F405428

General Info

Members Datasets Scaffolds Average Seq Length
320 156 640 299

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100072681|Ga0070706_1000726811
Length 348
Sequence MRTHGAMNRYGGRQSRWTGSYHKEYTIRRHGVVGAAPLPACVAATAEGAVAMKISLIGVPMDLGADRSGVDMGPSAIRYADIADKLSALGHEVRNLDTVPVPHPDVHAFGDPKLKYLEQIVTATNELARRVEEVAGSGALPIVLGGDNSISLGSISGVAKARGPIGVLWLDAHGDFNTSETSPSGNIHGQILAALAGYGDERLVNVGGPGAKVHPGNIVIVGARDLDPGERALLHESGVHVRTIADIDRRGMSEIAQEALTLTTEGTNGVYVMLDMDVMDPSEAPGVGTPVPGGITYREAHLMMEMVAESGKLLGLDLVEVNPILDRENKTAILATALALSAAGKHIF

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
64 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
98 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
99 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
155 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
156 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.62
Metatranscriptomes 3.44
Isolates 0.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 0.62
Rhizosphere 96.88
Stem 0
Stem Tuber 0
Unclassified 12.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100072681 3300005467 Bacteria 3182
2 JGI25406J46586_10004611 3300003203 Bacteria 6415
3 Ga0065704_10091857 3300005289 Bacteria 2690
4 Ga0065712_10114866 3300005290 Bacteria 1760
5 Ga0065712_10123623 3300005290 Bacteria 1636
6 Ga0065712_10126640 3300005290 Bacteria 1599
7 Ga0065707_10000534 3300005295 Bacteria 41079
8 Ga0065707_10095068 3300005295 Bacteria 3422
9 Ga0065707_10136852 3300005295 Bacteria 1828
10 Ga0070666_10057314 3300005335 Bacteria 2632
11 Ga0070666_10067556 3300005335 Bacteria 2427
12 Ga0068868_100002316 3300005338 Bacteria 13177
13 Ga0070689_100034744 3300005340 Unclassified 3847
14 Ga0070689_100060263 3300005340 Bacteria 2950
15 Ga0070689_100240758 3300005340 Bacteria 1490
16 Ga0070687_100053397 3300005343 Unclassified 2101
17 Ga0070675_100017174 3300005354 Bacteria 5752
18 Ga0070675_100017396 3300005354 Bacteria 5712
19 Ga0070675_100018401 3300005354 Bacteria 5560
20 Ga0070675_100323873 3300005354 Bacteria 1362
21 Ga0070675_100397008 3300005354 Bacteria 1230
22 Ga0070671_100086191 3300005355 Bacteria 2627
23 Ga0070671_100132584 3300005355 Bacteria 2099
24 Ga0070673_100089219 3300005364 Bacteria 2517
25 Ga0070673_100159546 3300005364 Bacteria 1917
26 Ga0070688_100046654 3300005365 Bacteria 2684
27 Ga0070688_100233851 3300005365 Bacteria 1301
28 Ga0070667_100001810 3300005367 Bacteria 19035
29 Ga0070667_100098724 3300005367 Bacteria 2520
30 Ga0070714_100115824 3300005435 Unclassified 2379
31 Ga0070705_100105822 3300005440 Bacteria 1787
32 Ga0070700_100004661 3300005441 Bacteria 7182
33 Ga0070694_100258802 3300005444 Bacteria 1319
34 Ga0070694_100329757 3300005444 Archaea 1177
35 Ga0068867_100474748 3300005459 Bacteria 1070
36 Ga0070685_10110982 3300005466 Bacteria 1689
37 Ga0070706_100004930 3300005467 Bacteria 12776
38 Ga0070707_100021465 3300005468 Bacteria 6103
39 Ga0070707_100085911 3300005468 Bacteria 3042
40 Ga0070698_100138351 3300005471 Bacteria 2388
41 Ga0070698_100209857 3300005471 Bacteria 1882
42 Ga0070698_100253858 3300005471 Bacteria 1691
43 Ga0070698_100552967 3300005471 Archaea 1090
44 Ga0070699_100001594 3300005518 Bacteria 20703
45 Ga0070699_100063639 3300005518 Unclassified 3199
