F405528

General Info

Members Datasets Scaffolds Average Seq Length
320 176 640 149

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10075477|Ga0157378_100754772
Length 170
Sequence MEFNGWGDSREPTPFVHTDMALMEQIQKDLTAAMMSKDELRLSVLRMVKSALKYKEIEXXXXLEDAEALQVVQTLLKQRRESVEQFAKGGRQDLVDKETKEISILEAYLPAGASDSDMAAAIEAAIVETGANSPKSMGAVIKAAKVRLEGKTVDGKTLSDRVKERLSKMA

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
56 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
57 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
58 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
86 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
87 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
92 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
93 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
94 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
105 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
108 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
153 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.25
Rhizosphere 98.75
Stem 0
Stem Tuber 0
Unclassified 20.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10075477 3300013297 Bacteria 3035
2 JGI25406J46586_10042296 3300003203 Bacteria 1596
3 Ga0065712_10174276 3300005290 Bacteria 1213
4 Ga0070676_10425552 3300005328 Bacteria 929
5 Ga0070683_100050321 3300005329 Bacteria 3857
6 Ga0070683_100131885 3300005329 Bacteria 2365
7 Ga0070683_100462766 3300005329 Bacteria 1210
8 Ga0070683_100526905 3300005329 Bacteria 1129
9 Ga0070680_100065603 3300005336 Bacteria 2975
10 Ga0070680_100078074 3300005336 Bacteria 2727
11 Ga0070680_100298707 3300005336 Bacteria 1365
12 Ga0070680_100792129 3300005336 Unclassified 817
13 Ga0070682_100042562 3300005337 Unclassified 2804
14 Ga0070668_100644087 3300005347 Bacteria 931
15 Ga0070667_101721324 3300005367 Bacteria 590
16 Ga0070709_10007651 3300005434 Bacteria 5931
17 Ga0070709_10057351 3300005434 Unclassified 2466
18 Ga0070709_10083540 3300005434 Bacteria 2089
19 Ga0070709_10091862 3300005434 Unclassified 2004
20 Ga0070709_10444827 3300005434 Unclassified 975
21 Ga0070714_100115685 3300005435 Bacteria 2380
22 Ga0070714_101551824 3300005435 Bacteria 647
23 Ga0070713_100014842 3300005436 Bacteria 5799
24 Ga0070713_100165408 3300005436 Bacteria 1978
25 Ga0070713_100230111 3300005436 Bacteria 1685
26 Ga0070713_102037671 3300005436 Unclassified 557
27 Ga0070710_10165856 3300005437 Bacteria 1373
28 Ga0070710_10462981 3300005437 Bacteria 862
29 Ga0070711_100032696 3300005439 Bacteria 3460
30 Ga0070711_100670786 3300005439 Bacteria 871
31 Ga0070681_10321705 3300005458 Bacteria 1456
32 Ga0070698_100788404 3300005471 Bacteria 894
33 Ga0070698_100937449 3300005471 Bacteria 812
34 Ga0070679_100006557 3300005530 Bacteria 10846
35 Ga0070679_101626759 3300005530 Unclassified 593
36 Ga0070684_100050955 3300005535 Bacteria 3596
37 Ga0070696_100049874 3300005546 Unclassified 2909
38 Ga0070693_100034529 3300005547 Bacteria 2799
39 Ga0070693_100150152 3300005547 Bacteria 1475
40 Ga0070704_102073039 3300005549 Unclassified 528
41 Ga0068855_100417154 3300005563 Bacteria 1469
42 Ga0068857_100192322 3300005577 Bacteria 1858
