F405571

General Info

Members Datasets Scaffolds Average Seq Length
320 176 628 209

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_10796644|Ga0207708_107966441
Length 229
Sequence VDSPARVRGSGRGCLDNEGMPTRLRRRRSGPDQDQTTESKIQKLRALFADAPEVGKKALENALHELKSQASDLPPAVESAGRIGSRLGKVSELTIIVPLAPGGAQRLRAFLRVLRGNLSQGADKVGTLHTMRFVFFDNDTRLLFATAFDGDWDTYIDDFVTKIPDYLDIIDSAWDGWPGIRSPGAKDYLAAHQITAEGWYVAYPDMTVAEILRLKRIGKAVDELLDKVG

Samples

Sample ID Description Type Environment
1 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
81 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
133 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
141 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
144 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 2.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.12
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 4.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207708_10796644 3300026075 Bacteria 813
2 JGI24752J21851_1007805 3300001976 Bacteria 1396
3 Ga0065715_10106597 3300005293 Bacteria 2815
4 Ga0070658_10142190 3300005327 Bacteria 2005
5 Ga0070683_100005791 3300005329 Bacteria 10333
6 Ga0070683_100055441 3300005329 Bacteria 3678
7 Ga0070683_100574995 3300005329 Bacteria 1078
8 Ga0070683_100834624 3300005329 Bacteria 884
9 Ga0070670_100971690 3300005331 Bacteria 772
10 Ga0068869_100173786 3300005334 Bacteria 1685
11 Ga0068869_100292369 3300005334 Unclassified 1313
12 Ga0070666_10166525 3300005335 Bacteria 1542
13 Ga0070682_100021333 3300005337 Bacteria 3820
14 Ga0070682_100324356 3300005337 Bacteria 1139
15 Ga0070660_100585775 3300005339 Bacteria 932
16 Ga0070689_100050537 3300005340 Bacteria 3212
17 Ga0070668_100000592 3300005347 Bacteria 24269
18 Ga0070668_100183727 3300005347 Bacteria 1709
19 Ga0070668_100254665 3300005347 Bacteria 1458
20 Ga0070669_100164592 3300005353 Bacteria 1726
21 Ga0070669_100326825 3300005353 Bacteria 1240
22 Ga0070671_100048000 3300005355 Bacteria 3550
23 Ga0070671_100526573 3300005355 Bacteria 1018
24 Ga0070671_100537672 3300005355 Bacteria 1007
25 Ga0070673_100208598 3300005364 Bacteria 1686
26 Ga0070659_100204166 3300005366 Bacteria 1627
27 Ga0070659_100278717 3300005366 Bacteria 1391
28 Ga0070659_100809607 3300005366 Bacteria 815
29 Ga0070667_100136770 3300005367 Bacteria 2143
30 Ga0070709_10100594 3300005434 Bacteria 1925
31 Ga0070714_100046066 3300005435 Bacteria 3698
32 Ga0070714_100309555 3300005435 Bacteria 1474
33 Ga0070714_101085496 3300005435 Bacteria 780
34 Ga0070710_10362978 3300005437 Bacteria 962
35 Ga0070711_100073741 3300005439 Bacteria 2412
36 Ga0070700_100137059 3300005441 Bacteria 1659
37 Ga0070663_100217525 3300005455 Bacteria 1498
38 Ga0070663_100705082 3300005455 Bacteria 858
39 Ga0070662_100108675 3300005457 Bacteria 2110
40 Ga0070662_100163631 3300005457 Bacteria 1742
41 Ga0070662_100689011 3300005457 Bacteria 864
42 Ga0070662_100700793 3300005457 Unclassified 857
43 Ga0068867_100441601 3300005459 Bacteria 1106
44 Ga0070706_100106205 3300005467 Bacteria 2612
45 Ga0070699_100164325 3300005518 Bacteria 1966
46 Ga0070684_100031586 3300005535 Bacteria 4510
