652 215
277 3300048922 Ga0496119_0276847 Ga0496119_0276847_116_766 215
278 3300048924 Ga0496121_0012621 Ga0496121_0012621_8189_8839 215
279 3300048924 Ga0496121_0442064 Ga0496121_0442064_68_715 215
280 3300048925 Ga0496122_0086625 Ga0496122_0086625_438_1085 215
281 3300048926 Ga0496123_0008314 Ga0496123_0008314_7020_7676 215
282 3300048927 Ga0496124_0064318 Ga0496124_0064318_951_1598 215
283 3300048928 Ga0496125_0001558 Ga0496125_0001558_4212_4868 215
284 3300048929 Ga0496126_0055302 Ga0496126_0055302_550_1206 215
285 3300049571 Ga0501034_0125472 Ga0501034_0125472_1333_1980 215
286 3300049822 Ga0501035_0815011 Ga0501035_0815011_46_696 215
287 3300049823 Ga0501044_0792138 Ga0501044_0792138_81_731 215
288 3300050492 nmdc:mga0yw44_32484_c1 nmdc:mga0yw44_32484_c1_421_1077 215
289 3300050496 nmdc:mga07m45_8639_c2 nmdc:mga07m45_8639_c2_2554_3201 215
290 3300050513 nmdc:mga0rr50_358041_c1 nmdc:mga0rr50_358041_c1_409_1056 215
291 3300050516 nmdc:mga0sz30_36674_c1 nmdc:mga0sz30_36674_c1_1338_1994 215
292 3300053077 Ga0495601_0061521 Ga0495601_0061521_1600_2253 215
293 3300053087 Ga0500643_043995 Ga0500643_043995_146_802 215
294 3300053088 Ga0500644_0062840 Ga0500644_0062840_39_689 215
295 3300053089 Ga0500581_059537 Ga0500581_059537_378_1034 215
296 3300053090 Ga0500646_0005758 Ga0500646_0005758_1694_2350 215
297 3300053093 Ga0500651_0022096 Ga0500651_0022096_1171_1827 215
298 3300053093 Ga0500651_0039260 Ga0500651_0039260_2064_2714 215
299 3300053096 Ga0500641_0003501 Ga0500641_0003501_2371_3027 215
300 3300053098 Ga0500650_0000191 Ga0500650_0000191_12672_13328 215
301 3300053104 Ga0500556_0000002 Ga0500556_0000002_260079_260735 215
302 3300053105 Ga0500557_073578 Ga0500557_073578_371_1027 215
303 3300053108 Ga0500562_005971 Ga0500562_005971_1880_2536 215
304 3300053117 Ga0500593_181516 Ga0500593_181516_78_734 215
305 3300053119 Ga0500595_001867 Ga0500595_001867_8733_9395 215
306 3300053130 Ga0500642_0000066 Ga0500642_0000066_11571_12227 215
307 3300053131 Ga0500652_011088 Ga0500652_011088_1414_2070 215
308 3300053134 Ga0500658_0015671 Ga0500658_0015671_493_1143 215
309 3300053139 Ga0500568_0000404 Ga0500568_0000404_26965_27615 215
310 3300053139 Ga0500568_0001092 Ga0500568_0001092_4721_5377 215
311 3300053140 Ga0500573_0000002 Ga0500573_0000002_172031_172678 215
312 3300053142 Ga0500577_0067327 Ga0500577_0067327_158_814 215
313 3300053151 Ga0500604_0007517 Ga0500604_0007517_1527_2183 215
314 3300053151 Ga0500604_0020914 Ga0500604_0020914_1157_1807 215
315 3300053156 Ga0500622_0002408 Ga0500622_0002408_6859_7515 215
316 3300053158 Ga0500627_0015145 Ga0500627_0015145_1457_2104 215
317 3300053160 Ga0500633_0000131 Ga0500633_0000131_3059_3709 215
318 3300053161 Ga0500634_0126973 Ga0500634_0126973_319_975 215
319 3300053727 Ga0500611_001382 Ga0500611_001382_1519_2175 215
320 iso_pu_bacteria 2882456835 2882461034 215

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dk9-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.8039 6 201
6dkd-assembly2.cif.gz_C yeast ddi2 cyanamide hydratase 0.8025 6 195
6dka-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.7985 6 200
6dk9-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.7344 6 201
6dka-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.7258 6 200
ID Description Score Start End Superfamily
af_P0CH63_33_194_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9212 16 171 1.10.3210.10
af_P0CH63_33_194_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8834 16 171 1.10.3210.10
af_Q59066_3_118_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6862 61 130 1.10.3210.10
af_Q58247_43_183_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6591 30 138 1.10.3210.10
af_Q58426_28_188_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.623 18 135 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A2V9X7X6-F1-model_v4 HD domain-containing protein 0.9539 7 161
AF-A0A530LD03-F1-model_v4 HD domain-containing protein 0.953 1 194
AF-A0A530LD03-F1-model_v4 HD domain-containing protein 0.9481 1 194
AF-A0A2V9X7X6-F1-model_v4 HD domain-containing protein 0.9479 7 161
AF-A0A069P2D5-F1-model_v4 Phosphohydrolase 0.9474 36 134 GO:0016787

Feature Viewer

pLDDT pTM Quality
89.89 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map