43 Ga0068852_100123458 3300005616 Bacteria 2374
44 Ga0068864_100283305 3300005618 Bacteria 1547
45 Ga0068861_100331984 3300005719 Bacteria 1328
46 Ga0068851_10051309 3300005834 Bacteria 2096
47 Ga0068863_100131577 3300005841 Bacteria 2389
48 Ga0068858_100063268 3300005842 Bacteria 3423
49 Ga0068858_100214467 3300005842 Bacteria 1822
50 Ga0081539_10011097 3300005985 Bacteria 7193
51 Ga0070717_10005277 3300006028 Bacteria 9420
52 Ga0070717_10009918 3300006028 Bacteria 7167
53 Ga0070717_10120009 3300006028 Unclassified 2251
54 Ga0070717_10177061 3300006028 Unclassified 1857
55 Ga0070717_10554270 3300006028 Bacteria 1041
56 Ga0070717_10643821 3300006028 Bacteria 962
57 Ga0070717_11265811 3300006028 Bacteria 671
58 Ga0070715_10694137 3300006163 Unclassified 607
59 Ga0070716_100008827 3300006173 Bacteria 5009
60 Ga0070716_100085215 3300006173 Bacteria 1897
61 Ga0070716_100331402 3300006173 Bacteria 1070
62 Ga0070712_100004232 3300006175 Bacteria 8832
63 Ga0075433_10332104 3300006852 Bacteria 1344
64 Ga0075434_100000462 3300006871 Bacteria 30392
65 Ga0075436_100220868 3300006914 Unclassified 1345
66 Ga0075435_100000404 3300007076 Bacteria 26487
67 Ga0075435_100272485 3300007076 Bacteria 1444
68 Ga0099794_10099616 3300007265 Unclassified 1450
69 Ga0099794_10114756 3300007265 Bacteria 1352
70 Ga0099795_10070418 3300007788 Unclassified 1318
71 Ga0099795_10197677 3300007788 Bacteria 847
72 Ga0105240_10025388 3300009093 Bacteria 7787
73 Ga0105240_10073991 3300009093 Bacteria 4206
74 Ga0105240_10151482 3300009093 Bacteria 2762
75 Ga0105245_10021278 3300009098 Bacteria 5687
76 Ga0105245_10237231 3300009098 Bacteria 1766
77 Ga0105241_10545586 3300009174 Unclassified 1040
78 Ga0105237_10176286 3300009545 Unclassified 2138
79 Ga0105238_10745418 3300009551 Bacteria 993
80 Ga0099796_10043110 3300010159 Unclassified 1536
81 Ga0105239_11213731 3300010375 Bacteria 869
82 Ga0105246_10167290 3300011119 Bacteria 1680
83 Ga0105246_10452754 3300011119 Bacteria 1079
84 Ga0157370_10077564 3300013104 Bacteria 3130
85 Ga0157369_10002713 3300013105 Bacteria 21129
86 Ga0157369_10051197 3300013105 Bacteria 4469
87 Ga0157374_10030753 3300013296 Bacteria 4877
88 Ga0157374_11211618 3300013296 Bacteria 776
89 Ga0157374_12837233 3300013296 Bacteria 512
90 Ga0157378_10014964 3300013297 Bacteria 6792
91 Ga0157372_10470547 3300013307 Unclassified 1465
92 Ga0157372_10816648 3300013307 Bacteria 1083
93 Ga0157375_11371786 3300013308 Archaea 832
94 Ga0157380_11066673 3300014326 Unclassified 845
95 Ga0157380_11605652 3300014326 Unclassified 706
96 Ga0157380_11901443 3300014326 Bacteria 656
97 Ga0224569_100421 3300022732 Unclassified 3619
98 Ga0224571_100753 3300022734 Unclassified 1891
99 Ga0228598_1002308 3300024227 Bacteria 4171
100 Ga0207656_10138790 3300025321 Bacteria 1144
101 Ga0207692_10440321 3300025898 Bacteria 819
102 Ga0207710_10022196 3300025900 Bacteria 2724
103 Ga0207699_10148222 3300025906 Unclassified 1549
104 Ga0207699_10390351 3300025906 Bacteria 989
105 Ga0207684_10462128 3300025910 Unclassified 1089
106 Ga0207707_10008391 3300025912 Bacteria 8965
107 Ga0207707_10494787 3300025912 Bacteria 1043
108 Ga0207707_10559582 3300025912 Unclassified 971