47 Ga0070672_100068502 3300005543 Bacteria 2815
48 Ga0070672_100091409 3300005543 Bacteria 2455
49 Ga0070696_100188592 3300005546 Bacteria 1533
50 Ga0070665_100010990 3300005548 Bacteria 9152
51 Ga0070664_100255080 3300005564 Bacteria 1577
52 Ga0070664_100283220 3300005564 Bacteria 1495
53 Ga0068857_100158581 3300005577 Bacteria 2052
54 Ga0068857_100194067 3300005577 Bacteria 1850
55 Ga0068857_100225776 3300005577 Bacteria 1712
56 Ga0068854_100046683 3300005578 Bacteria 3084
57 Ga0068854_101016315 3300005578 Bacteria 735
58 Ga0068856_100020780 3300005614 Bacteria 6381
59 Ga0068856_100165192 3300005614 Bacteria 2225
60 Ga0068859_100168236 3300005617 Bacteria 2272
61 Ga0068859_100647776 3300005617 Bacteria 1148
62 Ga0068864_100507848 3300005618 Bacteria 1161
63 Ga0068861_100014122 3300005719 Bacteria 5601
64 Ga0068861_100116595 3300005719 Bacteria 2148
65 Ga0068861_100189281 3300005719 Unclassified 1719
66 Ga0068861_100448120 3300005719 Bacteria 1156
67 Ga0068851_10133677 3300005834 Bacteria 1343
68 Ga0068851_10552555 3300005834 Unclassified 696
69 Ga0068870_10327776 3300005840 Bacteria 975
70 Ga0068870_10405960 3300005840 Bacteria 888
71 Ga0068863_100001469 3300005841 Bacteria 23375
72 Ga0068863_100013748 3300005841 Bacteria 7802
73 Ga0068863_100116299 3300005841 Bacteria 2548
74 Ga0068863_100142161 3300005841 Bacteria 2294
75 Ga0068863_100386481 3300005841 Bacteria 1367
76 Ga0068858_100007403 3300005842 Bacteria 10618
77 Ga0068858_100256648 3300005842 Bacteria 1661
78 Ga0068862_100004191 3300005844 Bacteria 12212
79 Ga0068862_100018314 3300005844 Bacteria 5832
80 Ga0081455_10002062 3300005937 Bacteria 24040
81 Ga0081455_10033041 3300005937 Bacteria 4653
82 Ga0081540_1003347 3300005983 Bacteria 12711
83 Ga0081540_1079203 3300005983 Bacteria 1486
84 Ga0075432_10064267 3300006058 Bacteria 1310
85 Ga0070716_100164984 3300006173 Bacteria 1439
86 Ga0070712_100377217 3300006175 Bacteria 1167
87 Ga0068871_100712664 3300006358 Bacteria 920
88 Ga0075428_100149880 3300006844 Bacteria 2534
89 Ga0075431_100080421 3300006847 Bacteria 3365
90 Ga0075433_10082027 3300006852 Bacteria 2844
91 Ga0075434_100074064 3300006871 Bacteria 3398
92 Ga0075434_100204602 3300006871 Bacteria 1994
93 Ga0075434_100265775 3300006871 Bacteria 1735
94 Ga0075436_100362708 3300006914 Bacteria 1045
95 Ga0097620_100168229 3300006931 Bacteria 2272
96 Ga0075435_100201774 3300007076 Bacteria 1685
97 Ga0075435_100225004 3300007076 Bacteria 1593
98 Ga0075435_100229665 3300007076 Bacteria 1576
99 Ga0111539_10054446 3300009094 Bacteria 4760
100 Ga0111539_10079158 3300009094 Bacteria 3866
101 Ga0111539_10158235 3300009094 Bacteria 2650
102 Ga0111539_10194025 3300009094 Bacteria 2369
103 Ga0111539_10239834 3300009094 Bacteria 2110
104 Ga0105245_10352553 3300009098 Bacteria 1459
105 Ga0105245_10479513 3300009098 Bacteria 1257
106 Ga0105241_10844044 3300009174 Bacteria 847
107 Ga0105242_10373463 3300009176 Bacteria 1323
108 Ga0105242_10737520 3300009176 Bacteria 968
109 Ga0105248_10012663 3300009177 Bacteria 9308
110 Ga0105248_10107100 3300009177 Bacteria 3152
111 Ga0105237_10274291 3300009545 Bacteria 1689
