F405414

General Info

Members Datasets Scaffolds Average Seq Length
320 158 640 165

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100037215|Ga0070705_1000372154
Length 160
Sequence MTTNATQVNATGSFAGSGDAAKGLALVRITIGAMFVWVFFENLGKGLYTPAGYAGLINYYIQHDHAPAVWKTVMAAAASHASMAAPLQGLTEISLGVLLVLGLLTRPAALVAFLFLGSLWISELLLVPVITSLGLAVGRAGRAWGVDALLARRNPVSPWW

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
65 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
104 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
113 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
157 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
158 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.12
Metatranscriptomes 1.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.06
Rhizosphere 94.38
Stem 0
Stem Tuber 0
Unclassified 37.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100037215 3300005440 Bacteria 2743
2 LJNas_1000023 3300000546 Bacteria 20717
3 Ga0070683_100009472 3300005329 Bacteria 8331
4 Ga0070680_100040194 3300005336 Unclassified 3786
5 Ga0070680_100228082 3300005336 Bacteria 1573
6 Ga0068868_101683239 3300005338 Unclassified 597
7 Ga0070687_100172378 3300005343 Bacteria 1289
8 Ga0070661_100034314 3300005344 Unclassified 3679
9 Ga0070673_101106639 3300005364 Unclassified 740
10 Ga0070709_10047348 3300005434 Bacteria 2678
11 Ga0070709_10114483 3300005434 Unclassified 1818
12 Ga0070709_10129544 3300005434 Bacteria 1721
13 Ga0070709_10932201 3300005434 Unclassified 688
14 Ga0070709_11260000 3300005434 Bacteria 596
15 Ga0070714_100040186 3300005435 Unclassified 3941
16 Ga0070714_100077770 3300005435 Bacteria 2882
17 Ga0070714_100179564 3300005435 Bacteria 1925
18 Ga0070714_100676143 3300005435 Viruses 995
19 Ga0070714_100755074 3300005435 Bacteria 940
20 Ga0070713_100108222 3300005436 Unclassified 2420
21 Ga0070713_100126421 3300005436 Bacteria 2249
22 Ga0070713_100141934 3300005436 Unclassified 2128
23 Ga0070713_100596591 3300005436 Viruses 1049
24 Ga0070713_100644454 3300005436 Bacteria 1008
25 Ga0070713_101156086 3300005436 Unclassified 749
26 Ga0070713_101299082 3300005436 Unclassified 705
27 Ga0070713_101382567 3300005436 Bacteria 683
28 Ga0070713_101709218 3300005436 Unclassified 611
29 Ga0070710_10167209 3300005437 Unclassified 1368
30 Ga0070711_100000159 3300005439 Bacteria 36590
31 Ga0070711_100038509 3300005439 Unclassified 3216
32 Ga0070708_100134488 3300005445 Bacteria 2290
33 Ga0070708_100182492 3300005445 Bacteria 1962
34 Ga0070708_100407233 3300005445 Bacteria 1282
35 Ga0070708_100446763 3300005445 Unclassified 1219
36 Ga0070708_100676325 3300005445 Unclassified 972
37 Ga0070708_100847721 3300005445 Unclassified 859
38 Ga0070663_100189684 3300005455 Bacteria 1599
39 Ga0070681_10013120 3300005458 Bacteria 8231
40 Ga0070681_10023043 3300005458 Bacteria 6261
41 Ga0070706_100777058 3300005467 Unclassified 887
42 Ga0070707_100000050 3300005468 Bacteria 102427
43 Ga0070707_100043153 3300005468 Bacteria 4317
44 Ga0070707_100204385 3300005468 Bacteria 1925
45 Ga0070707_100595927 3300005468 Bacteria 1068
46 Ga0070707_100626020 3300005468 Bacteria 1039
47 Ga0070707_101064331 3300005468 Unclassified 775