109 Ga0207695_10081481 3300025913 Bacteria 3275
110 Ga0207695_10437109 3300025913 Bacteria 1192
111 Ga0207695_10574679 3300025913 Unclassified 1008
112 Ga0207671_10353652 3300025914 Bacteria 1165
113 Ga0207693_10013373 3300025915 Bacteria 6617
114 Ga0207693_10911326 3300025915 Bacteria 674
115 Ga0207663_10106839 3300025916 Unclassified 1892
116 Ga0207663_10374401 3300025916 Bacteria 1083
117 Ga0207660_10001656 3300025917 Bacteria 14925
118 Ga0207660_10612892 3300025917 Unclassified 887
119 Ga0207652_10013893 3300025921 Bacteria 6517
120 Ga0207652_10726925 3300025921 Unclassified 885
121 Ga0207646_10000456 3300025922 Bacteria 54628
122 Ga0207694_10549633 3300025924 Bacteria 969
123 Ga0207687_10027666 3300025927 Bacteria 3806
124 Ga0207687_10147863 3300025927 Bacteria 1789
125 Ga0207700_10281788 3300025928 Unclassified 1430
126 Ga0207664_10081400 3300025929 Bacteria 2635
127 Ga0207664_10264787 3300025929 Bacteria 1504
128 Ga0207664_11077540 3300025929 Unclassified 719
129 Ga0207664_11252572 3300025929 Bacteria 661
130 Ga0207665_10001047 3300025939 Bacteria 18599
131 Ga0207665_10516967 3300025939 Unclassified 924
132 Ga0207711_10039833 3300025941 Bacteria 3997
133 Ga0207661_11231199 3300025944 Bacteria 688
134 Ga0207668_11033463 3300025972 Unclassified 735
135 Ga0207668_11810228 3300025972 Bacteria 551
136 Ga0207703_10042244 3300026035 Bacteria 3656
137 Ga0207703_10508462 3300026035 Bacteria 1132
138 Ga0207702_11115501 3300026078 Bacteria 783
139 Ga0207676_10009653 3300026095 Bacteria 6867
140 Ga0207674_10688703 3300026116 Bacteria 987
141 Ga0207675_100069116 3300026118 Unclassified 3301
142 Ga0207675_100135559 3300026118 Bacteria 2336
143 Ga0209179_1029020 3300027512 Unclassified 1124
144 Ga0265354_1007296 3300028016 Unclassified 1083
145 Ga0265319_1004846 3300028563 Bacteria 6587
146 Ga0265318_10002535 3300028577 Bacteria 9693
147 Ga0265338_10024236 3300028800 Bacteria 6204
148 Ga0265338_10673628 3300028800 Bacteria 715
149 Ga0265338_11008449 3300028800 Unclassified 563
150 Ga0265762_1007460 3300030760 Bacteria 1949
151 Ga0265760_10100597 3300031090 Unclassified 913
152 Ga0265330_10068031 3300031235 Bacteria 1543
153 Ga0265332_10006564 3300031238 Bacteria 5275
154 Ga0265328_10123648 3300031239 Unclassified 966
155 Ga0265328_10128086 3300031239 Bacteria 949
156 Ga0265320_10000285 3300031240 Bacteria 40924
157 Ga0265325_10006127 3300031241 Bacteria 7344
158 Ga0265325_10023349 3300031241 Bacteria 3378
159 Ga0265329_10005058 3300031242 Bacteria 5383
160 Ga0265340_10009493 3300031247 Bacteria 5219
161 Ga0265339_10001661 3300031249 Bacteria 16427
162 Ga0265339_10012986 3300031249 Bacteria 5064
163 Ga0265331_10000411 3300031250 Bacteria 43737
164 Ga0265331_10004313 3300031250 Bacteria 8911
165 Ga0265316_10003250 3300031344 Bacteria 16514
166 Ga0265316_10036913 3300031344 Bacteria 3950
167 Ga0265316_10061351 3300031344 Unclassified 2921
168 Ga0265316_10381720 3300031344 Bacteria 1016
169 Ga0265313_10010302 3300031595 Bacteria 5937
170 Ga0265313_10036568 3300031595 Bacteria 2464
171 Ga0265314_10152445 3300031711 Bacteria 1415
172 Ga0265342_10000468 3300031712 Bacteria 43740