112 Ga0105238_10042417 3300009551 Bacteria 4606
113 Ga0105238_10257287 3300009551 Bacteria 1725
114 Ga0105238_10400049 3300009551 Bacteria 1366
115 Ga0105249_10006873 3300009553 Bacteria 9920
116 Ga0105249_10042707 3300009553 Bacteria 4124
117 Ga0105249_10514501 3300009553 Bacteria 1244
118 Ga0105249_10708083 3300009553 Unclassified 1067
119 Ga0105239_10058771 3300010375 Bacteria 4220
120 Ga0105239_10210113 3300010375 Bacteria 2181
121 Ga0105239_10997649 3300010375 Bacteria 963
122 Ga0105239_11169981 3300010375 Unclassified 886
123 Ga0105246_10252331 3300011119 Bacteria 1401
124 Ga0157371_10394843 3300013102 Bacteria 1011
125 Ga0157369_10001255 3300013105 Bacteria 31570
126 Ga0157374_10302207 3300013296 Bacteria 1583
127 Ga0157378_10475151 3300013297 Bacteria 1245
128 Ga0163162_10333805 3300013306 Unclassified 1648
129 Ga0163162_10825300 3300013306 Bacteria 1043
130 Ga0157372_10000006 3300013307 Bacteria 354669
131 Ga0157372_10172239 3300013307 Bacteria 2505
132 Ga0157372_10308847 3300013307 Bacteria 1840
133 Ga0157375_10019456 3300013308 Bacteria 6175
134 Ga0157375_10154985 3300013308 Bacteria 2429
135 Ga0157375_10402432 3300013308 Bacteria 1535
136 Ga0163163_10348573 3300014325 Bacteria 1536
137 Ga0163163_10474478 3300014325 Bacteria 1312
138 Ga0163163_10899276 3300014325 Bacteria 949
139 Ga0157380_10064893 3300014326 Bacteria 2932
140 Ga0157380_10326869 3300014326 Bacteria 1424
141 Ga0182008_10042673 3300014497 Bacteria 2259
142 Ga0182008_10310972 3300014497 Bacteria 827
143 Ga0157377_10113137 3300014745 Bacteria 1634
144 Ga0157377_10210757 3300014745 Bacteria 1239
145 Ga0157379_10040214 3300014968 Bacteria 4172
146 Ga0157379_10153135 3300014968 Bacteria 2080
147 Ga0157376_10299290 3300014969 Bacteria 1522
148 Ga0182005_1107670 3300015265 Bacteria 785
149 Ga0182005_1143718 3300015265 Bacteria 691
150 Ga0206356_10427499 3300020070 Bacteria 899
151 Ga0213876_10000262 3300021384 Bacteria 48652
152 Ga0213875_10000009 3300021388 Bacteria 451129
153 Ga0213875_10015175 3300021388 Bacteria 3752
154 Ga0213875_10067268 3300021388 Bacteria 1674
155 Ga0207697_10189742 3300025315 Bacteria 902
156 Ga0207656_10026632 3300025321 Bacteria 2360
157 Ga0207680_10012608 3300025903 Bacteria 4311
158 Ga0207647_10040976 3300025904 Bacteria 2914
159 Ga0207699_10049454 3300025906 Bacteria 2475
160 Ga0207645_10136863 3300025907 Bacteria 1595
161 Ga0207684_10014595 3300025910 Bacteria 6769
162 Ga0207662_10190070 3300025918 Bacteria 1325
163 Ga0207662_10204451 3300025918 Bacteria 1279
164 Ga0207657_10510160 3300025919 Bacteria 941
165 Ga0207657_10733918 3300025919 Bacteria 766
166 Ga0207681_10147872 3300025923 Bacteria 1757
167 Ga0207681_10371351 3300025923 Bacteria 1149
168 Ga0207694_10105407 3300025924 Bacteria 2238
169 Ga0207687_10089248 3300025927 Bacteria 2244
170 Ga0207664_10211060 3300025929 Bacteria 1680
171 Ga0207664_10721744 3300025929 Bacteria 896
172 Ga0207644_10006573 3300025931 Bacteria 7575
173 Ga0207690_10440036 3300025932 Bacteria 1046
174 Ga0207706_10051400 3300025933 Bacteria 3639
175 Ga0207706_10161934 3300025933 Bacteria 1967
176 Ga0207706_10625769 3300025933 Unclassified 923
