F405451

General Info

Members Datasets Scaffolds Average Seq Length
320 147 640 360

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100197650|Ga0068852_1001976502
Length 393
Sequence LRRTIPVLYRNPSEIAALWTACEPRLSFHSNGNQMNLNDLDTPVLLADLDILERNIARMARISHNGGKALRPHTKTHKTPEIARMQIAAGAQGLTCAKLGEAEVLVDAGFDDVFIANQIVGPLKIERLLNLALRARITVAIDSVEVALPIGDAAAARGIRVPVRIEVDTGLGRAGARSAPEVLAIARCAAESRGLEFAGIFTHEGHLYKSAEPALAAAHAAGQMLGTADMLADAGLPCEAISVGSTPGASLMAPYEGLTELRPGVYVFNDRTQVRLGAPGEACALTVLATVVSVRSDGKIIIDAGTKSMASDCPFEDRTFGEIVGHPEVRFVGASEEHGHLMPEGGTTLRVGDRMRIIPNHACTCVNMHDMMTAVRGETVEATWTIAGRGKIR

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
63 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
88 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
89 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
90 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
91 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
92 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
93 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
94 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
95 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
98 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
99 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
105 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
147 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.25
Rhizosphere 97.81
Stem 0
Stem Tuber 0
Unclassified 6.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_100197650 3300005616 Bacteria 1901
2 JGI25406J46586_10032224 3300003203 Bacteria 1949
3 rootH2_10036856 3300003320 Bacteria 20097
4 Ga0070658_10000573 3300005327 Bacteria 31970
5 Ga0070666_10204316 3300005335 Bacteria 1390
6 Ga0070680_100024146 3300005336 Bacteria 4852
7 Ga0070689_100042109 3300005340 Bacteria 3506
8 Ga0070689_100224841 3300005340 Bacteria 1541
9 Ga0070668_100020556 3300005347 Bacteria 4983
10 Ga0070675_100316905 3300005354 Unclassified 1377
11 Ga0070667_100081354 3300005367 Bacteria 2772
12 Ga0070667_100088988 3300005367 Bacteria 2652
13 Ga0070714_100343664 3300005435 Unclassified 1400
14 Ga0070708_100014389 3300005445 Bacteria 6508
15 Ga0070708_100026180 3300005445 Bacteria 4990
16 Ga0070708_100119507 3300005445 Bacteria 2429
17 Ga0070662_100007718 3300005457 Bacteria 6982
18 Ga0070706_100001472 3300005467 Bacteria 24728
19 Ga0070706_100217256 3300005467 Bacteria 1784
20 Ga0070707_100007793 3300005468 Bacteria 9946
21 Ga0070707_100032175 3300005468 Bacteria 4996
22 Ga0070707_100043520 3300005468 Bacteria 4297
23 Ga0070707_100149984 3300005468 Bacteria 2270
24 Ga0070707_100211651 3300005468 Unclassified 1889
25 Ga0070698_100021478 3300005471 Bacteria 6761
26 Ga0070699_100055983 3300005518 Bacteria 3415
27 Ga0070699_100066908 3300005518 Bacteria 3120
28 Ga0070697_100008421 3300005536 Bacteria 8045
29 Ga0070697_100341874 3300005536 Bacteria 1291
30 Ga0070696_100126316 3300005546 Unclassified 1856
31 Ga0068855_100019168 3300005563 Bacteria 8222
32 Ga0068859_100138105 3300005617 Bacteria 2511
33 Ga0068859_100203079 3300005617 Bacteria 2067
34 Ga0068861_100009992 3300005719 Bacteria 6572
35 Ga0068858_100138219 3300005842 Bacteria 2287
36 Ga0081455_10054611 3300005937 Bacteria 3403
37 Ga0081538_10000692 3300005981 Bacteria 37028
38 Ga0081538_10001065 3300005981 Bacteria 29204
39 Ga0081538_10003970 3300005981 Bacteria 13781
40 Ga0081538_10006672 3300005981 Bacteria 10113
41 Ga0081538_10013990 3300005981 Bacteria 6316
42 Ga0081538_10043760 3300005981 Bacteria 2805