46 Ga0070699_100284382 3300005518 Bacteria 1482
47 Ga0070684_100161906 3300005535 Bacteria 2030
48 Ga0070684_100166363 3300005535 Bacteria 2002
49 Ga0070672_100107539 3300005543 Bacteria 2270
50 Ga0070686_100005803 3300005544 Bacteria 6841
51 Ga0070686_100184566 3300005544 Unclassified 1485
52 Ga0070695_100044859 3300005545 Unclassified 2816
53 Ga0070704_100189241 3300005549 Bacteria 1653
54 Ga0070664_100014441 3300005564 Bacteria 6438
55 Ga0070664_100053219 3300005564 Bacteria 3431
56 Ga0070702_100349576 3300005615 Bacteria 1041
57 Ga0068859_100000349 3300005617 Bacteria 45803
58 Ga0068859_100004096 3300005617 Bacteria 14866
59 Ga0068859_100057859 3300005617 Unclassified 3905
60 Ga0068859_100224783 3300005617 Bacteria 1965
61 Ga0068864_100001147 3300005618 Bacteria 22118
62 Ga0068864_100028679 3300005618 Unclassified 4708
63 Ga0068864_100319184 3300005618 Bacteria 1459
64 Ga0068864_100505529 3300005618 Bacteria 1163
65 Ga0068870_10065151 3300005840 Bacteria 1970
66 Ga0068863_100000383 3300005841 Bacteria 44901
67 Ga0068863_100039162 3300005841 Bacteria 4510
68 Ga0068858_100007372 3300005842 Bacteria 10644
69 Ga0068858_100016274 3300005842 Bacteria 6987
70 Ga0081539_10001674 3300005985 Bacteria 35879
71 Ga0075427_10000115 3300006194 Bacteria 7020
72 Ga0075427_10006562 3300006194 Bacteria 1690
73 Ga0097621_100102664 3300006237 Unclassified 2408
74 Ga0075428_100060063 3300006844 Bacteria 4163
75 Ga0075428_100061166 3300006844 Bacteria 4123
76 Ga0075428_100105138 3300006844 Bacteria 3079
77 Ga0075430_100053806 3300006846 Bacteria 3388
78 Ga0075430_100161183 3300006846 Bacteria 1867
79 Ga0075430_100261355 3300006846 Bacteria 1434
80 Ga0075431_100017220 3300006847 Bacteria 7343
81 Ga0075431_100196824 3300006847 Bacteria 2063
82 Ga0075431_100368432 3300006847 Bacteria 1442
83 Ga0075433_10016110 3300006852 Bacteria 6149
84 Ga0075433_10016253 3300006852 Bacteria 6124
85 Ga0075433_10057275 3300006852 Bacteria 3407
86 Ga0075433_10173242 3300006852 Unclassified 1920
87 Ga0075433_10510691 3300006852 Bacteria 1057
88 Ga0075434_100007798 3300006871 Bacteria 9913
89 Ga0075434_100010351 3300006871 Bacteria 8741
90 Ga0075434_100025663 3300006871 Bacteria 5767
91 Ga0075434_100050761 3300006871 Bacteria 4121
92 Ga0075434_100154063 3300006871 Bacteria 2318
93 Ga0075429_100005864 3300006880 Bacteria 10600
94 Ga0075429_100044777 3300006880 Bacteria 3849
95 Ga0075429_100102236 3300006880 Bacteria 2502
96 Ga0097620_100000349 3300006931 Bacteria 45803
97 Ga0097620_100004096 3300006931 Bacteria 14866
98 Ga0097620_100057859 3300006931 Unclassified 3905
99 Ga0097620_100224785 3300006931 Bacteria 1965
100 Ga0075435_100013286 3300007076 Bacteria 6119
101 Ga0075435_100067469 3300007076 Bacteria 2913
102 Ga0111539_10015018 3300009094 Bacteria 9651
103 Ga0111539_10028299 3300009094 Bacteria 6840
104 Ga0111539_10512373 3300009094 Unclassified 1397
105 Ga0114129_10000797 3300009147 Bacteria 40445
106 Ga0114129_10002541 3300009147 Bacteria 25325
107 Ga0114129_10007563 3300009147 Bacteria 15475
108 Ga0114129_10009131 3300009147 Bacteria 14133
109 Ga0114129_10020196 3300009147 Bacteria 9481
110 Ga0114129_10061757 3300009147 Bacteria 5236
111 Ga0114129_10085113 3300009147 Bacteria 4386
