F405558

General Info

Members Datasets Scaffolds Average Seq Length
320 202 640 123

Family's Representative Sequence

Representative Sequence 3300025908|Ga0207643_11028822|Ga0207643_110288221
Length 110
Sequence MEKPEVTIPDGAPSYQLELEDLEVGTGDEAVAGKVVEVHYVGVSWATGDQFDLGKXQVISGWDQGVTGMKVGGRRQLVIPPHLGYGDRGAGGVIKPGETLVFVVDLVAVN

Samples

Sample ID Description Type Environment
1 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
53 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
54 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
102 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
123 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
124 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
125 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
126 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
129 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
184 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
189 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
190 2643221615 Nocardioides sp. Root224 Isolate Unclassified
191 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
192 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
193 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
194 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
195 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
196 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
197 2891562705 Microbispora tritici MT50 Isolate Unclassified
198 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
199 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
200 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
201 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
202 8054727385 Micromonospora alfalfae MED01 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.31
Metatranscriptomes 0.31
Isolates 4.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.19
Nodule 0.31
Rhizoplane 5.62
Rhizosphere 85.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207643_11028822 3300025908 Bacteria 532
2 JGI24735J21928_10096175 3300002067 Bacteria 850
3 Ga0070676_10038585 3300005328 Bacteria 2759
4 Ga0070683_100454010 3300005329 Bacteria 1223
5 Ga0070677_10573836 3300005333 Bacteria 621
6 Ga0070677_10900773 3300005333 Bacteria 511
7 Ga0068869_100009537 3300005334 Bacteria 6300
8 Ga0070680_100187186 3300005336 Bacteria 1744
9 Ga0068868_100001369 3300005338 Bacteria 16806
10 Ga0068868_100412227 3300005338 Bacteria 1168
11 Ga0070661_100021679 3300005344 Bacteria 4593
12 Ga0070661_100959441 3300005344 Bacteria 708
13 Ga0070692_10044627 3300005345 Bacteria 2284
14 Ga0070692_10117156 3300005345 Bacteria 1481
15 Ga0070692_10459441 3300005345 Bacteria 817
16 Ga0070668_100888896 3300005347 Bacteria 796
17 Ga0070668_100908878 3300005347 Bacteria 787
18 Ga0070675_100011219 3300005354 Bacteria 7014
19 Ga0070675_100249180 3300005354 Bacteria 1554
20 Ga0070671_100837461 3300005355 Bacteria 802
21 Ga0070674_100267674 3300005356 Bacteria 1349
22 Ga0070674_100457282 3300005356 Bacteria 1055
23 Ga0070659_100011638 3300005366 Bacteria 6509
24 Ga0070714_100964222 3300005435 Bacteria 829
25 Ga0070701_10792128 3300005438 Bacteria 646
26 Ga0070700_100060250 3300005441 Bacteria 2392
27 Ga0070700_100068435 3300005441 Bacteria 2258