48 Ga0070698_100730535 3300005471 Bacteria 933
49 Ga0070698_100894948 3300005471 Unclassified 833
50 Ga0070698_101136691 3300005471 Unclassified 730
51 Ga0070699_100178374 3300005518 Bacteria 1884
52 Ga0070699_100838357 3300005518 Unclassified 842
53 Ga0070679_101023224 3300005530 Unclassified 770
54 Ga0070684_100051262 3300005535 Bacteria 3585
55 Ga0070684_100541143 3300005535 Unclassified 1080
56 Ga0070697_100000326 3300005536 Bacteria 37671
57 Ga0070697_100011012 3300005536 Bacteria 7065
58 Ga0070697_100011538 3300005536 Bacteria 6903
59 Ga0070697_100053020 3300005536 Bacteria 3296
60 Ga0070697_100104469 3300005536 Bacteria 2355
61 Ga0070697_100209413 3300005536 Bacteria 1659
62 Ga0070693_100406588 3300005547 Bacteria 945
63 Ga0070693_100475452 3300005547 Unclassified 882
64 Ga0068855_100182725 3300005563 Bacteria 2370
65 Ga0068855_100606825 3300005563 Bacteria 1179
66 Ga0070664_100700737 3300005564 Unclassified 943
67 Ga0068857_100436525 3300005577 Bacteria 1223
68 Ga0068854_100012486 3300005578 Bacteria 5565
69 Ga0068856_100001532 3300005614 Bacteria 24221
70 Ga0068856_100275654 3300005614 Bacteria 1698
71 Ga0068856_100289343 3300005614 Unclassified 1655
72 Ga0068856_100351717 3300005614 Unclassified 1492
73 Ga0068852_100854562 3300005616 Unclassified 926
74 Ga0068852_101394466 3300005616 Unclassified 723
75 Ga0068859_100135369 3300005617 Bacteria 2536
76 Ga0068864_100898564 3300005618 Bacteria 875
77 Ga0068863_100026229 3300005841 Bacteria 5561
78 Ga0068863_100412157 3300005841 Bacteria 1323
79 Ga0068863_100815185 3300005841 Unclassified 931
80 Ga0068858_100039288 3300005842 Unclassified 4389
81 Ga0068858_100104607 3300005842 Bacteria 2641
82 Ga0068858_100233690 3300005842 Bacteria 1743
83 Ga0068858_100542144 3300005842 Bacteria 1126
84 Ga0070717_10001232 3300006028 Bacteria 17417
85 Ga0070717_10020392 3300006028 Bacteria 5213
86 Ga0070717_10022580 3300006028 Bacteria 4973
87 Ga0070717_10080035 3300006028 Unclassified 2741
88 Ga0070717_10111476 3300006028 Unclassified 2334
89 Ga0070717_10165414 3300006028 Unclassified 1921
90 Ga0070717_10188568 3300006028 Bacteria 1801
91 Ga0070717_10235282 3300006028 Bacteria 1614
92 Ga0070717_10249109 3300006028 Unclassified 1569
93 Ga0070717_10349997 3300006028 Unclassified 1321
94 Ga0070717_10683682 3300006028 Unclassified 932
95 Ga0070717_10723596 3300006028 Unclassified 904
96 Ga0070717_11712832 3300006028 Unclassified 569
97 Ga0070716_100000354 3300006173 Bacteria 18784
98 Ga0070716_100003866 3300006173 Bacteria 7112
99 Ga0070716_100021401 3300006173 Unclassified 3408
100 Ga0070716_100069700 3300006173 Bacteria 2062
101 Ga0070716_100161954 3300006173 Unclassified 1451
102 Ga0070712_100033247 3300006175 Bacteria 3488
103 Ga0070712_100063059 3300006175 Unclassified 2623
104 Ga0070712_100295302 3300006175 Unclassified 1310
105 Ga0070712_101226965 3300006175 Unclassified 653
106 Ga0075434_100006014 3300006871 Bacteria 11103
107 Ga0075434_100020351 3300006871 Bacteria 6435
108 Ga0068865_100247002 3300006881 Bacteria 1407
109 Ga0075436_100002580 3300006914 Bacteria 12453
110 Ga0075436_100008969 3300006914 Bacteria 6844
111 Ga0075436_100142142 3300006914 Bacteria 1687