112 Ga0114129_10107458 3300009147 Bacteria 3854
113 Ga0114129_10236202 3300009147 Bacteria 2459
114 Ga0114129_10310166 3300009147 Unclassified 2100
115 Ga0114129_10534341 3300009147 Bacteria 1527
116 Ga0105243_10010606 3300009148 Bacteria 6995
117 Ga0105242_10532117 3300009176 Unclassified 1123
118 Ga0105248_10000236 3300009177 Bacteria 63750
119 Ga0105248_10008611 3300009177 Bacteria 11205
120 Ga0105248_10397548 3300009177 Bacteria 1552
121 Ga0105249_10231583 3300009553 Bacteria 1822
122 Ga0105246_10377330 3300011119 Bacteria 1170
123 Ga0157378_10010326 3300013297 Bacteria 8151
124 Ga0163162_10010453 3300013306 Bacteria 9023
125 Ga0163162_10066456 3300013306 Bacteria 3655
126 Ga0157375_10003202 3300013308 Bacteria 14201
127 Ga0157375_10031265 3300013308 Bacteria 5029
128 Ga0157375_10405742 3300013308 Bacteria 1529
129 Ga0163163_10015358 3300014325 Bacteria 7076
130 Ga0163163_10024458 3300014325 Bacteria 5749
131 Ga0163163_10036497 3300014325 Bacteria 4775
132 Ga0163163_10050427 3300014325 Bacteria 4098
133 Ga0157380_10088938 3300014326 Bacteria 2543
134 Ga0157380_10227309 3300014326 Bacteria 1673
135 Ga0157379_10000163 3300014968 Bacteria 49896
136 Ga0197907_11237859 3300020069 Bacteria 1763
137 Ga0206356_10370037 3300020070 Bacteria 1476
138 Ga0206349_1823596 3300020075 Bacteria 1027
139 Ga0206355_1403692 3300020076 Bacteria 1445
140 Ga0206351_10150774 3300020077 Bacteria 1248
141 Ga0206352_10052736 3300020078 Unclassified 1257
142 Ga0206352_11272337 3300020078 Bacteria 1198
143 Ga0206350_10668668 3300020080 Bacteria 1894
144 Ga0206353_10840278 3300020082 Bacteria 1475
145 Ga0224712_10022581 3300022467 Bacteria 2171
146 Ga0224712_10101731 3300022467 Bacteria 1220
147 Ga0209566_101212 3300025225 Bacteria 9075
148 Ga0207680_10007199 3300025903 Bacteria 5409
149 Ga0207680_10039007 3300025903 Bacteria 2752
150 Ga0207643_10106788 3300025908 Bacteria 1646
151 Ga0207643_10263707 3300025908 Bacteria 1064
152 Ga0207684_10003133 3300025910 Bacteria 16290
153 Ga0207660_10155000 3300025917 Bacteria 1763
154 Ga0207646_10014707 3300025922 Bacteria 7414
155 Ga0207646_10029767 3300025922 Bacteria 4957
156 Ga0207646_10080289 3300025922 Bacteria 2916
157 Ga0207650_10017464 3300025925 Bacteria 5025
158 Ga0207659_10001528 3300025926 Bacteria 13730
159 Ga0207659_10013834 3300025926 Bacteria 5185
160 Ga0207659_10132326 3300025926 Bacteria 1927
161 Ga0207659_10369328 3300025926 Bacteria 1194
162 Ga0207664_10089385 3300025929 Bacteria 2522
163 Ga0207644_10093991 3300025931 Bacteria 2239
164 Ga0207686_10353616 3300025934 Unclassified 1107
165 Ga0207670_10049784 3300025936 Bacteria 2804
166 Ga0207670_10064600 3300025936 Bacteria 2509
167 Ga0207670_10126172 3300025936 Unclassified 1868
168 Ga0207691_10005446 3300025940 Bacteria 12292
169 Ga0207711_10013711 3300025941 Bacteria 6731
170 Ga0207711_10075597 3300025941 Bacteria 2932
171 Ga0207679_10010255 3300025945 Bacteria 6027
172 Ga0207679_10018936 3300025945 Bacteria 4620
173 Ga0207651_10019445 3300025960 Bacteria 4071
174 Ga0207658_10016953 3300025986 Bacteria 5013
175 Ga0207658_10092663 3300025986 Bacteria 2347
176 Ga0207677_10020132 3300026023 Unclassified 4046
177 Ga0207703_10016153 3300026035 Bacteria 5819