173 Ga0373926_0000907 3300035083 Bacteria 8526
174 Ga0373923_0071733 3300035111 Bacteria 1488
175 Ga0373923_0259909 3300035111 Bacteria 814
176 Ga0373936_0214890 3300035113 Bacteria 852
177 Ga0373936_0321292 3300035113 Unclassified 701
178 Ga0373954_0065223 3300035118 Bacteria 1723
179 Ga0373954_0090031 3300035118 Bacteria 1473
180 Ga0373956_0086826 3300035119 Bacteria 1440
181 Ga0373956_0256075 3300035119 Bacteria 832
182 Ga0373956_0294564 3300035119 Unclassified 773
183 Ga0373955_0155725 3300035172 Bacteria 1346
184 Ga0373955_0466856 3300035172 Bacteria 770
185 Ga0373955_0501237 3300035172 Bacteria 741
186 Ga0316574_0086414 3300035398 Bacteria 1996
187 Ga0373935_0002635 3300035692 Bacteria 10308
188 Ga0373935_0072538 3300035692 Bacteria 2223
189 Ga0373935_0693067 3300035692 Bacteria 749
190 Ga0373935_0960004 3300035692 Unclassified 634
191 Ga0373927_0002067 3300035695 Bacteria 14827
192 Ga0373933_0056319 3300035724 Bacteria 2360
193 Ga0373933_0165458 3300035724 Bacteria 1406
194 Ga0373947_0019114 3300035725 Bacteria 3949
195 Ga0373937_0002103 3300036401 Bacteria 16650
196 Ga0373937_0019579 3300036401 Bacteria 6058
197 Ga0373937_0275004 3300036401 Bacteria 1590
198 Ga0373925_0020854 3300037068 Bacteria 4776
199 Ga0373925_0069399 3300037068 Bacteria 2662
200 Ga0373925_0383469 3300037068 Bacteria 1145
201 Ga0395900_1162812 3300037418 Unclassified 688
202 Ga0395905_0028312 3300037471 Bacteria 5281
203 Ga0395905_0428025 3300037471 Bacteria 1220
204 Ga0395905_0708890 3300037471 Bacteria 909
205 Ga0395901_0272026 3300038443 Unclassified 1762
206 Ga0395901_0627931 3300038443 Bacteria 1080
207 Ga0395901_0741892 3300038443 Unclassified 976
208 Ga0436361_0336483 3300039447 Bacteria 702
209 Ga0436362_1177384 3300039453 Unclassified 1367
210 Ga0451577_0000331 3300042876 Bacteria 88029
211 Ga0451577_0062769 3300042876 Bacteria 3313
212 Ga0451577_0275077 3300042876 Unclassified 1525
213 Ga0451577_1452101 3300042876 Bacteria 607
214 Ga0453683_0011091 3300044673 Bacteria 5956
215 Ga0453683_0386328 3300044673 Unclassified 901
216 Ga0466963_0000116 3300044694 Bacteria 29494
217 Ga0453684_0000429 3300044712 Bacteria 171513
218 Ga0453684_0005586 3300044712 Bacteria 24779
219 Ga0453684_0407973 3300044712 Unclassified 1520
220 Ga0453684_0880070 3300044712 Bacteria 960
221 Ga0466957_0631933 3300044842 Bacteria 752
222 Ga0451576_0011790 3300045051 Bacteria 9900
223 Ga0451576_0398593 3300045051 Bacteria 1443
224 Ga0466967_0000227 3300045976 Bacteria 24293
225 Ga0466967_0176469 3300045976 Bacteria 2013
226 Ga0466967_0640875 3300045976 Unclassified 1050
227 Ga0495592_0026265 3300046454 Bacteria 4416
228 Ga0495592_0167500 3300046454 Bacteria 1507
229 Ga0495651_0000196 3300046462 Bacteria 45780
230 Ga0495651_0000526 3300046462 Bacteria 29663
231 Ga0495651_0009223 3300046462 Bacteria 7573
232 Ga0495651_0323110 3300046462 Bacteria 1028
233 Ga0495653_0006105 3300046463 Bacteria 9874
234 Ga0495653_0076576 3300046463 Bacteria 2486
235 Ga0495653_0292001 3300046463 Bacteria 1066
236 Ga0495580_0000970 3300046472 Bacteria 25166
237 Ga0495580_0003126 3300046472 Bacteria 14184
238 Ga0495580_0014609 3300046472 Bacteria 5951
239 Ga0495580_0024615 3300046472 Unclassified 4404