177 Ga0207670_10023807 3300025936 Bacteria 3817
178 Ga0207670_10763748 3300025936 Bacteria 804
179 Ga0207704_10289177 3300025938 Bacteria 1250
180 Ga0207691_10016458 3300025940 Bacteria 7020
181 Ga0207691_10046628 3300025940 Bacteria 3981
182 Ga0207711_10002880 3300025941 Bacteria 15072
183 Ga0207711_10281357 3300025941 Bacteria 1532
184 Ga0207689_10193591 3300025942 Bacteria 1678
185 Ga0207689_10295724 3300025942 Unclassified 1342
186 Ga0207661_10005482 3300025944 Bacteria 8950
187 Ga0207661_10061736 3300025944 Bacteria 3029
188 Ga0207679_10423570 3300025945 Bacteria 1175
189 Ga0207679_10473727 3300025945 Bacteria 1114
190 Ga0207679_10535139 3300025945 Bacteria 1049
191 Ga0207712_10000470 3300025961 Bacteria 33957
192 Ga0207712_10008273 3300025961 Bacteria 6575
193 Ga0207712_10029137 3300025961 Bacteria 3700
194 Ga0207712_10148388 3300025961 Bacteria 1808
195 Ga0207712_10374772 3300025961 Bacteria 1189
196 Ga0207668_10000697 3300025972 Bacteria 20597
197 Ga0207668_10001658 3300025972 Bacteria 12995
198 Ga0207668_10004726 3300025972 Bacteria 8010
199 Ga0207668_10259373 3300025972 Bacteria 1416
200 Ga0207658_10010798 3300025986 Bacteria 6214
201 Ga0207658_10054797 3300025986 Bacteria 2952
202 Ga0207677_10586504 3300026023 Bacteria 976
203 Ga0207703_10006758 3300026035 Bacteria 9148
204 Ga0207639_10599797 3300026041 Bacteria 1015
205 Ga0207639_10718265 3300026041 Bacteria 928
206 Ga0207678_10426630 3300026067 Bacteria 1150
207 Ga0207678_10708500 3300026067 Bacteria 886
208 Ga0207708_10038677 3300026075 Bacteria 3634
209 Ga0207708_10366928 3300026075 Bacteria 1184
210 Ga0207702_10058731 3300026078 Bacteria 3274
211 Ga0207702_10274786 3300026078 Bacteria 1590
212 Ga0207641_10000837 3300026088 Bacteria 32751
213 Ga0207641_10016756 3300026088 Bacteria 6002
214 Ga0207641_10108945 3300026088 Unclassified 2452
215 Ga0207641_10272595 3300026088 Bacteria 1588
216 Ga0207641_10308439 3300026088 Bacteria 1497
217 Ga0207674_10053983 3300026116 Bacteria 4093
218 Ga0207674_10212039 3300026116 Bacteria 1886
219 Ga0207674_10246523 3300026116 Bacteria 1733
220 Ga0207675_100008279 3300026118 Bacteria 9796
221 Ga0207675_100085156 3300026118 Bacteria 2966
222 Ga0207675_100159503 3300026118 Bacteria 2151
223 Ga0207675_100202223 3300026118 Bacteria 1908
224 Ga0207675_100316714 3300026118 Unclassified 1522
225 Ga0207675_100525833 3300026118 Bacteria 1180
226 Ga0207428_10001136 3300027907 Bacteria 28891
227 Ga0207428_10019824 3300027907 Bacteria 5729
228 Ga0268266_10008322 3300028379 Bacteria 9238
229 Ga0268265_10001191 3300028380 Bacteria 22649
230 Ga0268265_10019782 3300028380 Bacteria 4687
231 Ga0268265_10141510 3300028380 Bacteria 2015
232 Ga0307408_100008078 3300031548 Bacteria 6956
233 Ga0307406_10004664 3300031901 Bacteria 7466
234 Ga0395898_0037611 3300037466 Bacteria 4800
235 Ga0395905_0171352 3300037471 Bacteria 2039
236 Ga0436364_0287104 3300037853 Bacteria 8155
237 Ga0436364_1345244 3300037853 Bacteria 104196
238 Ga0395901_0106625 3300038443 Bacteria 2941
239 Ga0436365_0166741 3300039437 Bacteria 1113
240 Ga0436365_1120687 3300039437 Bacteria 61803