43 Ga0081540_1030485 3300005983 Bacteria 2986
44 Ga0081539_10000069 3300005985 Bacteria 236854
45 Ga0081539_10002100 3300005985 Bacteria 29689
46 Ga0068871_100372378 3300006358 Bacteria 1267
47 Ga0075428_100005262 3300006844 Bacteria 14390
48 Ga0075428_100007451 3300006844 Bacteria 12125
49 Ga0075428_100022978 3300006844 Bacteria 6901
50 Ga0075428_100052962 3300006844 Bacteria 4446
51 Ga0075428_100107361 3300006844 Bacteria 3043
52 Ga0075428_100126009 3300006844 Bacteria 2787
53 Ga0075428_100129408 3300006844 Bacteria 2747
54 Ga0075428_100152481 3300006844 Bacteria 2510
55 Ga0075430_100001410 3300006846 Bacteria 19545
56 Ga0075430_100008149 3300006846 Bacteria 8857
57 Ga0075430_100012112 3300006846 Bacteria 7343
58 Ga0075430_100018583 3300006846 Bacteria 5915
59 Ga0075430_100124168 3300006846 Bacteria 2152
60 Ga0075431_100000806 3300006847 Bacteria 27398
61 Ga0075431_100011417 3300006847 Bacteria 8951
62 Ga0075431_100015195 3300006847 Bacteria 7801
63 Ga0075431_100016824 3300006847 Bacteria 7428
64 Ga0075431_100022500 3300006847 Bacteria 6444
65 Ga0075431_100033425 3300006847 Bacteria 5301
66 Ga0075431_100072184 3300006847 Bacteria 3562
67 Ga0075431_100095647 3300006847 Bacteria 3066
68 Ga0075431_100125429 3300006847 Bacteria 2649
69 Ga0075433_10001439 3300006852 Bacteria 17555
70 Ga0075434_100001811 3300006871 Bacteria 18463
71 Ga0075434_100105533 3300006871 Unclassified 2827
72 Ga0075434_100246049 3300006871 Bacteria 1808
73 Ga0075429_100001453 3300006880 Bacteria 19450
74 Ga0075429_100003109 3300006880 Bacteria 14099
75 Ga0075429_100004056 3300006880 Bacteria 12544
76 Ga0075429_100007217 3300006880 Bacteria 9644
77 Ga0075429_100011341 3300006880 Bacteria 7716
78 Ga0075429_100015409 3300006880 Bacteria 6624
79 Ga0075429_100170767 3300006880 Unclassified 1905
80 Ga0075429_100181626 3300006880 Bacteria 1844
81 Ga0075436_100032849 3300006914 Bacteria 3576
82 Ga0097620_100138107 3300006931 Bacteria 2511
83 Ga0097620_100203064 3300006931 Bacteria 2067
84 Ga0075435_100013221 3300007076 Bacteria 6133
85 Ga0075435_100046608 3300007076 Bacteria 3478
86 Ga0075435_100084012 3300007076 Bacteria 2619
87 Ga0111539_10025794 3300009094 Bacteria 7198
88 Ga0111539_10066517 3300009094 Bacteria 4257
89 Ga0111539_10330081 3300009094 Unclassified 1776
90 Ga0105245_10177467 3300009098 Bacteria 2033
91 Ga0114129_10000002 3300009147 Bacteria 204413
92 Ga0114129_10001170 3300009147 Bacteria 34810
93 Ga0114129_10002369 3300009147 Bacteria 26165
94 Ga0114129_10004630 3300009147 Bacteria 19415
95 Ga0114129_10020310 3300009147 Bacteria 9449
96 Ga0114129_10023513 3300009147 Bacteria 8735
97 Ga0114129_10044446 3300009147 Bacteria 6249
98 Ga0114129_10286731 3300009147 Bacteria 2198
99 Ga0114129_10338083 3300009147 Bacteria 1998
100 Ga0105238_10072490 3300009551 Bacteria 3439
101 Ga0105249_10314486 3300009553 Unclassified 1575
102 Ga0105239_10015402 3300010375 Bacteria 8472
103 Ga0163162_10011743 3300013306 Bacteria 8542
104 Ga0157375_10267392 3300013308 Bacteria 1872
105 Ga0163163_10003176 3300014325 Bacteria 13918
106 Ga0163163_10167387 3300014325 Bacteria 2244
107 Ga0157379_10268447 3300014968 Bacteria 1551
108 Ga0163161_10023047 3300017792 Bacteria 4387
109 Ga0163161_10140276 3300017792 Unclassified 1830
110 Ga0207705_10006862 3300025909 Bacteria 8417
111 Ga0207684_10000009 3300025910 Bacteria 572126
112 Ga0207684_10030966 3300025910 Bacteria 4553
113 Ga0207684_10039103 3300025910 Bacteria 4025
114 Ga0207684_10042250 3300025910 Bacteria 3864