28 Ga0070708_100309832 3300005445 Bacteria 1487
29 Ga0070663_100007904 3300005455 Bacteria 6511
30 Ga0070663_100612810 3300005455 Bacteria 917
31 Ga0070678_100377193 3300005456 Bacteria 1226
32 Ga0068867_100511678 3300005459 Bacteria 1034
33 Ga0070685_10032735 3300005466 Bacteria 2914
34 Ga0070684_100049333 3300005535 Bacteria 3653
35 Ga0070672_100020919 3300005543 Bacteria 4781
36 Ga0070672_100108743 3300005543 Bacteria 2258
37 Ga0070672_100528856 3300005543 Bacteria 1022
38 Ga0070664_100000639 3300005564 Bacteria 26842
39 Ga0070664_100626392 3300005564 Bacteria 999
40 Ga0068857_100008230 3300005577 Bacteria 9016
41 Ga0070702_100019290 3300005615 Bacteria 3554
42 Ga0070702_100110866 3300005615 Bacteria 1701
43 Ga0070702_100236675 3300005615 Bacteria 1230
44 Ga0070702_100286121 3300005615 Bacteria 1134
45 Ga0068852_100154248 3300005616 Bacteria 2138
46 Ga0068864_100227892 3300005618 Bacteria 1722
47 Ga0068864_100414604 3300005618 Bacteria 1282
48 Ga0068864_100891424 3300005618 Bacteria 878
49 Ga0068866_10056289 3300005718 Bacteria 2022
50 Ga0068861_100143406 3300005719 Bacteria 1952
51 Ga0068870_10084092 3300005840 Bacteria 1766
52 Ga0068863_100424897 3300005841 Bacteria 1302
53 Ga0068858_100897072 3300005842 Bacteria 867
54 Ga0068860_100000301 3300005843 Bacteria 68703
55 Ga0068860_100795001 3300005843 Bacteria 959
56 Ga0068862_100006973 3300005844 Bacteria 9376
57 Ga0081455_10001815 3300005937 Bacteria 25723
58 Ga0075365_10006199 3300006038 Bacteria 6554
59 Ga0075363_100009739 3300006048 Bacteria 4526
60 Ga0075364_10161851 3300006051 Bacteria 1510
61 Ga0075367_10900908 3300006178 Bacteria 564
62 Ga0075430_100213235 3300006846 Bacteria 1602
63 Ga0068865_100803718 3300006881 Bacteria 812
64 Ga0111539_13433441 3300009094 Bacteria 509
65 Ga0105245_10301099 3300009098 Bacteria 1573
66 Ga0105245_12362516 3300009098 Bacteria 585
67 Ga0105248_11435988 3300009177 Bacteria 781
68 Ga0105248_11951028 3300009177 Bacteria 667
69 Ga0105238_10369121 3300009551 Bacteria 1425
70 Ga0105238_10847241 3300009551 Bacteria 931
71 Ga0105249_10929490 3300009553 Bacteria 937
72 Ga0105032_102338 3300009979 Bacteria 1699
73 Ga0105246_10132496 3300011119 Bacteria 1864
74 Ga0105246_11860151 3300011119 Bacteria 577
75 Ga0157336_1021100 3300012477 Bacteria 590
76 Ga0157321_1005122 3300012487 Bacteria 850
77 Ga0157313_1055624 3300012503 Bacteria 527
78 Ga0157371_11348684 3300013102 Bacteria 553
79 Ga0157374_10752847 3300013296 Bacteria 989
80 Ga0157374_11272450 3300013296 Bacteria 757
81 Ga0157374_12527758 3300013296 Bacteria 541
82 Ga0163162_11456061 3300013306 Bacteria 780
83 Ga0157375_11868978 3300013308 Bacteria 712
84 Ga0163163_10148455 3300014325 Bacteria 2389
85 Ga0163163_10552346 3300014325 Bacteria 1214
86 Ga0163163_10656522 3300014325 Bacteria 1112
87 Ga0157380_10230156 3300014326 Bacteria 1664
88 Ga0157380_11988979 3300014326 Bacteria 643
89 Ga0157377_10057553 3300014745 Bacteria 2211
90 Ga0157377_10099649 3300014745 Bacteria 1729
91 Ga0157376_10246782 3300014969 Bacteria 1666
92 Ga0163161_10633207 3300017792 Bacteria 885
93 Ga0163161_10650045 3300017792 Bacteria 874
94 Ga0163161_11386701 3300017792 Bacteria 613
95 Ga0206353_11938910 3300020082 Bacteria 1264
96 Ga0213876_10175036 3300021384 Bacteria 1142