241 Ga0436365_1632042 3300039437 Bacteria 2437
242 Ga0436360_0207262 3300039438 Bacteria 1419
243 Ga0436361_0119211 3300039447 Bacteria 1382
244 Ga0436363_1569244 3300039450 Bacteria 1448
245 Ga0436363_1691105 3300039450 Bacteria 828
246 Ga0436362_1289411 3300039453 Bacteria 1124
247 Ga0439464_0021364 3300042439 Bacteria 1777
248 Ga0439440_0062429 3300042993 Bacteria 954
249 Ga0466964_0398638 3300044706 Bacteria 718
250 Ga0466957_0518549 3300044842 Bacteria 828
251 Ga0466960_0008804 3300044901 Bacteria 4145
252 Ga0466960_0057033 3300044901 Bacteria 1903
253 Ga0466960_0154894 3300044901 Bacteria 1227
254 Ga0466967_0041854 3300045976 Bacteria 3954
255 Ga0466967_0055035 3300045976 Bacteria 3504
256 Ga0466967_0534893 3300045976 Bacteria 1152
257 Ga0495590_0000406 3300046457 Bacteria 21724
258 Ga0495629_0233481 3300046459 Bacteria 1268
259 Ga0495616_0171383 3300046513 Bacteria 970
260 Ga0495666_0200258 3300046526 Bacteria 918
261 Ga0495625_0018794 3300046660 Bacteria 5383
262 Ga0495649_0072492 3300046694 Bacteria 1846
263 Ga0495672_0076475 3300047320 Bacteria 1880
264 Ga0496100_0269098 3300048903 Bacteria 1266
265 Ga0496101_0435383 3300048904 Bacteria 1034
266 Ga0496102_0011699 3300048905 Bacteria 7572
267 Ga0496102_0079205 3300048905 Bacteria 3026
268 Ga0496102_0196741 3300048905 Bacteria 1900
269 Ga0496102_0396210 3300048905 Bacteria 1298
270 Ga0496102_0885482 3300048905 Bacteria 814
271 Ga0496102_0962315 3300048905 Bacteria 775
272 Ga0496103_0185616 3300048906 Bacteria 1337
273 Ga0496103_0402539 3300048906 Unclassified 879
274 Ga0496104_0574430 3300048907 Bacteria 1038
275 Ga0496106_0006982 3300048909 Bacteria 8343
276 Ga0496107_0041253 3300048910 Bacteria 3314
277 Ga0496107_0430752 3300048910 Bacteria 980
278 Ga0496108_0151203 3300048911 Bacteria 2003
279 Ga0496108_0795643 3300048911 Bacteria 816
280 Ga0496108_0865965 3300048911 Bacteria 777
281 Ga0496109_0227628 3300048912 Bacteria 1754
282 Ga0496109_0362729 3300048912 Bacteria 1369
283 Ga0496109_0404504 3300048912 Unclassified 1290
284 Ga0496110_0180277 3300048913 Bacteria 1918
285 Ga0496111_0447974 3300048914 Bacteria 952
286 Ga0496111_0477024 3300048914 Bacteria 919
287 Ga0496112_0188682 3300048915 Bacteria 2024
288 Ga0496112_0742716 3300048915 Bacteria 908
289 Ga0496113_0107119 3300048916 Bacteria 2171
290 Ga0496116_0232388 3300048919 Bacteria 934
291 Ga0496118_0144257 3300048921 Bacteria 1503
292 Ga0496121_0094358 3300048924 Bacteria 2328
293 Ga0495682_0004612 3300049460 Bacteria 5854
294 Ga0501067_0209633 3300049583 Bacteria 1085
295 Ga0501069_0143561 3300049585 Bacteria 1370
296 Ga0501069_0191077 3300049585 Bacteria 1185
297 nmdc:mga05p37_40884_c1 3300050507 Bacteria 5692
298 nmdc:mga09592_607095_c1 3300050508 Bacteria 937
299 nmdc:mga06r32_126572_c1 3300050510 Bacteria 2524
300 nmdc:mga08y16_775606_c1 3300050511 Bacteria 953
301 nmdc:mga0n895_30923_c1 3300050512 Bacteria 5121
302 nmdc:mga0n895_679541_c1 3300050512 Bacteria 1027
303 nmdc:mga0n895_850031_c1 3300050512 Bacteria 900
304 nmdc:mga0rr50_249308_c1 3300050513 Bacteria 1474
305 nmdc:mga08x19_139138_c1 3300050514 Bacteria 1639
306 nmdc:mga0a205_262631_c1 3300050515 Bacteria 1604