115 Ga0207693_10133813 3300025915 Bacteria 1949
116 Ga0207660_10131170 3300025917 Bacteria 1908
117 Ga0207646_10016297 3300025922 Bacteria 6974
118 Ga0207646_10024020 3300025922 Bacteria 5590
119 Ga0207646_10028662 3300025922 Bacteria 5066
120 Ga0207646_10097485 3300025922 Unclassified 2634
121 Ga0207706_10059196 3300025933 Bacteria 3374
122 Ga0207670_10055006 3300025936 Bacteria 2688
123 Ga0207670_10236172 3300025936 Bacteria 1406
124 Ga0207691_10045678 3300025940 Bacteria 4025
125 Ga0207691_10269387 3300025940 Bacteria 1467
126 Ga0207658_10082926 3300025986 Bacteria 2463
127 Ga0207703_10312030 3300026035 Bacteria 1438
128 Ga0207641_10116995 3300026088 Bacteria 2373
129 Ga0207675_100004291 3300026118 Bacteria 13783
130 Ga0207675_100150631 3300026118 Bacteria 2214
131 Ga0207675_100338932 3300026118 Bacteria 1471
132 Ga0209971_1019436 3300027682 Bacteria 1612
133 Ga0207428_10086141 3300027907 Bacteria 2445
134 Ga0265337_1001993 3300028556 Bacteria 9695
135 Ga0265337_1011511 3300028556 Bacteria 3046
136 Ga0265338_10133857 3300028800 Bacteria 1952
137 Ga0265327_10004246 3300031251 Bacteria 12848
138 Ga0307408_100015273 3300031548 Bacteria 5112
139 Ga0307408_100028972 3300031548 Bacteria 3831
140 Ga0307405_10155913 3300031731 Bacteria 1611
141 Ga0307413_10013455 3300031824 Bacteria 4114
142 Ga0307413_10062525 3300031824 Bacteria 2303
143 Ga0307413_10085006 3300031824 Bacteria 2041
144 Ga0307410_10006838 3300031852 Bacteria 6195
145 Ga0307410_10029593 3300031852 Bacteria 3489
146 Ga0307410_10036546 3300031852 Bacteria 3199
147 Ga0307410_10065013 3300031852 Bacteria 2508
148 Ga0307410_10181476 3300031852 Bacteria 1594
149 Ga0307406_10007097 3300031901 Bacteria 6203
150 Ga0307406_10019172 3300031901 Bacteria 4012
151 Ga0307406_10033084 3300031901 Bacteria 3162
152 Ga0307406_10077979 3300031901 Bacteria 2193
153 Ga0307406_10243418 3300031901 Bacteria 1350
154 Ga0307407_10002050 3300031903 Bacteria 7704
155 Ga0307407_10006409 3300031903 Bacteria 5226
156 Ga0307407_10090230 3300031903 Bacteria 1876
157 Ga0307412_10031992 3300031911 Bacteria 3328
158 Ga0307412_10071826 3300031911 Bacteria 2364
159 Ga0307409_100001629 3300031995 Bacteria 11233
160 Ga0307409_100040949 3300031995 Bacteria 3455
161 Ga0307409_100210643 3300031995 Bacteria 1746
162 Ga0307416_100002831 3300032002 Bacteria 10091
163 Ga0307416_100002882 3300032002 Bacteria 10018
164 Ga0307416_100095028 3300032002 Bacteria 2572
165 Ga0307416_100182455 3300032002 Bacteria 1968
166 Ga0307414_10187209 3300032004 Bacteria 1671
167 Ga0307411_10020022 3300032005 Bacteria 3881
168 Ga0307411_10020956 3300032005 Bacteria 3814
169 Ga0307415_100000257 3300032126 Bacteria 22928
170 Ga0307415_100033921 3300032126 Bacteria 3317
171 Ga0373931_0062639 3300035691 Bacteria 2008
172 Ga0373927_0005372 3300035695 Bacteria 8850
173 Ga0373947_0193108 3300035725 Bacteria 1329
174 Ga0373937_0132367 3300036401 Unclassified 2330
175 Ga0373925_0004881 3300037068 Bacteria 10092
176 Ga0395900_0060968 3300037418 Bacteria 3880
177 Ga0395900_0660578 3300037418 Bacteria 981
178 Ga0395898_0048523 3300037466 Bacteria 4163
179 Ga0395905_0021091 3300037471 Bacteria 6170
180 Ga0395905_0130739 3300037471 Bacteria 2361
181 Ga0395905_0219556 3300037471 Bacteria 1779
182 Ga0395901_0123715 3300038443 Bacteria 2718
183 Ga0439465_0052512 3300041413 Bacteria 1338
184 Ga0439448_0004310 3300042005 Bacteria 4012
185 Ga0439450_000364 3300042008 Bacteria 5698
186 Ga0439463_004072 3300042016 Bacteria 3674
187 Ga0439459_0021030 3300042438 Bacteria 1250