240 Ga0495580_0053474 3300046472 Bacteria 2849
241 Ga0495580_0504808 3300046472 Bacteria 807
242 Ga0495582_0116499 3300046473 Bacteria 1503
243 Ga0495662_0271191 3300046476 Bacteria 835
244 Ga0495664_0076936 3300046477 Bacteria 1998
245 Ga0495664_0079269 3300046477 Bacteria 1968
246 Ga0495594_0129381 3300046499 Bacteria 1429
247 Ga0495594_0463985 3300046499 Bacteria 720
248 Ga0495594_0756478 3300046499 Unclassified 548
249 Ga0495608_0027238 3300046511 Bacteria 3889
250 Ga0495608_0587047 3300046511 Bacteria 669
251 Ga0495608_0668871 3300046511 Unclassified 620
252 Ga0495618_0075568 3300046514 Bacteria 2146
253 Ga0495628_0002853 3300046516 Bacteria 15494
254 Ga0495628_0005522 3300046516 Bacteria 11066
255 Ga0495628_0044147 3300046516 Bacteria 3547
256 Ga0495630_0001162 3300046517 Bacteria 18179
257 Ga0495630_0018351 3300046517 Bacteria 5139
258 Ga0495630_0068115 3300046517 Bacteria 2676
259 Ga0495666_0166671 3300046526 Bacteria 1020
260 Ga0495666_0290304 3300046526 Bacteria 741
261 Ga0495652_0006157 3300046529 Bacteria 11204
262 Ga0495652_0022479 3300046529 Bacteria 5596
263 Ga0495652_0377697 3300046529 Bacteria 1009
264 Ga0495665_0006273 3300046531 Bacteria 6415
265 Ga0495640_0032356 3300046533 Bacteria 3726
266 Ga0495586_0008588 3300046535 Bacteria 5438
267 Ga0495586_0517812 3300046535 Unclassified 688
268 Ga0495587_0001660 3300046536 Bacteria 14852
269 Ga0495587_0054515 3300046536 Bacteria 2356
270 Ga0495645_0136914 3300046543 Bacteria 1712
271 Ga0495645_0195163 3300046543 Unclassified 1377
272 Ga0495645_0679949 3300046543 Unclassified 626
273 Ga0495667_0003232 3300046559 Bacteria 10927
274 Ga0495667_0125685 3300046559 Bacteria 1655
275 Ga0495635_0006277 3300046663 Bacteria 8278
276 Ga0495657_0010690 3300046675 Bacteria 6900
277 Ga0495657_0259092 3300046675 Unclassified 1045
278 Ga0495599_0052161 3300046678 Bacteria 2562
279 Ga0495599_0305716 3300046678 Unclassified 959
280 Ga0495623_0001660 3300046679 Bacteria 14978
281 Ga0495623_0131352 3300046679 Bacteria 1499
282 Ga0495646_0000622 3300046680 Bacteria 19321
283 Ga0495658_0502609 3300046683 Unclassified 775
284 Ga0495613_0012162 3300046689 Bacteria 6398
285 Ga0495613_0038758 3300046689 Bacteria 3532
286 Ga0495624_0001721 3300046690 Bacteria 16735
287 Ga0495670_0610371 3300046691 Unclassified 594
288 Ga0495600_0021562 3300046809 Bacteria 4128
289 Ga0495604_0008125 3300047317 Bacteria 8309
290 Ga0495604_0008462 3300047317 Bacteria 8123
291 Ga0495604_0572056 3300047317 Unclassified 727
292 Ga0495674_0002876 3300047319 Bacteria 16740
293 Ga0495674_0084819 3300047319 Bacteria 2714
294 Ga0495674_0114343 3300047319 Bacteria 2285
295 Ga0495676_0109351 3300047321 Bacteria 2031
296 Ga0495680_0002128 3300047322 Bacteria 20557
297 Ga0495680_0098963 3300047322 Bacteria 2175
298 Ga0495675_0000422 3300047444 Bacteria 28659
299 Ga0495675_0001073 3300047444 Bacteria 16578
300 Ga0495675_0154601 3300047444 Bacteria 1415
301 Ga0495684_0001951 3300047471 Bacteria 16557
302 Ga0495684_0032527 3300047471 Bacteria 4005
303 Ga0495684_0198166 3300047471 Bacteria 1481
304 Ga0495593_0011785 3300047673 Bacteria 5013
305 Ga0495602_0003527 3300048088 Bacteria 16162