307 nmdc:mga0a205_285764_c1 3300050515 Bacteria 1524
308 nmdc:mga0a205_68245_c1 3300050515 Bacteria 3434
309 Ga0587073_0048847 3300059492 Bacteria 952
310 Ga0587083_0077073 3300059505 Bacteria 786
311 Ga0587090_037340 3300059510 Bacteria 840
312 Ga0587079_055335 3300059647 Bacteria 845
313 Ga0587079_061176 3300059647 Bacteria 816
314 Ga0587111_0040667 3300060346 Bacteria 989
315 Ga0207708_10796644
316 JGI24752J21851_1007805
317 Ga0065715_10106597
318 Ga0070658_10142190
319 Ga0070683_100005791
320 Ga0070683_100055441
321 Ga0070683_100574995
322 Ga0070683_100834624
323 Ga0070670_100971690
324 Ga0068869_100173786
325 Ga0068869_100292369
326 Ga0070666_10166525
327 Ga0070682_100021333
328 Ga0070682_100324356
329 Ga0070660_100585775
330 Ga0070689_100050537
331 Ga0070668_100000592
332 Ga0070668_100183727
333 Ga0070668_100254665
334 Ga0070669_100164592
335 Ga0070669_100326825
336 Ga0070671_100048000
337 Ga0070671_100526573
338 Ga0070671_100537672
339 Ga0070673_100208598
340 Ga0070659_100204166
341 Ga0070659_100278717
342 Ga0070659_100809607
343 Ga0070667_100136770
344 Ga0070709_10100594
345 Ga0070714_100046066
346 Ga0070714_100309555
347 Ga0070714_101085496
348 Ga0070710_10362978
349 Ga0070711_100073741
350 Ga0070700_100137059
351 Ga0070663_100217525
352 Ga0070663_100705082
353 Ga0070662_100108675
354 Ga0070662_100163631
355 Ga0070662_100689011
356 Ga0070662_100700793
357 Ga0068867_100441601
358 Ga0070706_100106205
359 Ga0070699_100164325
360 Ga0070684_100031586
361 Ga0070672_100068502
362 Ga0070672_100091409
363 Ga0070696_100188592
364 Ga0070665_100010990
365 Ga0070664_100255080
366 Ga0070664_100283220
367 Ga0068857_100158581
368 Ga0068857_100194067
369 Ga0068857_100225776
370 Ga0068854_100046683
371 Ga0068854_101016315
372 Ga0068856_100020780
373 Ga0068856_100165192
374 Ga0068859_100168236
375 Ga0068859_100647776
376 Ga0068864_100507848
377 Ga0068861_100014122
378 Ga0068861_100116595
379 Ga0068861_100189281
380 Ga0068861_100448120
381 Ga0068851_10133677
382 Ga0068851_10552555
383 Ga0068870_10327776
384 Ga0068870_10405960
385 Ga0068863_100001469
386 Ga0068863_100013748
387 Ga0068863_100116299
388 Ga0068863_100142161
389 Ga0068863_100386481
390 Ga0068858_100007403
391 Ga0068858_100256648
392 Ga0068862_100004191
393 Ga0068862_100018314
394 Ga0081455_10002062
395 Ga0081455_10033041
396 Ga0081540_1003347
397 Ga0081540_1079203
398 Ga0075432_10064267
399 Ga0070716_100164984
400 Ga0070712_100377217
401 Ga0068871_100712664
402 Ga0075428_100149880
403 Ga0075431_100080421
404 Ga0075433_10082027
405 Ga0075434_100074064
406 Ga0075434_100204602
407 Ga0075434_100265775
408 Ga0075436_100362708
409 Ga0097620_100168229
410 Ga0075435_100201774
411 Ga0075435_100225004
412 Ga0075435_100229665
413 Ga0111539_10054446
414 Ga0111539_10079158
415 Ga0111539_10158235
416 Ga0111539_10194025
417 Ga0111539_10239834
418 Ga0105245_10352553
419 Ga0105245_10479513
420 Ga0105241_10844044
421 Ga0105242_10373463
422 Ga0105242_10737520
423 Ga0105248_10012663
424 Ga0105248_10107100
425 Ga0105237_10274291
426 Ga0105238_10042417
427 Ga0105238_10257287
428 Ga0105238_10400049
429 Ga0105249_10006873