188 Ga0439464_0000078 3300042439 Bacteria 13860
189 Ga0439460_0037550 3300042461 Unclassified 1409
190 Ga0450916_000454 3300042530 Bacteria 3532
191 Ga0439440_0000030 3300042993 Bacteria 17756
192 Ga0466967_0229834 3300045976 Bacteria 1766
193 Ga0495584_0043644 3300046491 Bacteria 2263
194 Ga0495669_0097096 3300046684 Unclassified 1366
195 Ga0495683_0052678 3300047323 Bacteria 2031
196 Ga0496100_0037972 3300048903 Bacteria 3049
197 Ga0496102_0138376 3300048905 Bacteria 2282
198 Ga0496106_0184032 3300048909 Bacteria 1659
199 Ga0496110_0013461 3300048913 Bacteria 6764
200 Ga0496126_0348754 3300048929 Unclassified 1211
201 Ga0501031_0015043 3300049568 Bacteria 5026
202 Ga0501032_0070558 3300049569 Bacteria 2330
203 Ga0501032_0242541 3300049569 Bacteria 1171
204 Ga0501033_0007621 3300049570 Bacteria 8417
205 Ga0501033_0049162 3300049570 Bacteria 3131
206 Ga0501034_0338431 3300049571 Bacteria 1435
207 Ga0501037_0028209 3300049573 Bacteria 4147
208 Ga0501038_0011086 3300049574 Bacteria 8232
209 Ga0501038_0051090 3300049574 Bacteria 3570
210 Ga0501038_0092622 3300049574 Bacteria 2530
211 Ga0501038_0137516 3300049574 Unclassified 2001
212 Ga0501039_0004165 3300049575 Bacteria 10883
213 Ga0501039_0038136 3300049575 Bacteria 3712
214 Ga0501040_0000066 3300049576 Bacteria 50854
215 Ga0501040_0002303 3300049576 Bacteria 12277
216 Ga0501041_0000152 3300049577 Bacteria 30395
217 Ga0501042_0000037 3300049578 Bacteria 43512
218 Ga0501042_0166752 3300049578 Bacteria 1589
219 Ga0501043_0007030 3300049579 Bacteria 8958
220 Ga0501043_0047415 3300049579 Unclassified 3378
221 Ga0501046_0000639 3300049580 Bacteria 34274
222 Ga0501046_0068713 3300049580 Bacteria 2757
223 Ga0501048_0001382 3300049582 Bacteria 18381
224 Ga0501048_0105764 3300049582 Bacteria 1986
225 Ga0501048_0187992 3300049582 Bacteria 1464
226 Ga0501067_0005258 3300049583 Bacteria 7194
227 Ga0501068_0013385 3300049584 Bacteria 4667
228 Ga0501068_0072357 3300049584 Bacteria 2105
229 Ga0501069_0043792 3300049585 Bacteria 2478
230 Ga0501070_0133504 3300049586 Bacteria 2050
231 Ga0501071_0050545 3300049587 Bacteria 2994
232 Ga0501072_0003233 3300049588 Bacteria 12228
233 Ga0501072_0016406 3300049588 Bacteria 5686
234 Ga0501072_0056379 3300049588 Bacteria 3096
235 Ga0501073_0009621 3300049589 Bacteria 7129
236 Ga0501074_0000293 3300049590 Bacteria 28811
237 Ga0501074_0041992 3300049590 Bacteria 3310
238 Ga0501074_0051099 3300049590 Bacteria 2983
239 Ga0501075_0002571 3300049591 Bacteria 12100
240 Ga0501075_0015004 3300049591 Bacteria 5558
241 Ga0501075_0019112 3300049591 Bacteria 4969
242 Ga0501075_0119418 3300049591 Bacteria 2005
243 Ga0501075_0219830 3300049591 Unclassified 1449
244 Ga0501076_0003168 3300049592 Bacteria 11472
245 Ga0501076_0012317 3300049592 Bacteria 6396
246 Ga0501076_0015967 3300049592 Bacteria 5684
247 Ga0501077_0002273 3300049593 Bacteria 11575
248 Ga0501077_0049359 3300049593 Unclassified 2675
249 Ga0501079_0000903 3300049741 Bacteria 20342
250 Ga0501079_0013297 3300049741 Bacteria 6275
251 Ga0501079_0091752 3300049741 Bacteria 2353
252 Ga0501079_0131143 3300049741 Bacteria 1951
253 Ga0501079_0249533 3300049741 Bacteria 1387
254 Ga0501081_0009028 3300049743 Bacteria 6482
255 Ga0501081_0019352 3300049743 Bacteria 4535
256 Ga0501081_0023519 3300049743 Bacteria 4130
257 Ga0501081_0025547 3300049743 Bacteria 3974
258 Ga0501081_0061405 3300049743 Bacteria 2605
259 Ga0501081_0100545 3300049743 Bacteria 2044
260 Ga0501081_0106119 3300049743 Bacteria 1991