178 Ga0207703_10066891 3300026035 Bacteria 2957
179 Ga0207641_10082433 3300026088 Bacteria 2794
180 Ga0207641_10133169 3300026088 Unclassified 2234
181 Ga0207676_10113468 3300026095 Bacteria 2272
182 Ga0207676_10179087 3300026095 Unclassified 1854
183 Ga0207676_10375782 3300026095 Bacteria 1321
184 Ga0207674_10006744 3300026116 Bacteria 13481
185 Ga0207675_100023175 3300026118 Bacteria 5773
186 Ga0207428_10097564 3300027907 Bacteria 2274
187 Ga0268265_10029360 3300028380 Unclassified 3946
188 Ga0268264_10012640 3300028381 Bacteria 6953
189 Ga0265318_10024823 3300028577 Bacteria 2372
190 Ga0265340_10064442 3300031247 Bacteria 1746
191 Ga0265331_10025315 3300031250 Bacteria 2997
192 Ga0316575_10075220 3300031665 Bacteria 1359
193 Ga0316579_10074386 3300031691 Bacteria 1613
194 Ga0307413_10037393 3300031824 Bacteria 2803
195 Ga0307410_10071120 3300031852 Bacteria 2412
196 Ga0307410_10097169 3300031852 Unclassified 2104
197 Ga0307409_100098354 3300031995 Bacteria 2420
198 Ga0307416_100172046 3300032002 Bacteria 2018
199 Ga0307416_100445779 3300032002 Unclassified 1346
200 Ga0307411_10027374 3300032005 Bacteria 3449
201 Ga0373955_0086721 3300035172 Bacteria 1778
202 Ga0373931_0281697 3300035691 Bacteria 1021
203 Ga0373927_0000098 3300035695 Bacteria 65705
204 Ga0373937_0073323 3300036401 Unclassified 3158
205 Ga0373937_0205605 3300036401 Bacteria 1852
206 Ga0373937_0322998 3300036401 Bacteria 1460
207 Ga0373937_0380675 3300036401 Bacteria 1338
208 Ga0316582_0183751 3300036647 Bacteria 1423
209 Ga0436364_0967203 3300037853 Bacteria 45513
210 Ga0436365_0982444 3300039437 Bacteria 1611
211 Ga0436363_1053072 3300039450 Bacteria 4822
212 Ga0436363_1145337 3300039450 Bacteria 1076
213 Ga0451577_0000735 3300042876 Bacteria 50706
214 Ga0451577_0012206 3300042876 Bacteria 8075
215 Ga0451577_0038382 3300042876 Unclassified 4309
216 Ga0451577_0073835 3300042876 Bacteria 3043
217 Ga0451577_0128923 3300042876 Bacteria 2268
218 Ga0451577_0209848 3300042876 Bacteria 1759
219 Ga0451577_0271502 3300042876 Unclassified 1536
220 Ga0451577_0465239 3300042876 Bacteria 1148
221 Ga0453683_0001838 3300044673 Bacteria 17454
222 Ga0453683_0006728 3300044673 Bacteria 7859
223 Ga0453683_0010514 3300044673 Bacteria 6128
224 Ga0453683_0026940 3300044673 Bacteria 3649
225 Ga0466961_0001334 3300044693 Bacteria 15210
226 Ga0453684_0000074 3300044712 Bacteria 438364
227 Ga0453684_0000232 3300044712 Bacteria 240951
228 Ga0453684_0000269 3300044712 Bacteria 223826
229 Ga0453684_0003950 3300044712 Bacteria 32433
230 Ga0453684_0004002 3300044712 Bacteria 32129
231 Ga0453684_0004414 3300044712 Bacteria 29749
232 Ga0453684_0010190 3300044712 Bacteria 16121
233 Ga0453684_0067687 3300044712 Unclassified 4540
234 Ga0453684_0081294 3300044712 Bacteria 4042
235 Ga0453684_0169466 3300044712 Bacteria 2575
236 Ga0453684_0215000 3300044712 Bacteria 2231
237 Ga0453684_0271407 3300044712 Bacteria 1938
238 Ga0453684_0308905 3300044712 Bacteria 1795
239 Ga0453684_0436149 3300044712 Unclassified 1460
240 Ga0453684_0827652 3300044712 Bacteria 996
241 Ga0466959_0218974 3300045049 Bacteria 1321
242 Ga0451576_0000322 3300045051 Bacteria 116299
243 Ga0451576_0003289 3300045051 Bacteria 22439
244 Ga0451576_0007979 3300045051 Bacteria 12519