97 Ga0213875_10003948 3300021388 Bacteria 8285
98 Ga0207688_10109214 3300025901 Bacteria 1604
99 Ga0207688_10229893 3300025901 Bacteria 1119
100 Ga0207643_10201639 3300025908 Bacteria 1212
101 Ga0207705_10736966 3300025909 Bacteria 766
102 Ga0207705_11189768 3300025909 Bacteria 585
103 Ga0207654_10700178 3300025911 Bacteria 728
104 Ga0207660_10263549 3300025917 Bacteria 1363
105 Ga0207649_10039764 3300025920 Bacteria 2854
106 Ga0207681_10159602 3300025923 Bacteria 1698
107 Ga0207694_10236722 3300025924 Bacteria 1492
108 Ga0207659_10005558 3300025926 Bacteria 7650
109 Ga0207659_10666777 3300025926 Bacteria 889
110 Ga0207687_10012416 3300025927 Bacteria 5565
111 Ga0207664_11756740 3300025929 Bacteria 543
112 Ga0207644_10671162 3300025931 Bacteria 863
113 Ga0207690_10068960 3300025932 Bacteria 2431
114 Ga0207690_10437731 3300025932 Bacteria 1049
115 Ga0207706_10004720 3300025933 Bacteria 12759
116 Ga0207669_10107663 3300025937 Bacteria 1860
117 Ga0207669_10291133 3300025937 Bacteria 1237
118 Ga0207669_11245653 3300025937 Bacteria 631
119 Ga0207704_11627349 3300025938 Bacteria 555
120 Ga0207691_10128120 3300025940 Bacteria 2244
121 Ga0207691_10131045 3300025940 Bacteria 2215
122 Ga0207691_10442894 3300025940 Bacteria 1106
123 Ga0207689_10032920 3300025942 Bacteria 4308
124 Ga0207661_10283730 3300025944 Bacteria 1481
125 Ga0207640_10129665 3300025981 Bacteria 1821
126 Ga0207640_12147751 3300025981 Bacteria 507
127 Ga0207677_10030914 3300026023 Bacteria 3424
128 Ga0207677_10506837 3300026023 Bacteria 1044
129 Ga0207677_10570387 3300026023 Bacteria 989
130 Ga0207677_11900339 3300026023 Bacteria 553
131 Ga0207703_10276883 3300026035 Bacteria 1522
132 Ga0207678_10014215 3300026067 Bacteria 6998
133 Ga0207678_10100386 3300026067 Bacteria 2472
134 Ga0207678_10118906 3300026067 Bacteria 2255
135 Ga0207708_10028163 3300026075 Bacteria 4254
136 Ga0207708_10421018 3300026075 Bacteria 1107
137 Ga0207641_10306002 3300026088 Bacteria 1503
138 Ga0207648_10318473 3300026089 Bacteria 1397
139 Ga0207676_10112586 3300026095 Bacteria 2280
140 Ga0207674_10013338 3300026116 Bacteria 9125
141 Ga0207675_100064915 3300026118 Bacteria 3412
142 Ga0207683_10007871 3300026121 Bacteria 9118
143 Ga0207683_10061284 3300026121 Bacteria 3311
144 Ga0207683_10241598 3300026121 Bacteria 1647
145 Ga0207698_10208076 3300026142 Bacteria 1758
146 Ga0207698_10259199 3300026142 Bacteria 1596
147 Ga0207428_10007762 3300027907 Bacteria 9764
148 Ga0268266_10561210 3300028379 Bacteria 1095
149 Ga0268265_10011149 3300028380 Bacteria 6075
150 Ga0268264_10000269 3300028381 Bacteria 91321
151 Ga0307515_10027474 3300028794 Bacteria 9726
152 Ga0307512_10182313 3300030522 Bacteria 1177
153 Ga0307509_10123296 3300031507 Bacteria 2564
154 Ga0307405_10705081 3300031731 Bacteria 836
155 Ga0307413_10363786 3300031824 Bacteria 1121
156 Ga0307410_10897978 3300031852 Bacteria 759
157 Ga0326468_10041738 3300031889 Bacteria 658
158 Ga0307406_10099869 3300031901 Bacteria 1974
159 Ga0307406_10118985 3300031901 Bacteria 1833
160 Ga0307407_10033156 3300031903 Bacteria 2815
161 Ga0307407_10944081 3300031903 Bacteria 664
162 Ga0307412_10180614 3300031911 Bacteria 1587
163 Ga0307409_100138371 3300031995 Bacteria 2094
164 Ga0307409_100457804 3300031995 Bacteria 1233
165 Ga0307409_100643921 3300031995 Bacteria 1053