112 Ga0097620_100135361 3300006931 Bacteria 2536
113 Ga0075435_100063320 3300007076 Unclassified 3003
114 Ga0075435_100142468 3300007076 Bacteria 2012
115 Ga0099794_10000882 3300007265 Bacteria 10130
116 Ga0099794_10111065 3300007265 Unclassified 1373
117 Ga0099794_10284495 3300007265 Unclassified 855
118 Ga0099794_10325416 3300007265 Unclassified 798
119 Ga0099794_10579705 3300007265 Unclassified 593
120 Ga0099795_10146916 3300007788 Bacteria 963
121 Ga0099795_10224134 3300007788 Unclassified 801
122 Ga0105240_10038089 3300009093 Bacteria 6172
123 Ga0105240_10153549 3300009093 Unclassified 2740
124 Ga0105245_10000411 3300009098 Bacteria 39875
125 Ga0114129_10840108 3300009147 Unclassified 1168
126 Ga0105241_10254028 3300009174 Bacteria 1491
127 Ga0105248_10524712 3300009177 Unclassified 1335
128 Ga0105237_10038741 3300009545 Bacteria 4813
129 Ga0105237_10340471 3300009545 Bacteria 1504
130 Ga0105238_10036544 3300009551 Bacteria 4994
131 Ga0099796_10180158 3300010159 Bacteria 848
132 Ga0105239_10582233 3300010375 Bacteria 1276
133 Ga0157373_10051986 3300013100 Unclassified 2916
134 Ga0157373_10061908 3300013100 Bacteria 2650
135 Ga0157373_10339221 3300013100 Unclassified 1071
136 Ga0157369_10155259 3300013105 Bacteria 2418
137 Ga0157369_10594039 3300013105 Bacteria 1143
138 Ga0157374_10065571 3300013296 Unclassified 3410
139 Ga0157374_11022451 3300013296 Bacteria 846
140 Ga0157378_10183123 3300013297 Unclassified 1972
141 Ga0163162_10907036 3300013306 Unclassified 994
142 Ga0157372_10030521 3300013307 Bacteria 5897
143 Ga0157372_10319246 3300013307 Bacteria 1808
144 Ga0163163_10699341 3300014325 Bacteria 1077
145 Ga0163163_12165403 3300014325 Unclassified 615
146 Ga0182008_10009546 3300014497 Bacteria 5229
147 Ga0157379_10579148 3300014968 Bacteria 1046
148 Ga0182007_10040366 3300015262 Unclassified 1559
149 Ga0182005_1011524 3300015265 Bacteria 2518
150 Ga0213874_10132601 3300021377 Bacteria 857
151 Ga0213876_10032500 3300021384 Bacteria 2752
152 Ga0207692_10040499 3300025898 Bacteria 2299
153 Ga0207692_10086083 3300025898 Bacteria 1692
154 Ga0207642_10027827 3300025899 Unclassified 2319
155 Ga0207685_10077256 3300025905 Bacteria 1367
156 Ga0207699_10072460 3300025906 Bacteria 2110
157 Ga0207699_10131876 3300025906 Bacteria 1631
158 Ga0207699_10155871 3300025906 Unclassified 1516
159 Ga0207699_10158888 3300025906 Bacteria 1503
160 Ga0207699_10263998 3300025906 Unclassified 1191
161 Ga0207699_10300300 3300025906 Bacteria 1121
162 Ga0207699_10497096 3300025906 Bacteria 880
163 Ga0207699_10639048 3300025906 Unclassified 777
164 Ga0207699_10826097 3300025906 Unclassified 682
165 Ga0207684_10125543 3300025910 Bacteria 2202
166 Ga0207684_10305736 3300025910 Bacteria 1371
167 Ga0207684_10484074 3300025910 Bacteria 1061
168 Ga0207684_10613148 3300025910 Unclassified 929
169 Ga0207707_10015200 3300025912 Bacteria 6702
170 Ga0207707_10066300 3300025912 Bacteria 3144
171 Ga0207707_10086116 3300025912 Bacteria 2746
172 Ga0207707_10159744 3300025912 Bacteria 1971
173 Ga0207695_10107005 3300025913 Bacteria 2782
174 Ga0207695_10337257 3300025913 Bacteria 1396
175 Ga0207693_10002464 3300025915 Bacteria 16079
176 Ga0207693_10013939 3300025915 Bacteria 6473