245 Ga0451576_0017601 3300045051 Bacteria 7853
246 Ga0451576_0019420 3300045051 Bacteria 7418
247 Ga0451576_0096921 3300045051 Bacteria 3068
248 Ga0451576_0123948 3300045051 Bacteria 2691
249 Ga0451576_0464304 3300045051 Bacteria 1330
250 Ga0451576_0482600 3300045051 Bacteria 1302
251 Ga0451576_0511402 3300045051 Bacteria 1262
252 Ga0495592_0013736 3300046454 Bacteria 6160
253 Ga0495651_0199179 3300046462 Bacteria 1403
254 Ga0495639_0062846 3300046475 Bacteria 1704
255 Ga0495662_0066782 3300046476 Bacteria 1740
256 Ga0495608_0008767 3300046511 Bacteria 7075
257 Ga0495618_0038805 3300046514 Unclassified 2994
258 Ga0495586_0124520 3300046535 Unclassified 1441
259 Ga0495667_0001059 3300046559 Bacteria 17885
260 Ga0495635_0238369 3300046663 Archaea 1228
261 Ga0495657_0000804 3300046675 Bacteria 27848
262 Ga0495613_0006398 3300046689 Bacteria 8801
263 Ga0495613_0133030 3300046689 Unclassified 1780
264 Ga0495636_0059867 3300047318 Bacteria 1608
265 Ga0495674_0008506 3300047319 Bacteria 9771
266 Ga0495674_0137587 3300047319 Bacteria 2054
267 Ga0495684_0135273 3300047471 Bacteria 1850
268 Ga0495684_0188875 3300047471 Unclassified 1524
269 Ga0496105_0378451 3300048908 Bacteria 1127
270 Ga0496112_0179042 3300048915 Bacteria 2084
271 Ga0501036_0155316 3300049572 Bacteria 1930
272 Ga0501039_0106026 3300049575 Unclassified 2195
273 Ga0501046_0150978 3300049580 Bacteria 1752
274 Ga0501071_0294526 3300049587 Bacteria 1229
275 Ga0501072_0207744 3300049588 Bacteria 1561
276 Ga0501076_0024603 3300049592 Bacteria 4656
277 Ga0501076_0098871 3300049592 Bacteria 2351
278 Ga0501076_0114460 3300049592 Bacteria 2183
279 Ga0501076_0334210 3300049592 Bacteria 1243
280 Ga0501079_0040194 3300049741 Bacteria 3607
281 Ga0501079_0485448 3300049741 Bacteria 971
282 Ga0501080_0072719 3300049742 Bacteria 3199
283 Ga0501080_0417485 3300049742 Unclassified 1206
284 Ga0501081_0041034 3300049743 Bacteria 3168
285 nmdc:mga05p37_111477_c1 3300050507 Unclassified 3365
286 nmdc:mga05p37_14102_c1 3300050507 Bacteria 9591
287 nmdc:mga05p37_20519_c1 3300050507 Bacteria 7994
288 nmdc:mga05p37_229375_c1 3300050507 Bacteria 2238
289 nmdc:mga05p37_2919_c1 3300050507 Bacteria 19842
290 nmdc:mga05p37_3011_c1 3300050507 Bacteria 19550
291 nmdc:mga05p37_3183_c1 3300050507 Bacteria 19098
292 nmdc:mga05p37_35025_c1 3300050507 Bacteria 6154
293 nmdc:mga05p37_401878_c1 3300050507 Bacteria 1599
294 nmdc:mga05p37_43785_c1 3300050507 Bacteria 5508
295 nmdc:mga05p37_575527_c1 3300050507 Unclassified 1276
296 nmdc:mga09592_24252_c1 3300050508 Bacteria 5015
297 nmdc:mga09592_303830_c1 3300050508 Bacteria 1383
298 nmdc:mga09592_3410_c1 3300050508 Bacteria 12845
299 nmdc:mga09592_62471_c1 3300050508 Bacteria 3151
300 nmdc:mga0qj67_220167_c1 3300050509 Bacteria 1541
301 nmdc:mga0qj67_299052_c1 3300050509 Bacteria 1304
302 nmdc:mga06r32_117988_c1 3300050510 Unclassified 2615
303 nmdc:mga06r32_186373_c1 3300050510 Bacteria 2062
304 nmdc:mga06r32_198882_c1 3300050510 Bacteria 1992
305 nmdc:mga06r32_49032_c1 3300050510 Bacteria 4038
306 nmdc:mga06r32_54858_c1 3300050510 Bacteria 3822
307 nmdc:mga08y16_26811_c1 3300050511 Unclassified 3598
308 nmdc:mga0n895_105144_c1 3300050512 Bacteria 2835