166 Ga0307409_100671311 3300031995 Bacteria 1032
167 Ga0307409_101189841 3300031995 Bacteria 785
168 Ga0307416_101139776 3300032002 Bacteria 885
169 Ga0307416_102430635 3300032002 Bacteria 623
170 Ga0307414_10217858 3300032004 Bacteria 1565
171 Ga0307414_10264574 3300032004 Bacteria 1437
172 Ga0307414_11265151 3300032004 Bacteria 684
173 Ga0307411_10073619 3300032005 Bacteria 2325
174 Ga0307411_10262164 3300032005 Bacteria 1365
175 Ga0307415_101384966 3300032126 Bacteria 669
176 Ga0307415_102024604 3300032126 Bacteria 561
177 Ga0373931_0410824 3300035691 Bacteria 859
178 Ga0373937_0084887 3300036401 Bacteria 2930
179 Ga0395898_0768018 3300037466 Bacteria 905
180 Ga0395905_0468373 3300037471 Bacteria 1159
181 Ga0436364_0463609 3300037853 Bacteria 21667
182 Ga0395901_1221942 3300038443 Bacteria 716
183 Ga0439439_0251385 3300041406 Bacteria 524
184 Ga0451793_1133271 3300041452 Bacteria 691
185 Ga0451793_1570019 3300041452 Bacteria 554
186 Ga0451800_1365523 3300041459 Bacteria 1069
187 Ga0451833_0022253 3300041491 Bacteria 769
188 Ga0451851_0460435 3300041507 Bacteria 775
189 Ga0451853_2271722 3300041512 Bacteria 848
190 Ga0451853_3102857 3300041512 Bacteria 880
191 Ga0439448_0081622 3300042005 Bacteria 1086
192 Ga0439440_0107473 3300042993 Bacteria 765
193 Ga0466961_0889421 3300044693 Bacteria 530
194 Ga0466963_0225518 3300044694 Bacteria 1313
195 Ga0466963_1004378 3300044694 Bacteria 587
196 Ga0466964_0387563 3300044706 Bacteria 727
197 Ga0466968_0312362 3300044735 Bacteria 758
198 Ga0466970_0008221 3300044765 Bacteria 5240
199 Ga0466957_0025900 3300044842 Bacteria 3478
200 Ga0466960_0020229 3300044901 Bacteria 2945
201 Ga0466960_0464667 3300044901 Bacteria 737
202 Ga0466960_0573328 3300044901 Bacteria 668
203 Ga0466967_0174923 3300045976 Bacteria 2022
204 Ga0466967_0496420 3300045976 Bacteria 1197
205 Ga0466967_0507560 3300045976 Bacteria 1184
206 Ga0466967_1932509 3300045976 Bacteria 587
207 Ga0495603_0712104 3300046455 Bacteria 574
208 Ga0495641_0206724 3300046461 Bacteria 880
209 Ga0495653_0141189 3300046463 Bacteria 1694
210 Ga0495650_0276909 3300046471 Bacteria 565
211 Ga0495639_0711681 3300046475 Bacteria 519
212 Ga0495665_0411141 3300046531 Bacteria 686
213 Ga0495635_0460349 3300046663 Bacteria 840
214 Ga0495676_0064868 3300047321 Bacteria 2838
215 Ga0496100_1233258 3300048903 Bacteria 590
216 Ga0496105_0229701 3300048908 Bacteria 1508
217 Ga0496108_0117040 3300048911 Bacteria 2284
218 Ga0496108_0590273 3300048911 Bacteria 968
219 Ga0496109_0638069 3300048912 Bacteria 1002
220 Ga0496110_0336566 3300048913 Bacteria 1375
221 Ga0496110_0732826 3300048913 Bacteria 891
222 Ga0496110_0806315 3300048913 Bacteria 843
223 Ga0496110_1650292 3300048913 Bacteria 551
224 Ga0496111_0137437 3300048914 Bacteria 1811
225 Ga0496112_0008541 3300048915 Bacteria 9178
226 Ga0496113_0623812 3300048916 Bacteria 863
227 Ga0496114_0080656 3300048917 Bacteria 2748
228 Ga0496114_0467211 3300048917 Bacteria 1117
229 Ga0496114_1018814 3300048917 Bacteria 711
230 Ga0496124_0888566 3300048927 Bacteria 542
231 Ga0501031_0007919 3300049568 Bacteria 6916
232 Ga0501032_0002092 3300049569 Bacteria 15735
233 Ga0501032_0065182 3300049569 Bacteria 2437
234 Ga0501033_0017822 3300049570 Bacteria 5362