430 Ga0105249_10042707
431 Ga0105249_10514501
432 Ga0105249_10708083
433 Ga0105239_10058771
434 Ga0105239_10210113
435 Ga0105239_10997649
436 Ga0105239_11169981
437 Ga0105246_10252331
438 Ga0157371_10394843
439 Ga0157369_10001255
440 Ga0157374_10302207
441 Ga0157378_10475151
442 Ga0163162_10333805
443 Ga0163162_10825300
444 Ga0157372_10000006
445 Ga0157372_10172239
446 Ga0157372_10308847
447 Ga0157375_10019456
448 Ga0157375_10154985
449 Ga0157375_10402432
450 Ga0163163_10348573
451 Ga0163163_10474478
452 Ga0163163_10899276
453 Ga0157380_10064893
454 Ga0157380_10326869
455 Ga0182008_10042673
456 Ga0182008_10310972
457 Ga0157377_10113137
458 Ga0157377_10210757
459 Ga0157379_10040214
460 Ga0157379_10153135
461 Ga0157376_10299290
462 Ga0182005_1107670
463 Ga0182005_1143718
464 Ga0206356_10427499
465 Ga0213876_10000262
466 Ga0213875_10000009
467 Ga0213875_10015175
468 Ga0213875_10067268
469 Ga0207697_10189742
470 Ga0207656_10026632
471 Ga0207680_10012608
472 Ga0207647_10040976
473 Ga0207699_10049454
474 Ga0207645_10136863
475 Ga0207684_10014595
476 Ga0207662_10190070
477 Ga0207662_10204451
478 Ga0207657_10510160
479 Ga0207657_10733918
480 Ga0207681_10147872
481 Ga0207681_10371351
482 Ga0207694_10105407
483 Ga0207687_10089248
484 Ga0207664_10211060
485 Ga0207664_10721744
486 Ga0207644_10006573
487 Ga0207690_10440036
488 Ga0207706_10051400
489 Ga0207706_10161934
490 Ga0207706_10625769
491 Ga0207670_10023807
492 Ga0207670_10763748
493 Ga0207704_10289177
494 Ga0207691_10016458
495 Ga0207691_10046628
496 Ga0207711_10002880
497 Ga0207711_10281357
498 Ga0207689_10193591
499 Ga0207689_10295724
500 Ga0207661_10005482
501 Ga0207661_10061736
502 Ga0207679_10423570
503 Ga0207679_10473727
504 Ga0207679_10535139
505 Ga0207712_10000470
506 Ga0207712_10008273
507 Ga0207712_10029137
508 Ga0207712_10148388
509 Ga0207712_10374772
510 Ga0207668_10000697
511 Ga0207668_10001658
512 Ga0207668_10004726
513 Ga0207668_10259373
514 Ga0207658_10010798
515 Ga0207658_10054797
516 Ga0207677_10586504
517 Ga0207703_10006758
518 Ga0207639_10599797
519 Ga0207639_10718265
520 Ga0207678_10426630
521 Ga0207678_10708500
522 Ga0207708_10038677
523 Ga0207708_10366928
524 Ga0207702_10058731
525 Ga0207702_10274786
526 Ga0207641_10000837
527 Ga0207641_10016756
528 Ga0207641_10108945
529 Ga0207641_10272595
530 Ga0207641_10308439
531 Ga0207674_10053983
532 Ga0207674_10212039
533 Ga0207674_10246523
534 Ga0207675_100008279
535 Ga0207675_100085156
536 Ga0207675_100159503
537 Ga0207675_100202223
538 Ga0207675_100316714
539 Ga0207675_100525833
540 Ga0207428_10001136
541 Ga0207428_10019824
542 Ga0268266_10008322
543 Ga0268265_10001191
544 Ga0268265_10019782
545 Ga0268265_10141510
546 Ga0307408_100008078
547 Ga0307406_10004664
548 Ga0395898_0037611
549 Ga0395905_0171352
550 Ga0436364_0287104
551 Ga0436364_1345244
552 Ga0395901_0106625
553 Ga0436365_0166741
554 Ga0436365_1120687
555 Ga0436365_1632042
556 Ga0436360_0207262
557 Ga0436361_0119211
558 Ga0436363_1569244
559 Ga0436363_1691105
560 Ga0436362_1289411
561 Ga0439464_0021364
562 Ga0439440_0062429
563 Ga0466964_0398638
564 Ga0466957_0518549
565 Ga0466960_0008804