309 nmdc:mga0n895_135186_c1 3300050512 Bacteria 2492
310 nmdc:mga0n895_73944_c1 3300050512 Bacteria 3384
311 nmdc:mga0n895_91647_c1 3300050512 Bacteria 3042
312 nmdc:mga0rr50_258202_c1 3300050513 Bacteria 1449
313 nmdc:mga0rr50_54885_c1 3300050513 Bacteria 2970
314 nmdc:mga0a205_137052_c2 3300050515 Unclassified 1911
315 nmdc:mga0a205_156089_c1 3300050515 Bacteria 2180
316 Ga0495619_0119303 3300053085 Bacteria 1808
317 Ga0501084_0008919 3300054114 Bacteria 8297
318 2904116428 2904113452 Bacteria 7796941
319 2925328751 2925326138 Bacteria 9652120
320 2980130783 2980125574 Bacteria 5567337
321 Ga0070706_100072681
322 JGI25406J46586_10004611
323 Ga0065704_10091857
324 Ga0065712_10114866
325 Ga0065712_10123623
326 Ga0065712_10126640
327 Ga0065707_10000534
328 Ga0065707_10095068
329 Ga0065707_10136852
330 Ga0070666_10057314
331 Ga0070666_10067556
332 Ga0068868_100002316
333 Ga0070689_100034744
334 Ga0070689_100060263
335 Ga0070689_100240758
336 Ga0070687_100053397
337 Ga0070675_100017174
338 Ga0070675_100017396
339 Ga0070675_100018401
340 Ga0070675_100323873
341 Ga0070675_100397008
342 Ga0070671_100086191
343 Ga0070671_100132584
344 Ga0070673_100089219
345 Ga0070673_100159546
346 Ga0070688_100046654
347 Ga0070688_100233851
348 Ga0070667_100001810
349 Ga0070667_100098724
350 Ga0070714_100115824
351 Ga0070705_100105822
352 Ga0070700_100004661
353 Ga0070694_100258802
354 Ga0070694_100329757
355 Ga0068867_100474748
356 Ga0070685_10110982
357 Ga0070706_100004930
358 Ga0070707_100021465
359 Ga0070707_100085911
360 Ga0070698_100138351
361 Ga0070698_100209857
362 Ga0070698_100253858
363 Ga0070698_100552967
364 Ga0070699_100001594
365 Ga0070699_100063639
366 Ga0070699_100284382
367 Ga0070684_100161906
368 Ga0070684_100166363
369 Ga0070672_100107539
370 Ga0070686_100005803
371 Ga0070686_100184566
372 Ga0070695_100044859
373 Ga0070704_100189241
374 Ga0070664_100014441
375 Ga0070664_100053219
376 Ga0070702_100349576
377 Ga0068859_100000349
378 Ga0068859_100004096
379 Ga0068859_100057859
380 Ga0068859_100224783
381 Ga0068864_100001147
382 Ga0068864_100028679
383 Ga0068864_100319184
384 Ga0068864_100505529
385 Ga0068870_10065151
386 Ga0068863_100000383
387 Ga0068863_100039162
388 Ga0068858_100007372
389 Ga0068858_100016274
390 Ga0081539_10001674
391 Ga0075427_10000115
392 Ga0075427_10006562
393 Ga0097621_100102664
394 Ga0075428_100060063
395 Ga0075428_100061166
396 Ga0075428_100105138
397 Ga0075430_100053806
398 Ga0075430_100161183
399 Ga0075430_100261355
400 Ga0075431_100017220
401 Ga0075431_100196824
402 Ga0075431_100368432
403 Ga0075433_10016110
404 Ga0075433_10016253
405 Ga0075433_10057275
406 Ga0075433_10173242
407 Ga0075433_10510691
408 Ga0075434_100007798
409 Ga0075434_100010351
410 Ga0075434_100025663
411 Ga0075434_100050761
412 Ga0075434_100154063
413 Ga0075429_100005864
414 Ga0075429_100044777
415 Ga0075429_100102236
416 Ga0097620_100000349
417 Ga0097620_100004096
418 Ga0097620_100057859
419 Ga0097620_100224785
420 Ga0075435_100013286
421 Ga0075435_100067469
422 Ga0111539_10015018
423 Ga0111539_10028299
424 Ga0111539_10512373
425 Ga0114129_10000797
426 Ga0114129_10002541
427 Ga0114129_10007563
428 Ga0114129_10009131
429 Ga0114129_10020196
430 Ga0114129_10061757
431 Ga0114129_10085113