261 Ga0501081_0254139 3300049743 Bacteria 1283
262 Ga0501083_0066067 3300049744 Bacteria 2409
263 Ga0501035_0037087 3300049822 Bacteria 4416
264 Ga0501035_0069903 3300049822 Unclassified 3111
265 Ga0501035_0087914 3300049822 Bacteria 2739
266 Ga0501044_0219993 3300049823 Bacteria 1850
267 Ga0501045_0000790 3300049824 Bacteria 20394
268 Ga0501045_0011059 3300049824 Bacteria 6324
269 Ga0501045_0390813 3300049824 Bacteria 1035
270 nmdc:mga05p37_100_c1 3300050507 Bacteria 77275
271 nmdc:mga05p37_13823_c1 3300050507 Bacteria 9672
272 nmdc:mga05p37_154812_c1 3300050507 Unclassified 2802
273 nmdc:mga05p37_2_c1 3300050507 Bacteria 173421
274 nmdc:mga05p37_30918_c1 3300050507 Bacteria 6537
275 nmdc:mga05p37_31270_c1 3300050507 Bacteria 6503
276 nmdc:mga05p37_322421_c1 3300050507 Bacteria 1828
277 nmdc:mga05p37_3282_c1 3300050507 Bacteria 18863
278 nmdc:mga05p37_54545_c1 3300050507 Bacteria 4917
279 nmdc:mga05p37_9514_c1 3300050507 Bacteria 11071
280 nmdc:mga09592_11783_c1 3300050508 Bacteria 7111
281 nmdc:mga09592_13608_c1 3300050508 Bacteria 6647
282 nmdc:mga09592_1516_c1 3300050508 Bacteria 18712
283 nmdc:mga09592_240416_c1 3300050508 Bacteria 1569
284 nmdc:mga09592_2654_c1 3300050508 Bacteria 14466
285 nmdc:mga09592_8363_c1 3300050508 Bacteria 8410
286 nmdc:mga0qj67_205558_c1 3300050509 Bacteria 1599
287 nmdc:mga0qj67_2927_c1 3300050509 Bacteria 12255
288 nmdc:mga0qj67_99297_c1 3300050509 Bacteria 2345
289 nmdc:mga06r32_108421_c1 3300050510 Bacteria 2730
290 nmdc:mga06r32_11690_c1 3300050510 Bacteria 7902
291 nmdc:mga06r32_120_c1 3300050510 Bacteria 56649
292 nmdc:mga06r32_156013_c1 3300050510 Bacteria 2264
293 nmdc:mga06r32_3131_c1 3300050510 Bacteria 14818
294 nmdc:mga06r32_439836_c1 3300050510 Bacteria 1284
295 nmdc:mga06r32_63225_c1 3300050510 Bacteria 3567
296 nmdc:mga08y16_178488_c1 3300050511 Bacteria 2205
297 nmdc:mga08y16_58920_c1 3300050511 Bacteria 4012
298 nmdc:mga0n895_170_c1 3300050512 Bacteria 40200
299 nmdc:mga0n895_254528_c1 3300050512 Unclassified 1782
300 nmdc:mga0n895_34746_c1 3300050512 Bacteria 4855
301 nmdc:mga0n895_4482_c1 3300050512 Bacteria 11480
302 nmdc:mga0rr50_264_c1 3300050513 Bacteria 28384
303 nmdc:mga0rr50_37759_c1 3300050513 Bacteria 3490
304 nmdc:mga0rr50_99041_c1 3300050513 Bacteria 2286
305 nmdc:mga08x19_3156_c1 3300050514 Bacteria 9891
306 nmdc:mga0a205_177040_c1 3300050515 Bacteria 2028
307 nmdc:mga0a205_2945_c1 3300050515 Bacteria 15086
308 Ga0501084_0001131 3300054114 Bacteria 20802
309 Ga0501084_0006453 3300054114 Bacteria 9644
310 Ga0501084_0144231 3300054114 Bacteria 2005
311 Ga0501084_0174214 3300054114 Bacteria 1816
312 Ga0501082_0000057 3300060353 Bacteria 79254
313 Ga0501082_0001036 3300060353 Bacteria 24575
314 Ga0501082_0424083 3300060353 Bacteria 1162
315 Ga0530510_0005693 3300061734 Bacteria 8632
316 Ga0530510_0009556 3300061734 Bacteria 6801
317 Ga0530510_0018813 3300061734 Bacteria 4898
318 Ga0530510_0089690 3300061734 Bacteria 2242
319 Ga0530510_0231835 3300061734 Bacteria 1373
320 3003001292 3002998708 Bacteria 11715108
321 Ga0068852_100197650
322 JGI25406J46586_10032224
323 rootH2_10036856
324 Ga0070658_10000573
325 Ga0070666_10204316
326 Ga0070680_100024146
327 Ga0070689_100042109
328 Ga0070689_100224841
329 Ga0070668_100020556
330 Ga0070675_100316905
331 Ga0070667_100081354
332 Ga0070667_100088988
333 Ga0070714_100343664
334 Ga0070708_100014389
335 Ga0070708_100026180
336 Ga0070708_100119507
337 Ga0070662_100007718
338 Ga0070706_100001472
339 Ga0070706_100217256
340 Ga0070707_100007793