235 Ga0501033_0037023 3300049570 Bacteria 3654
236 Ga0501033_0101701 3300049570 Bacteria 2097
237 Ga0501033_0280882 3300049570 Bacteria 1175
238 Ga0501033_0337554 3300049570 Bacteria 1057
239 Ga0501033_0448204 3300049570 Bacteria 897
240 Ga0501034_0004181 3300049571 Bacteria 16111
241 Ga0501034_0032460 3300049571 Bacteria 5302
242 Ga0501034_0194011 3300049571 Bacteria 1992
243 Ga0501034_0759134 3300049571 Bacteria 865
244 Ga0501036_0000170 3300049572 Bacteria 42985
245 Ga0501036_0001452 3300049572 Bacteria 18223
246 Ga0501036_0013255 3300049572 Bacteria 6843
247 Ga0501037_0009911 3300049573 Bacteria 6988
248 Ga0501037_0162266 3300049573 Bacteria 1593
249 Ga0501037_0205579 3300049573 Bacteria 1390
250 Ga0501038_0002634 3300049574 Bacteria 16782
251 Ga0501038_0008380 3300049574 Bacteria 9507
252 Ga0501038_0029431 3300049574 Bacteria 4867
253 Ga0501039_0002340 3300049575 Bacteria 14096
254 Ga0501039_0089663 3300049575 Bacteria 2396
255 Ga0501039_0124684 3300049575 Bacteria 2020
256 Ga0501039_0171799 3300049575 Bacteria 1704
257 Ga0501039_1045053 3300049575 Bacteria 634
258 Ga0501040_0005487 3300049576 Bacteria 8208
259 Ga0501041_0205180 3300049577 Bacteria 1236
260 Ga0501042_0024923 3300049578 Bacteria 4198
261 Ga0501042_0042121 3300049578 Bacteria 3249
262 Ga0501042_0052056 3300049578 Bacteria 2920
263 Ga0501042_0113565 3300049578 Bacteria 1950
264 Ga0501042_1046430 3300049578 Bacteria 595
265 Ga0501043_0000866 3300049579 Bacteria 26823
266 Ga0501043_0032887 3300049579 Bacteria 4079
267 Ga0501043_0145507 3300049579 Bacteria 1856
268 Ga0501043_0206548 3300049579 Bacteria 1523
269 Ga0501046_0000602 3300049580 Bacteria 35284
270 Ga0501046_0010293 3300049580 Bacteria 8046
271 Ga0501046_0148120 3300049580 Bacteria 1772
272 Ga0501046_1096824 3300049580 Bacteria 550
273 Ga0501047_0002697 3300049581 Bacteria 16895
274 Ga0501047_0387355 3300049581 Bacteria 1231
275 Ga0501048_0001690 3300049582 Bacteria 16814
276 Ga0501048_0009724 3300049582 Bacteria 7211
277 Ga0501048_0011306 3300049582 Bacteria 6655
278 Ga0501048_0495992 3300049582 Bacteria 875
279 Ga0501068_0143863 3300049584 Bacteria 1496
280 Ga0501070_0013454 3300049586 Bacteria 6896
281 Ga0501071_0027595 3300049587 Bacteria 3995
282 Ga0501073_0028034 3300049589 Bacteria 4023
283 Ga0501073_0081809 3300049589 Bacteria 2246
284 Ga0501073_0095140 3300049589 Bacteria 2069
285 Ga0501074_0017215 3300049590 Bacteria 5244
286 Ga0501074_0058889 3300049590 Bacteria 2768
287 Ga0501075_0198276 3300049591 Bacteria 1531
288 Ga0501079_0071297 3300049741 Bacteria 2684
289 Ga0501080_0065038 3300049742 Bacteria 3393
290 Ga0501080_0127634 3300049742 Bacteria 2355
291 Ga0501080_0135925 3300049742 Bacteria 2275
292 Ga0501083_0520889 3300049744 Bacteria 774
293 Ga0501035_0003880 3300049822 Bacteria 14266
294 Ga0501044_0027864 3300049823 Bacteria 5963
295 Ga0501044_0058758 3300049823 Bacteria 3942
296 Ga0501044_0898250 3300049823 Bacteria 761
297 Ga0501044_1186983 3300049823 Bacteria 631
298 Ga0501045_0035214 3300049824 Bacteria 3634
299 Ga0501045_0052678 3300049824 Bacteria 2972
300 Ga0501045_0435057 3300049824 Bacteria 976
301 nmdc:mga00v17_8657_c1 3300050491 Bacteria 5481
302 nmdc:mga0yw44_539840_c1 3300050492 Bacteria 792
303 nmdc:mga0qj67_539730_c1 3300050509 Bacteria 936