306 Ga0495602_0015810 3300048088 Bacteria 7601
307 Ga0495602_0908383 3300048088 Unclassified 586
308 Ga0495614_0035271 3300048089 Bacteria 2149
309 Ga0496100_0286228 3300048903 Unclassified 1230
310 Ga0496102_1119035 3300048905 Bacteria 707
311 Ga0496112_0048475 3300048915 Bacteria 4165
312 Ga0496112_0270430 3300048915 Bacteria 1648
313 Ga0501280_076049 3300049776 Bacteria 609
314 nmdc:mga0n895_1746_c1 3300050512 Bacteria 16448
315 nmdc:mga0n895_353186_c1 3300050512 Bacteria 1489
316 nmdc:mga0rr50_135898_c1 3300050513 Bacteria 1973
317 nmdc:mga0rr50_618_c1 3300050513 Bacteria 19051
318 nmdc:mga08x19_29245_c1 3300050514 Bacteria 3455
319 nmdc:mga0a205_348292_c1 3300050515 Bacteria 1349
320 Ga0495612_0000571 3300053078 Bacteria 14824
321 Ga0157378_10075477
322 JGI25406J46586_10042296
323 Ga0065712_10174276
324 Ga0070676_10425552
325 Ga0070683_100050321
326 Ga0070683_100131885
327 Ga0070683_100462766
328 Ga0070683_100526905
329 Ga0070680_100065603
330 Ga0070680_100078074
331 Ga0070680_100298707
332 Ga0070680_100792129
333 Ga0070682_100042562
334 Ga0070668_100644087
335 Ga0070667_101721324
336 Ga0070709_10007651
337 Ga0070709_10057351
338 Ga0070709_10083540
339 Ga0070709_10091862
340 Ga0070709_10444827
341 Ga0070714_100115685
342 Ga0070714_101551824
343 Ga0070713_100014842
344 Ga0070713_100165408
345 Ga0070713_100230111
346 Ga0070713_102037671
347 Ga0070710_10165856
348 Ga0070710_10462981
349 Ga0070711_100032696
350 Ga0070711_100670786
351 Ga0070681_10321705
352 Ga0070698_100788404
353 Ga0070698_100937449
354 Ga0070679_100006557
355 Ga0070679_101626759
356 Ga0070684_100050955
357 Ga0070696_100049874
358 Ga0070693_100034529
359 Ga0070693_100150152
360 Ga0070704_102073039
361 Ga0068855_100417154
362 Ga0068857_100192322
363 Ga0068852_100123458
364 Ga0068864_100283305
365 Ga0068861_100331984
366 Ga0068851_10051309
367 Ga0068863_100131577
368 Ga0068858_100063268
369 Ga0068858_100214467
370 Ga0081539_10011097
371 Ga0070717_10005277
372 Ga0070717_10009918
373 Ga0070717_10120009
374 Ga0070717_10177061
375 Ga0070717_10554270
376 Ga0070717_10643821
377 Ga0070717_11265811
378 Ga0070715_10694137
379 Ga0070716_100008827
380 Ga0070716_100085215
381 Ga0070716_100331402
382 Ga0070712_100004232
383 Ga0075433_10332104
384 Ga0075434_100000462
385 Ga0075436_100220868
386 Ga0075435_100000404
387 Ga0075435_100272485
388 Ga0099794_10099616
389 Ga0099794_10114756
390 Ga0099795_10070418
391 Ga0099795_10197677
392 Ga0105240_10025388
393 Ga0105240_10073991
394 Ga0105240_10151482
395 Ga0105245_10021278
396 Ga0105245_10237231
397 Ga0105241_10545586
398 Ga0105237_10176286
399 Ga0105238_10745418
400 Ga0099796_10043110
401 Ga0105239_11213731
402 Ga0105246_10167290
403 Ga0105246_10452754
404 Ga0157370_10077564
405 Ga0157369_10002713
406 Ga0157369_10051197
407 Ga0157374_10030753
408 Ga0157374_11211618
409 Ga0157374_12837233
410 Ga0157378_10014964
411 Ga0157372_10470547
412 Ga0157372_10816648
413 Ga0157375_11371786
414 Ga0157380_11066673
415 Ga0157380_11605652
416 Ga0157380_11901443
417 Ga0224569_100421
418 Ga0224571_100753
419 Ga0228598_1002308
420 Ga0207656_10138790
421 Ga0207692_10440321
422 Ga0207710_10022196
423 Ga0207699_10148222