341 Ga0070707_100032175
342 Ga0070707_100043520
343 Ga0070707_100149984
344 Ga0070707_100211651
345 Ga0070698_100021478
346 Ga0070699_100055983
347 Ga0070699_100066908
348 Ga0070697_100008421
349 Ga0070697_100341874
350 Ga0070696_100126316
351 Ga0068855_100019168
352 Ga0068859_100138105
353 Ga0068859_100203079
354 Ga0068861_100009992
355 Ga0068858_100138219
356 Ga0081455_10054611
357 Ga0081538_10000692
358 Ga0081538_10001065
359 Ga0081538_10003970
360 Ga0081538_10006672
361 Ga0081538_10013990
362 Ga0081538_10043760
363 Ga0081540_1030485
364 Ga0081539_10000069
365 Ga0081539_10002100
366 Ga0068871_100372378
367 Ga0075428_100005262
368 Ga0075428_100007451
369 Ga0075428_100022978
370 Ga0075428_100052962
371 Ga0075428_100107361
372 Ga0075428_100126009
373 Ga0075428_100129408
374 Ga0075428_100152481
375 Ga0075430_100001410
376 Ga0075430_100008149
377 Ga0075430_100012112
378 Ga0075430_100018583
379 Ga0075430_100124168
380 Ga0075431_100000806
381 Ga0075431_100011417
382 Ga0075431_100015195
383 Ga0075431_100016824
384 Ga0075431_100022500
385 Ga0075431_100033425
386 Ga0075431_100072184
387 Ga0075431_100095647
388 Ga0075431_100125429
389 Ga0075433_10001439
390 Ga0075434_100001811
391 Ga0075434_100105533
392 Ga0075434_100246049
393 Ga0075429_100001453
394 Ga0075429_100003109
395 Ga0075429_100004056
396 Ga0075429_100007217
397 Ga0075429_100011341
398 Ga0075429_100015409
399 Ga0075429_100170767
400 Ga0075429_100181626
401 Ga0075436_100032849
402 Ga0097620_100138107
403 Ga0097620_100203064
404 Ga0075435_100013221
405 Ga0075435_100046608
406 Ga0075435_100084012
407 Ga0111539_10025794
408 Ga0111539_10066517
409 Ga0111539_10330081
410 Ga0105245_10177467
411 Ga0114129_10000002
412 Ga0114129_10001170
413 Ga0114129_10002369
414 Ga0114129_10004630
415 Ga0114129_10020310
416 Ga0114129_10023513
417 Ga0114129_10044446
418 Ga0114129_10286731
419 Ga0114129_10338083
420 Ga0105238_10072490
421 Ga0105249_10314486
422 Ga0105239_10015402
423 Ga0163162_10011743
424 Ga0157375_10267392
425 Ga0163163_10003176
426 Ga0163163_10167387
427 Ga0157379_10268447
428 Ga0163161_10023047
429 Ga0163161_10140276
430 Ga0207705_10006862
431 Ga0207684_10000009
432 Ga0207684_10030966
433 Ga0207684_10039103
434 Ga0207684_10042250
435 Ga0207693_10133813
436 Ga0207660_10131170
437 Ga0207646_10016297
438 Ga0207646_10024020
439 Ga0207646_10028662
440 Ga0207646_10097485
441 Ga0207706_10059196
442 Ga0207670_10055006
443 Ga0207670_10236172
444 Ga0207691_10045678
445 Ga0207691_10269387
446 Ga0207658_10082926
447 Ga0207703_10312030
448 Ga0207641_10116995
449 Ga0207675_100004291
450 Ga0207675_100150631
451 Ga0207675_100338932
452 Ga0209971_1019436
453 Ga0207428_10086141
454 Ga0265337_1001993
455 Ga0265337_1011511
456 Ga0265338_10133857
457 Ga0265327_10004246
458 Ga0307408_100015273
459 Ga0307408_100028972
460 Ga0307405_10155913
461 Ga0307413_10013455
462 Ga0307413_10062525
463 Ga0307413_10085006
464 Ga0307410_10006838
465 Ga0307410_10029593
466 Ga0307410_10036546
467 Ga0307410_10065013
468 Ga0307410_10181476
469 Ga0307406_10007097
470 Ga0307406_10019172
471 Ga0307406_10033084
472 Ga0307406_10077979
473 Ga0307406_10243418
474 Ga0307407_10002050
475 Ga0307407_10006409
476 Ga0307407_10090230
477 Ga0307412_10031992
478 Ga0307412_10071826
479 Ga0307409_100001629
480 Ga0307409_100040949
481 Ga0307409_100210643
482 Ga0307416_100002831
483 Ga0307416_100002882
484 Ga0307416_100095028
485 Ga0307416_100182455
486 Ga0307414_10187209
487 Ga0307411_10020022
488 Ga0307411_10020956
489 Ga0307415_100000257