304 nmdc:mga08y16_397269_c1 3300050511 Bacteria 1411
305 Ga0500566_0486184 3300053094 Bacteria 534
306 Ga0466962_0067971 3300061719 Bacteria 1701
307 2623589642 2622736626 Bacteria 7181580
308 2644090716 2643221615 Bacteria 5487866
309 2644320520 2643221657 Bacteria 5490246
310 2731909305 2731639228 Bacteria 4187555
311 2816503645 2816332139 Bacteria 9138787
312 2856744899 2856741275 Bacteria 8096094
313 2891329762 2891326441 Bacteria 6439512
314 2891558496 2891554331 Bacteria 8812224
315 2891568542 2891562705 Bacteria 8039471
316 2891969470 2891968417 Bacteria 5821697
317 2919450380 2919446982 Bacteria 3994487
318 8003833571 8003830390 Bacteria 6541657
319 8054476559 8054472261 Bacteria 7464355
320 8054732940 8054727385 Bacteria 7558670
321 Ga0207643_11028822
322 JGI24735J21928_10096175
323 Ga0070676_10038585
324 Ga0070683_100454010
325 Ga0070677_10573836
326 Ga0070677_10900773
327 Ga0068869_100009537
328 Ga0070680_100187186
329 Ga0068868_100001369
330 Ga0068868_100412227
331 Ga0070661_100021679
332 Ga0070661_100959441
333 Ga0070692_10044627
334 Ga0070692_10117156
335 Ga0070692_10459441
336 Ga0070668_100888896
337 Ga0070668_100908878
338 Ga0070675_100011219
339 Ga0070675_100249180
340 Ga0070671_100837461
341 Ga0070674_100267674
342 Ga0070674_100457282
343 Ga0070659_100011638
344 Ga0070714_100964222
345 Ga0070701_10792128
346 Ga0070700_100060250
347 Ga0070700_100068435
348 Ga0070708_100309832
349 Ga0070663_100007904
350 Ga0070663_100612810
351 Ga0070678_100377193
352 Ga0068867_100511678
353 Ga0070685_10032735
354 Ga0070684_100049333
355 Ga0070672_100020919
356 Ga0070672_100108743
357 Ga0070672_100528856
358 Ga0070664_100000639
359 Ga0070664_100626392
360 Ga0068857_100008230
361 Ga0070702_100019290
362 Ga0070702_100110866
363 Ga0070702_100236675
364 Ga0070702_100286121
365 Ga0068852_100154248
366 Ga0068864_100227892
367 Ga0068864_100414604
368 Ga0068864_100891424
369 Ga0068866_10056289
370 Ga0068861_100143406
371 Ga0068870_10084092
372 Ga0068863_100424897
373 Ga0068858_100897072
374 Ga0068860_100000301
375 Ga0068860_100795001
376 Ga0068862_100006973
377 Ga0081455_10001815
378 Ga0075365_10006199
379 Ga0075363_100009739
380 Ga0075364_10161851
381 Ga0075367_10900908
382 Ga0075430_100213235
383 Ga0068865_100803718
384 Ga0111539_13433441
385 Ga0105245_10301099
386 Ga0105245_12362516
387 Ga0105248_11435988
388 Ga0105248_11951028
389 Ga0105238_10369121
390 Ga0105238_10847241
391 Ga0105249_10929490
392 Ga0105032_102338
393 Ga0105246_10132496
394 Ga0105246_11860151
395 Ga0157336_1021100
396 Ga0157321_1005122
397 Ga0157313_1055624
398 Ga0157371_11348684
399 Ga0157374_10752847
400 Ga0157374_11272450
401 Ga0157374_12527758
402 Ga0163162_11456061
403 Ga0157375_11868978
404 Ga0163163_10148455
405 Ga0163163_10552346
406 Ga0163163_10656522
407 Ga0157380_10230156
408 Ga0157380_11988979
409 Ga0157377_10057553
410 Ga0157377_10099649
411 Ga0157376_10246782
412 Ga0163161_10633207
413 Ga0163161_10650045
414 Ga0163161_11386701
415 Ga0206353_11938910
416 Ga0213876_10175036
417 Ga0213875_10003948
418 Ga0207688_10109214
419 Ga0207688_10229893
420 Ga0207643_10201639
421 Ga0207705_10736966
422 Ga0207705_11189768
423 Ga0207654_10700178
424 Ga0207660_10263549
425 Ga0207649_10039764
426 Ga0207681_10159602
427 Ga0207694_10236722
428 Ga0207659_10005558