424 Ga0207699_10390351
425 Ga0207684_10462128
426 Ga0207707_10008391
427 Ga0207707_10494787
428 Ga0207707_10559582
429 Ga0207695_10081481
430 Ga0207695_10437109
431 Ga0207695_10574679
432 Ga0207671_10353652
433 Ga0207693_10013373
434 Ga0207693_10911326
435 Ga0207663_10106839
436 Ga0207663_10374401
437 Ga0207660_10001656
438 Ga0207660_10612892
439 Ga0207652_10013893
440 Ga0207652_10726925
441 Ga0207646_10000456
442 Ga0207694_10549633
443 Ga0207687_10027666
444 Ga0207687_10147863
445 Ga0207700_10281788
446 Ga0207664_10081400
447 Ga0207664_10264787
448 Ga0207664_11077540
449 Ga0207664_11252572
450 Ga0207665_10001047
451 Ga0207665_10516967
452 Ga0207711_10039833
453 Ga0207661_11231199
454 Ga0207668_11033463
455 Ga0207668_11810228
456 Ga0207703_10042244
457 Ga0207703_10508462
458 Ga0207702_11115501
459 Ga0207676_10009653
460 Ga0207674_10688703
461 Ga0207675_100069116
462 Ga0207675_100135559
463 Ga0209179_1029020
464 Ga0265354_1007296
465 Ga0265319_1004846
466 Ga0265318_10002535
467 Ga0265338_10024236
468 Ga0265338_10673628
469 Ga0265338_11008449
470 Ga0265762_1007460
471 Ga0265760_10100597
472 Ga0265330_10068031
473 Ga0265332_10006564
474 Ga0265328_10123648
475 Ga0265328_10128086
476 Ga0265320_10000285
477 Ga0265325_10006127
478 Ga0265325_10023349
479 Ga0265329_10005058
480 Ga0265340_10009493
481 Ga0265339_10001661
482 Ga0265339_10012986
483 Ga0265331_10000411
484 Ga0265331_10004313
485 Ga0265316_10003250
486 Ga0265316_10036913
487 Ga0265316_10061351
488 Ga0265316_10381720
489 Ga0265313_10010302
490 Ga0265313_10036568
491 Ga0265314_10152445
492 Ga0265342_10000468
493 Ga0373926_0000907
494 Ga0373923_0071733
495 Ga0373923_0259909
496 Ga0373936_0214890
497 Ga0373936_0321292
498 Ga0373954_0065223
499 Ga0373954_0090031
500 Ga0373956_0086826
501 Ga0373956_0256075
502 Ga0373956_0294564
503 Ga0373955_0155725
504 Ga0373955_0466856
505 Ga0373955_0501237
506 Ga0316574_0086414
507 Ga0373935_0002635
508 Ga0373935_0072538
509 Ga0373935_0693067
510 Ga0373935_0960004
511 Ga0373927_0002067
512 Ga0373933_0056319
513 Ga0373933_0165458
514 Ga0373947_0019114
515 Ga0373937_0002103
516 Ga0373937_0019579
517 Ga0373937_0275004
518 Ga0373925_0020854
519 Ga0373925_0069399
520 Ga0373925_0383469
521 Ga0395900_1162812
522 Ga0395905_0028312
523 Ga0395905_0428025
524 Ga0395905_0708890
525 Ga0395901_0272026
526 Ga0395901_0627931
527 Ga0395901_0741892
528 Ga0436361_0336483
529 Ga0436362_1177384
530 Ga0451577_0000331
531 Ga0451577_0062769
532 Ga0451577_0275077
533 Ga0451577_1452101
534 Ga0453683_0011091
535 Ga0453683_0386328
536 Ga0466963_0000116
537 Ga0453684_0000429
538 Ga0453684_0005586
539 Ga0453684_0407973
540 Ga0453684_0880070
541 Ga0466957_0631933
542 Ga0451576_0011790
543 Ga0451576_0398593
544 Ga0466967_0000227
545 Ga0466967_0176469
546 Ga0466967_0640875
547 Ga0495592_0026265
548 Ga0495592_0167500
549 Ga0495651_0000196
550 Ga0495651_0000526
551 Ga0495651_0009223
552 Ga0495651_0323110
553 Ga0495653_0006105
554 Ga0495653_0076576
555 Ga0495653_0292001
556 Ga0495580_0000970
557 Ga0495580_0003126
558 Ga0495580_0014609
559 Ga0495580_0024615
560 Ga0495580_0053474
561 Ga0495580_0504808
562 Ga0495582_0116499
563 Ga0495662_0271191
564 Ga0495664_0076936