490 Ga0307415_100033921
491 Ga0373931_0062639
492 Ga0373927_0005372
493 Ga0373947_0193108
494 Ga0373937_0132367
495 Ga0373925_0004881
496 Ga0395900_0060968
497 Ga0395900_0660578
498 Ga0395898_0048523
499 Ga0395905_0021091
500 Ga0395905_0130739
501 Ga0395905_0219556
502 Ga0395901_0123715
503 Ga0439465_0052512
504 Ga0439448_0004310
505 Ga0439450_000364
506 Ga0439463_004072
507 Ga0439459_0021030
508 Ga0439464_0000078
509 Ga0439460_0037550
510 Ga0450916_000454
511 Ga0439440_0000030
512 Ga0466967_0229834
513 Ga0495584_0043644
514 Ga0495669_0097096
515 Ga0495683_0052678
516 Ga0496100_0037972
517 Ga0496102_0138376
518 Ga0496106_0184032
519 Ga0496110_0013461
520 Ga0496126_0348754
521 Ga0501031_0015043
522 Ga0501032_0070558
523 Ga0501032_0242541
524 Ga0501033_0007621
525 Ga0501033_0049162
526 Ga0501034_0338431
527 Ga0501037_0028209
528 Ga0501038_0011086
529 Ga0501038_0051090
530 Ga0501038_0092622
531 Ga0501038_0137516
532 Ga0501039_0004165
533 Ga0501039_0038136
534 Ga0501040_0000066
535 Ga0501040_0002303
536 Ga0501041_0000152
537 Ga0501042_0000037
538 Ga0501042_0166752
539 Ga0501043_0007030
540 Ga0501043_0047415
541 Ga0501046_0000639
542 Ga0501046_0068713
543 Ga0501048_0001382
544 Ga0501048_0105764
545 Ga0501048_0187992
546 Ga0501067_0005258
547 Ga0501068_0013385
548 Ga0501068_0072357
549 Ga0501069_0043792
550 Ga0501070_0133504
551 Ga0501071_0050545
552 Ga0501072_0003233
553 Ga0501072_0016406
554 Ga0501072_0056379
555 Ga0501073_0009621
556 Ga0501074_0000293
557 Ga0501074_0041992
558 Ga0501074_0051099
559 Ga0501075_0002571
560 Ga0501075_0015004
561 Ga0501075_0019112
562 Ga0501075_0119418
563 Ga0501075_0219830
564 Ga0501076_0003168
565 Ga0501076_0012317
566 Ga0501076_0015967
567 Ga0501077_0002273
568 Ga0501077_0049359
569 Ga0501079_0000903
570 Ga0501079_0013297
571 Ga0501079_0091752
572 Ga0501079_0131143
573 Ga0501079_0249533
574 Ga0501081_0009028
575 Ga0501081_0019352
576 Ga0501081_0023519
577 Ga0501081_0025547
578 Ga0501081_0061405
579 Ga0501081_0100545
580 Ga0501081_0106119
581 Ga0501081_0254139
582 Ga0501083_0066067
583 Ga0501035_0037087
584 Ga0501035_0069903
585 Ga0501035_0087914
586 Ga0501044_0219993
587 Ga0501045_0000790
588 Ga0501045_0011059
589 Ga0501045_0390813
590 nmdc:mga05p37_100_c1
591 nmdc:mga05p37_13823_c1
592 nmdc:mga05p37_154812_c1
593 nmdc:mga05p37_2_c1
594 nmdc:mga05p37_30918_c1
595 nmdc:mga05p37_31270_c1
596 nmdc:mga05p37_322421_c1
597 nmdc:mga05p37_3282_c1
598 nmdc:mga05p37_54545_c1
599 nmdc:mga05p37_9514_c1
600 nmdc:mga09592_11783_c1
601 nmdc:mga09592_13608_c1
602 nmdc:mga09592_1516_c1
603 nmdc:mga09592_240416_c1
604 nmdc:mga09592_2654_c1
605 nmdc:mga09592_8363_c1
606 nmdc:mga0qj67_205558_c1
607 nmdc:mga0qj67_2927_c1
608 nmdc:mga0qj67_99297_c1
609 nmdc:mga06r32_108421_c1
610 nmdc:mga06r32_11690_c1
611 nmdc:mga06r32_120_c1
612 nmdc:mga06r32_156013_c1
613 nmdc:mga06r32_3131_c1
614 nmdc:mga06r32_439836_c1
615 nmdc:mga06r32_63225_c1
616 nmdc:mga08y16_178488_c1
617 nmdc:mga08y16_58920_c1
618 nmdc:mga0n895_170_c1
619 nmdc:mga0n895_254528_c1
620 nmdc:mga0n895_34746_c1
621 nmdc:mga0n895_4482_c1
622 nmdc:mga0rr50_264_c1
623 nmdc:mga0rr50_37759_c1
624 nmdc:mga0rr50_99041_c1
625 nmdc:mga08x19_3156_c1
626 nmdc:mga0a205_177040_c1
627 nmdc:mga0a205_2945_c1
628 Ga0501084_0001131
629 Ga0501084_0006453
630 Ga0501084_0144231
631 Ga0501084_0174214
632 Ga0501082_0000057
633 Ga0501082_0001036
634 Ga0501082_0424083
635 Ga0530510_0005693
636 Ga0530510_0009556
637 Ga0530510_0018813
638 Ga0530510_0089690
639 Ga0530510_0231835
640 3003001292