429 Ga0207659_10666777
430 Ga0207687_10012416
431 Ga0207664_11756740
432 Ga0207644_10671162
433 Ga0207690_10068960
434 Ga0207690_10437731
435 Ga0207706_10004720
436 Ga0207669_10107663
437 Ga0207669_10291133
438 Ga0207669_11245653
439 Ga0207704_11627349
440 Ga0207691_10128120
441 Ga0207691_10131045
442 Ga0207691_10442894
443 Ga0207689_10032920
444 Ga0207661_10283730
445 Ga0207640_10129665
446 Ga0207640_12147751
447 Ga0207677_10030914
448 Ga0207677_10506837
449 Ga0207677_10570387
450 Ga0207677_11900339
451 Ga0207703_10276883
452 Ga0207678_10014215
453 Ga0207678_10100386
454 Ga0207678_10118906
455 Ga0207708_10028163
456 Ga0207708_10421018
457 Ga0207641_10306002
458 Ga0207648_10318473
459 Ga0207676_10112586
460 Ga0207674_10013338
461 Ga0207675_100064915
462 Ga0207683_10007871
463 Ga0207683_10061284
464 Ga0207683_10241598
465 Ga0207698_10208076
466 Ga0207698_10259199
467 Ga0207428_10007762
468 Ga0268266_10561210
469 Ga0268265_10011149
470 Ga0268264_10000269
471 Ga0307515_10027474
472 Ga0307512_10182313
473 Ga0307509_10123296
474 Ga0307405_10705081
475 Ga0307413_10363786
476 Ga0307410_10897978
477 Ga0326468_10041738
478 Ga0307406_10099869
479 Ga0307406_10118985
480 Ga0307407_10033156
481 Ga0307407_10944081
482 Ga0307412_10180614
483 Ga0307409_100138371
484 Ga0307409_100457804
485 Ga0307409_100643921
486 Ga0307409_100671311
487 Ga0307409_101189841
488 Ga0307416_101139776
489 Ga0307416_102430635
490 Ga0307414_10217858
491 Ga0307414_10264574
492 Ga0307414_11265151
493 Ga0307411_10073619
494 Ga0307411_10262164
495 Ga0307415_101384966
496 Ga0307415_102024604
497 Ga0373931_0410824
498 Ga0373937_0084887
499 Ga0395898_0768018
500 Ga0395905_0468373
501 Ga0436364_0463609
502 Ga0395901_1221942
503 Ga0439439_0251385
504 Ga0451793_1133271
505 Ga0451793_1570019
506 Ga0451800_1365523
507 Ga0451833_0022253
508 Ga0451851_0460435
509 Ga0451853_2271722
510 Ga0451853_3102857
511 Ga0439448_0081622
512 Ga0439440_0107473
513 Ga0466961_0889421
514 Ga0466963_0225518
515 Ga0466963_1004378
516 Ga0466964_0387563
517 Ga0466968_0312362
518 Ga0466970_0008221
519 Ga0466957_0025900
520 Ga0466960_0020229
521 Ga0466960_0464667
522 Ga0466960_0573328
523 Ga0466967_0174923
524 Ga0466967_0496420
525 Ga0466967_0507560
526 Ga0466967_1932509
527 Ga0495603_0712104
528 Ga0495641_0206724
529 Ga0495653_0141189
530 Ga0495650_0276909
531 Ga0495639_0711681
532 Ga0495665_0411141
533 Ga0495635_0460349
534 Ga0495676_0064868
535 Ga0496100_1233258
536 Ga0496105_0229701
537 Ga0496108_0117040
538 Ga0496108_0590273
539 Ga0496109_0638069
540 Ga0496110_0336566
541 Ga0496110_0732826
542 Ga0496110_0806315
543 Ga0496110_1650292
544 Ga0496111_0137437
545 Ga0496112_0008541
546 Ga0496113_0623812
547 Ga0496114_0080656
548 Ga0496114_0467211
549 Ga0496114_1018814
550 Ga0496124_0888566
551 Ga0501031_0007919
552 Ga0501032_0002092
553 Ga0501032_0065182
554 Ga0501033_0017822
555 Ga0501033_0037023
556 Ga0501033_0101701
557 Ga0501033_0280882
558 Ga0501033_0337554
559 Ga0501033_0448204
560 Ga0501034_0004181
561 Ga0501034_0032460
562 Ga0501034_0194011
563 Ga0501034_0759134
564 Ga0501036_0000170
565 Ga0501036_0001452
566 Ga0501036_0013255
567 Ga0501037_0009911
568 Ga0501037_0162266
569 Ga0501037_0205579
570 Ga0501038_0002634
571 Ga0501038_0008380
572 Ga0501038_0029431
573 Ga0501039_0002340