565 Ga0495664_0079269
566 Ga0495594_0129381
567 Ga0495594_0463985
568 Ga0495594_0756478
569 Ga0495608_0027238
570 Ga0495608_0587047
571 Ga0495608_0668871
572 Ga0495618_0075568
573 Ga0495628_0002853
574 Ga0495628_0005522
575 Ga0495628_0044147
576 Ga0495630_0001162
577 Ga0495630_0018351
578 Ga0495630_0068115
579 Ga0495666_0166671
580 Ga0495666_0290304
581 Ga0495652_0006157
582 Ga0495652_0022479
583 Ga0495652_0377697
584 Ga0495665_0006273
585 Ga0495640_0032356
586 Ga0495586_0008588
587 Ga0495586_0517812
588 Ga0495587_0001660
589 Ga0495587_0054515
590 Ga0495645_0136914
591 Ga0495645_0195163
592 Ga0495645_0679949
593 Ga0495667_0003232
594 Ga0495667_0125685
595 Ga0495635_0006277
596 Ga0495657_0010690
597 Ga0495657_0259092
598 Ga0495599_0052161
599 Ga0495599_0305716
600 Ga0495623_0001660
601 Ga0495623_0131352
602 Ga0495646_0000622
603 Ga0495658_0502609
604 Ga0495613_0012162
605 Ga0495613_0038758
606 Ga0495624_0001721
607 Ga0495670_0610371
608 Ga0495600_0021562
609 Ga0495604_0008125
610 Ga0495604_0008462
611 Ga0495604_0572056
612 Ga0495674_0002876
613 Ga0495674_0084819
614 Ga0495674_0114343
615 Ga0495676_0109351
616 Ga0495680_0002128
617 Ga0495680_0098963
618 Ga0495675_0000422
619 Ga0495675_0001073
620 Ga0495675_0154601
621 Ga0495684_0001951
622 Ga0495684_0032527
623 Ga0495684_0198166
624 Ga0495593_0011785
625 Ga0495602_0003527
626 Ga0495602_0015810
627 Ga0495602_0908383
628 Ga0495614_0035271
629 Ga0496100_0286228
630 Ga0496102_1119035
631 Ga0496112_0048475
632 Ga0496112_0270430
633 Ga0501280_076049
634 nmdc:mga0n895_1746_c1
635 nmdc:mga0n895_353186_c1
636 nmdc:mga0rr50_135898_c1
637 nmdc:mga0rr50_618_c1
638 nmdc:mga08x19_29245_c1
639 nmdc:mga0a205_348292_c1
640 Ga0495612_0000571

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09424

YqeY

Yqey-like protein

23

166

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.959 1 147
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.9466 1 147
1kt0-assembly1.cif.gz_A structure of the large fkbp-like protein, fkbp51, involved in steroid receptor complexes 0.4897 50 127
7dgu-assembly1.cif.gz_A de novo designed protein h4a1r 0.4805 4 89
7tbn-assembly2.cif.gz_B lov2-darpin fusion : d11 0.4777 46 135
ID Description Score Start End Superfamily
1ng6A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9861 91 147 1.10.10.410
af_I6X831_2_93_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9855 3 90 1.10.1510.10
af_Q86K90_1153_1377_1.10.3380.30 Mainly Alpha;Orthogonal Bundle;Sec63 N-terminal domain-like fold; 0.9809 44 87 1.10.3380.30
1ng6A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9694 91 147 1.10.10.410
1ng6A01 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9599 1 90 1.10.1510.10
ID Description Score Start End GO Terms
AF-A0A1L3GEJ1-F1-model_v4 Glutamyl-tRNA amidotransferase 0.9974 1 148 GO:0016740
GO:0016884
AF-A0A1Y3QBX7-F1-model_v4 Aspartyl-tRNA amidotransferase 0.9954 1 147 GO:0016740
GO:0016884
AF-A0A536BNG3-F1-model_v4 GatB/YqeY domain-containing protein 0.9927 1 154 GO:0016884
AF-A0A1T5I3E4-F1-model_v4 Yqey-like protein 0.9919 1 146 GO:0016884
AF-A0A3N5EXW9-F1-model_v4 GatB/YqeY domain-containing protein 0.9917 1 146 GO:0016884

Map