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14031

D-ser_dehydrat

Putative serine dehydratase domain

284

375

0.91

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

47

272

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v15-assembly1.cif.gz_B crystal structure of d-threonine aldolase from alcaligenes xylosoxidans 0.9524 23 365
7dib-assembly1.cif.gz_A crystal structure of d-threonine aldolase from filomicrobium marinum 0.9448 23 365
7dib-assembly1.cif.gz_B crystal structure of d-threonine aldolase from filomicrobium marinum 0.9446 23 365
6qkb-assembly1.cif.gz_B crystal structure of the beta-hydroxyaspartate aldolase of paracoccus denitrificans 0.9425 17 365
7yqa-assembly1.cif.gz_A crystal structure of d-threonine aldolase from chlamydomonas reinhardtii 0.9182 8 365
ID Description Score Start End Superfamily
4v15B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9514 39 244 3.20.20.10
4v15B01 Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;D-serine dehydratase-like domain 0.9271 258 365 2.40.37.20
3wqcB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9003 39 240 3.20.20.10
af_Q54XE5_21_258_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8901 41 244 3.20.20.10
af_A0A0R4IJQ7_212_335_2.40.37.20 Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;D-serine dehydratase-like domain 0.8853 244 356 2.40.37.20
ID Description Score Start End GO Terms
AF-A0A5J6N4I8-F1-model_v4 Alanine racemase 0.9925 22 365 GO:0008721
GO:0036088
AF-A0A537DA52-F1-model_v4 DSD1 family PLP-dependent enzyme 0.9908 165 365 GO:0008721
GO:0036088
AF-A0A3D3XVX2-F1-model_v4 Threonine aldolase 0.9883 30 126 GO:0008721
GO:0036088
AF-A0A537DA52-F1-model_v4 DSD1 family PLP-dependent enzyme 0.9859 165 365 GO:0008721
GO:0036088
AF-A0A3C1JU56-F1-model_v4 D-serine dehydratase-like domain-containing protein 0.9858 144 365 GO:0008721
GO:0036088

Map