432 Ga0114129_10107458
433 Ga0114129_10236202
434 Ga0114129_10310166
435 Ga0114129_10534341
436 Ga0105243_10010606
437 Ga0105242_10532117
438 Ga0105248_10000236
439 Ga0105248_10008611
440 Ga0105248_10397548
441 Ga0105249_10231583
442 Ga0105246_10377330
443 Ga0157378_10010326
444 Ga0163162_10010453
445 Ga0163162_10066456
446 Ga0157375_10003202
447 Ga0157375_10031265
448 Ga0157375_10405742
449 Ga0163163_10015358
450 Ga0163163_10024458
451 Ga0163163_10036497
452 Ga0163163_10050427
453 Ga0157380_10088938
454 Ga0157380_10227309
455 Ga0157379_10000163
456 Ga0197907_11237859
457 Ga0206356_10370037
458 Ga0206349_1823596
459 Ga0206355_1403692
460 Ga0206351_10150774
461 Ga0206352_10052736
462 Ga0206352_11272337
463 Ga0206350_10668668
464 Ga0206353_10840278
465 Ga0224712_10022581
466 Ga0224712_10101731
467 Ga0209566_101212
468 Ga0207680_10007199
469 Ga0207680_10039007
470 Ga0207643_10106788
471 Ga0207643_10263707
472 Ga0207684_10003133
473 Ga0207660_10155000
474 Ga0207646_10014707
475 Ga0207646_10029767
476 Ga0207646_10080289
477 Ga0207650_10017464
478 Ga0207659_10001528
479 Ga0207659_10013834
480 Ga0207659_10132326
481 Ga0207659_10369328
482 Ga0207664_10089385
483 Ga0207644_10093991
484 Ga0207686_10353616
485 Ga0207670_10049784
486 Ga0207670_10064600
487 Ga0207670_10126172
488 Ga0207691_10005446
489 Ga0207711_10013711
490 Ga0207711_10075597
491 Ga0207679_10010255
492 Ga0207679_10018936
493 Ga0207651_10019445
494 Ga0207658_10016953
495 Ga0207658_10092663
496 Ga0207677_10020132
497 Ga0207703_10016153
498 Ga0207703_10066891
499 Ga0207641_10082433
500 Ga0207641_10133169
501 Ga0207676_10113468
502 Ga0207676_10179087
503 Ga0207676_10375782
504 Ga0207674_10006744
505 Ga0207675_100023175
506 Ga0207428_10097564
507 Ga0268265_10029360
508 Ga0268264_10012640
509 Ga0265318_10024823
510 Ga0265340_10064442
511 Ga0265331_10025315
512 Ga0316575_10075220
513 Ga0316579_10074386
514 Ga0307413_10037393
515 Ga0307410_10071120
516 Ga0307410_10097169
517 Ga0307409_100098354
518 Ga0307416_100172046
519 Ga0307416_100445779
520 Ga0307411_10027374
521 Ga0373955_0086721
522 Ga0373931_0281697
523 Ga0373927_0000098
524 Ga0373937_0073323
525 Ga0373937_0205605
526 Ga0373937_0322998
527 Ga0373937_0380675
528 Ga0316582_0183751
529 Ga0436364_0967203
530 Ga0436365_0982444
531 Ga0436363_1053072
532 Ga0436363_1145337
533 Ga0451577_0000735
534 Ga0451577_0012206
535 Ga0451577_0038382
536 Ga0451577_0073835
537 Ga0451577_0128923
538 Ga0451577_0209848
539 Ga0451577_0271502
540 Ga0451577_0465239
541 Ga0453683_0001838
542 Ga0453683_0006728
543 Ga0453683_0010514
544 Ga0453683_0026940
545 Ga0466961_0001334
546 Ga0453684_0000074
547 Ga0453684_0000232
548 Ga0453684_0000269
549 Ga0453684_0003950
550 Ga0453684_0004002
551 Ga0453684_0004414
552 Ga0453684_0010190
553 Ga0453684_0067687
554 Ga0453684_0081294
555 Ga0453684_0169466
556 Ga0453684_0215000
557 Ga0453684_0271407
558 Ga0453684_0308905
559 Ga0453684_0436149
560 Ga0453684_0827652
561 Ga0466959_0218974
562 Ga0451576_0000322
563 Ga0451576_0003289
564 Ga0451576_0007979
565 Ga0451576_0017601
566 Ga0451576_0019420
567 Ga0451576_0096921
568 Ga0451576_0123948
569 Ga0451576_0464304
570 Ga0451576_0482600
571 Ga0451576_0511402
572 Ga0495592_0013736
573 Ga0495651_0199179