574 Ga0501039_0089663
575 Ga0501039_0124684
576 Ga0501039_0171799
577 Ga0501039_1045053
578 Ga0501040_0005487
579 Ga0501041_0205180
580 Ga0501042_0024923
581 Ga0501042_0042121
582 Ga0501042_0052056
583 Ga0501042_0113565
584 Ga0501042_1046430
585 Ga0501043_0000866
586 Ga0501043_0032887
587 Ga0501043_0145507
588 Ga0501043_0206548
589 Ga0501046_0000602
590 Ga0501046_0010293
591 Ga0501046_0148120
592 Ga0501046_1096824
593 Ga0501047_0002697
594 Ga0501047_0387355
595 Ga0501048_0001690
596 Ga0501048_0009724
597 Ga0501048_0011306
598 Ga0501048_0495992
599 Ga0501068_0143863
600 Ga0501070_0013454
601 Ga0501071_0027595
602 Ga0501073_0028034
603 Ga0501073_0081809
604 Ga0501073_0095140
605 Ga0501074_0017215
606 Ga0501074_0058889
607 Ga0501075_0198276
608 Ga0501079_0071297
609 Ga0501080_0065038
610 Ga0501080_0127634
611 Ga0501080_0135925
612 Ga0501083_0520889
613 Ga0501035_0003880
614 Ga0501044_0027864
615 Ga0501044_0058758
616 Ga0501044_0898250
617 Ga0501044_1186983
618 Ga0501045_0035214
619 Ga0501045_0052678
620 Ga0501045_0435057
621 nmdc:mga00v17_8657_c1
622 nmdc:mga0yw44_539840_c1
623 nmdc:mga0qj67_539730_c1
624 nmdc:mga08y16_397269_c1
625 Ga0500566_0486184
626 Ga0466962_0067971
627 2623589642
628 2644090716
629 2644320520
630 2731909305
631 2816503645
632 2856744899
633 2891329762
634 2891558496
635 2891568542
636 2891969470
637 2919450380
638 8003833571
639 8054476559
640 8054732940

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00254

FKBP_C

FKBP-type peptidyl-prolyl cis-trans isomerase

27

107

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6o4a-assembly3.cif.gz_C crystal structure of smt fusion peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with sf355 1 23 126
4ggq-assembly1.cif.gz_C crystal structure of a smt fusion peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with cj40 0.9966 23 126
2y78-assembly1.cif.gz_A-2 crystal structure of bpss1823, a mip-like chaperone from burkholderia pseudomallei 0.9966 23 126
4ggq-assembly3.cif.gz_B crystal structure of a smt fusion peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with cj40 0.9963 23 126
5klx-assembly1.cif.gz_A crystal structure of smt fusion peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with sf110 0.9963 23 126
ID Description Score Start End Superfamily
af_B0G119_2_111_3.10.50.40 Alpha Beta;Roll;Chitinase A; domain 3; 0.9651 22 128 3.10.50.40
1n1aB00 Alpha Beta;Roll;Chitinase A; domain 3; 0.9649 22 128 3.10.50.40
3ni6A01 Alpha Beta;Roll;Chitinase A; domain 3; 0.9637 22 128 3.10.50.40
af_Q66H94_147_254_3.10.50.40 Alpha Beta;Roll;Chitinase A; domain 3; 0.9624 23 128 3.10.50.40
5huaA00 Alpha Beta;Roll;Chitinase A; domain 3; 0.9621 23 128 3.10.50.40
ID Description Score Start End GO Terms
AF-A0A248YND7-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 1.004 24 128 GO:0140839
GO:0140840
AF-A0A0M9YNY9-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 1.004 24 126 GO:0140839
GO:0140840
AF-A0A3P1WPZ0-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 1.001 8 128 GO:0140839
GO:0140840
AF-A0A640YB24-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 1.001 8 128 GO:0016020
GO:0140839
GO:0140840
AF-A0A7S3XHG6-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.9991 34 127 GO:0003755
GO:0005783
GO:0061077

Map