566 Ga0466960_0057033
567 Ga0466960_0154894
568 Ga0466967_0041854
569 Ga0466967_0055035
570 Ga0466967_0534893
571 Ga0495590_0000406
572 Ga0495629_0233481
573 Ga0495616_0171383
574 Ga0495666_0200258
575 Ga0495625_0018794
576 Ga0495649_0072492
577 Ga0495672_0076475
578 Ga0496100_0269098
579 Ga0496101_0435383
580 Ga0496102_0011699
581 Ga0496102_0079205
582 Ga0496102_0196741
583 Ga0496102_0396210
584 Ga0496102_0885482
585 Ga0496102_0962315
586 Ga0496103_0185616
587 Ga0496103_0402539
588 Ga0496104_0574430
589 Ga0496106_0006982
590 Ga0496107_0041253
591 Ga0496107_0430752
592 Ga0496108_0151203
593 Ga0496108_0795643
594 Ga0496108_0865965
595 Ga0496109_0227628
596 Ga0496109_0362729
597 Ga0496109_0404504
598 Ga0496110_0180277
599 Ga0496111_0447974
600 Ga0496111_0477024
601 Ga0496112_0188682
602 Ga0496112_0742716
603 Ga0496113_0107119
604 Ga0496116_0232388
605 Ga0496118_0144257
606 Ga0496121_0094358
607 Ga0495682_0004612
608 Ga0501067_0209633
609 Ga0501069_0143561
610 Ga0501069_0191077
611 nmdc:mga05p37_40884_c1
612 nmdc:mga09592_607095_c1
613 nmdc:mga06r32_126572_c1
614 nmdc:mga08y16_775606_c1
615 nmdc:mga0n895_30923_c1
616 nmdc:mga0n895_679541_c1
617 nmdc:mga0n895_850031_c1
618 nmdc:mga0rr50_249308_c1
619 nmdc:mga08x19_139138_c1
620 nmdc:mga0a205_262631_c1
621 nmdc:mga0a205_285764_c1
622 nmdc:mga0a205_68245_c1
623 Ga0587073_0048847
624 Ga0587083_0077073
625 Ga0587090_037340
626 Ga0587079_055335
627 Ga0587079_061176
628 Ga0587111_0040667

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gz7-assembly1.cif.gz_B crystal structure of putative antibiotic biosynthesis monooxygenase (np_888398.1) from bordetella bronchiseptica at 2.15 a resolution 0.7239 67 151
7byw-assembly1.cif.gz_B crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose-bound form) 0.7178 68 143
6hhn-assembly1.cif.gz_A-2 crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila 0.7132 68 127
6fxd-assembly1.cif.gz_B-2 crystal structure of mupz from pseudomonas fluorescens 0.7036 67 136
2qlw-assembly1.cif.gz_A crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum 0.7019 65 127
ID Description Score Start End Superfamily
af_Q4D015_9_98_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6942 106 124 2.60.40.790
2jdjB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6913 68 143 3.30.70.100
4d6gA03 Mainly Beta;Sandwich;Chondroitinase Ac; Chain A, domain 3;Polysaccharide lyase family 8-like, C-terminal 0.6744 103 126 2.60.220.10
2qlxB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6602 65 127 3.30.70.100
af_Q2FV13_1_138_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6602 67 131 3.30.70.100
ID Description Score Start End GO Terms
AF-Q65Q29-F1-model_v4 L-rhamnose mutarotase (EC 5.1.3.32) (Rhamnose 1-epimerase) (Type-3 mutarotase) 0.7506 68 137 GO:0005737
GO:0019301
GO:0062192
AF-H2YJ08-F1-model_v4 L-rhamnose mutarotase 0.7464 67 151 GO:0016857
AF-A0A534H9B0-F1-model_v4 Uncharacterized protein 0.7444 72 205
AF-A0A1S8TWZ3-F1-model_v4 L-rhamnose mutarotase (EC 5.1.3.32) 0.7434 67 139 GO:0005737
GO:0016857
GO:0019301
AF-A0A6A7Y101-F1-model_v4 L-rhamnose mutarotase 0.7311 68 150 GO:0016857

Map