574 Ga0495639_0062846
575 Ga0495662_0066782
576 Ga0495608_0008767
577 Ga0495618_0038805
578 Ga0495586_0124520
579 Ga0495667_0001059
580 Ga0495635_0238369
581 Ga0495657_0000804
582 Ga0495613_0006398
583 Ga0495613_0133030
584 Ga0495636_0059867
585 Ga0495674_0008506
586 Ga0495674_0137587
587 Ga0495684_0135273
588 Ga0495684_0188875
589 Ga0496105_0378451
590 Ga0496112_0179042
591 Ga0501036_0155316
592 Ga0501039_0106026
593 Ga0501046_0150978
594 Ga0501071_0294526
595 Ga0501072_0207744
596 Ga0501076_0024603
597 Ga0501076_0098871
598 Ga0501076_0114460
599 Ga0501076_0334210
600 Ga0501079_0040194
601 Ga0501079_0485448
602 Ga0501080_0072719
603 Ga0501080_0417485
604 Ga0501081_0041034
605 nmdc:mga05p37_111477_c1
606 nmdc:mga05p37_14102_c1
607 nmdc:mga05p37_20519_c1
608 nmdc:mga05p37_229375_c1
609 nmdc:mga05p37_2919_c1
610 nmdc:mga05p37_3011_c1
611 nmdc:mga05p37_3183_c1
612 nmdc:mga05p37_35025_c1
613 nmdc:mga05p37_401878_c1
614 nmdc:mga05p37_43785_c1
615 nmdc:mga05p37_575527_c1
616 nmdc:mga09592_24252_c1
617 nmdc:mga09592_303830_c1
618 nmdc:mga09592_3410_c1
619 nmdc:mga09592_62471_c1
620 nmdc:mga0qj67_220167_c1
621 nmdc:mga0qj67_299052_c1
622 nmdc:mga06r32_117988_c1
623 nmdc:mga06r32_186373_c1
624 nmdc:mga06r32_198882_c1
625 nmdc:mga06r32_49032_c1
626 nmdc:mga06r32_54858_c1
627 nmdc:mga08y16_26811_c1
628 nmdc:mga0n895_105144_c1
629 nmdc:mga0n895_135186_c1
630 nmdc:mga0n895_73944_c1
631 nmdc:mga0n895_91647_c1
632 nmdc:mga0rr50_258202_c1
633 nmdc:mga0rr50_54885_c1
634 nmdc:mga0a205_137052_c2
635 nmdc:mga0a205_156089_c1
636 Ga0495619_0119303
637 Ga0501084_0008919
638 2904116428
639 2925328751
640 2980130783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00491

Arginase

Arginase family

52

344

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2eiv-assembly6.cif.gz_M crystal structure of the arginase from thermus thermophilus 0.9681 1 296
6nbk-assembly1.cif.gz_B crystal structure of arginase from bacillus cereus 0.968 1 296
6nbk-assembly3.cif.gz_A crystal structure of arginase from bacillus cereus 0.9664 1 296
6dkt-assembly5.cif.gz_E crystal structure of arginase from bacillus subtilis 0.9656 1 296
6nbk-assembly1.cif.gz_B crystal structure of arginase from bacillus cereus 0.9647 1 296
ID Description Score Start End Superfamily
6nfpA00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.9535 1 296 3.40.800.10
6nfpA00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.9503 1 296 3.40.800.10
4iu1A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.9196 1 298 3.40.800.10
af_A0A1X7RC97_10_314_3.40.800.10 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.9183 1 290 3.40.800.10
4iu1A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.9167 1 298 3.40.800.10
ID Description Score Start End GO Terms
AF-A0A3M1DNN5-F1-model_v4 Arginase 0.9882 186 296 GO:0004053
GO:0005737
GO:0019547
GO:0030145
AF-A0A6J4JGV5-F1-model_v4 Arginase (EC 3.5.3.1) 0.9808 122 298 GO:0000050
GO:0004053
GO:0005737
GO:0019547
GO:0030145
AF-A0A1Q7WSZ3-F1-model_v4 Arginase (EC 3.5.3.1) 0.9807 1 296 GO:0000050
GO:0004053
GO:0005737
GO:0019547
GO:0030145
AF-A0A812LR36-F1-model_v4 deleted 0.98 2 296
AF-A0A357NFK3-F1-model_v4 Arginase (EC 3.5.3.1) 0.9779 1 296 GO:0004053
GO:0005737
GO:0019547
GO:0030145

Map