177 Ga0207693_10015230 3300025915 Bacteria 6172
178 Ga0207693_10125350 3300025915 Unclassified 2018
179 Ga0207693_10334213 3300025915 Bacteria 1186
180 Ga0207663_10000965 3300025916 Bacteria 13150
181 Ga0207663_10063906 3300025916 Unclassified 2346
182 Ga0207663_11112611 3300025916 Bacteria 635
183 Ga0207660_10349746 3300025917 Unclassified 1184
184 Ga0207657_10010205 3300025919 Bacteria 9383
185 Ga0207649_10088524 3300025920 Bacteria 2022
186 Ga0207652_10654737 3300025921 Bacteria 939
187 Ga0207646_10000037 3300025922 Bacteria 196362
188 Ga0207646_10050454 3300025922 Bacteria 3724
189 Ga0207646_10105087 3300025922 Bacteria 2532
190 Ga0207646_10404050 3300025922 Bacteria 1233
191 Ga0207694_10063306 3300025924 Bacteria 2881
192 Ga0207694_10812258 3300025924 Bacteria 790
193 Ga0207687_10000141 3300025927 Bacteria 48006
194 Ga0207700_10018967 3300025928 Bacteria 4637
195 Ga0207700_10028873 3300025928 Unclassified 3908
196 Ga0207700_10085103 3300025928 Unclassified 2481
197 Ga0207700_11265432 3300025928 Unclassified 658
198 Ga0207664_10136687 3300025929 Bacteria 2069
199 Ga0207664_10243129 3300025929 Unclassified 1568
200 Ga0207664_10297813 3300025929 Bacteria 1418
201 Ga0207664_10450767 3300025929 Bacteria 1148
202 Ga0207664_10728739 3300025929 Unclassified 892
203 Ga0207664_10861754 3300025929 Bacteria 814
204 Ga0207644_10341673 3300025931 Bacteria 1214
205 Ga0207690_10343128 3300025932 Bacteria 1179
206 Ga0207706_10016470 3300025933 Bacteria 6671
207 Ga0207704_11425796 3300025938 Unclassified 594
208 Ga0207665_10000596 3300025939 Bacteria 24294
209 Ga0207665_10003730 3300025939 Bacteria 10181
210 Ga0207665_10014915 3300025939 Bacteria 5105
211 Ga0207665_10044361 3300025939 Bacteria 2976
212 Ga0207665_10063331 3300025939 Unclassified 2511
213 Ga0207661_10005239 3300025944 Bacteria 9117
214 Ga0207679_10146112 3300025945 Bacteria 1918
215 Ga0207667_10342982 3300025949 Bacteria 1524
216 Ga0207640_10068667 3300025981 Bacteria 2376
217 Ga0207640_10508562 3300025981 Bacteria 1004
218 Ga0207677_11465199 3300026023 Unclassified 630
219 Ga0207703_10038527 3300026035 Bacteria 3815
220 Ga0207703_10307334 3300026035 Bacteria 1448
221 Ga0207678_10435524 3300026067 Bacteria 1138
222 Ga0207702_10001513 3300026078 Bacteria 22979
223 Ga0207702_10126375 3300026078 Bacteria 2296
224 Ga0207702_10201118 3300026078 Bacteria 1847
225 Ga0207702_10217570 3300026078 Unclassified 1779
226 Ga0207641_10088629 3300026088 Bacteria 2702
227 Ga0207641_10632715 3300026088 Bacteria 1050
228 Ga0207641_10643121 3300026088 Unclassified 1041
229 Ga0207641_10803906 3300026088 Unclassified 930
230 Ga0207648_10010627 3300026089 Bacteria 8702
231 Ga0207676_10834051 3300026095 Bacteria 901
232 Ga0207674_10100651 3300026116 Unclassified 2871
233 Ga0209588_1008568 3300027671 Bacteria 3034
234 Ga0209588_1009128 3300027671 Unclassified 2957
235 Ga0209588_1143907 3300027671 Unclassified 757
236 Ga0265354_1006113 3300028016 Bacteria 1201
237 Ga0265762_1001012 3300030760 Bacteria 5045
238 Ga0265762_1004191 3300030760 Bacteria 2584
239 Ga0265762_1075077 3300030760 Bacteria 715
240 Ga0265760_10001941 3300031090 Bacteria 6068
241 Ga0265760_10008341 3300031090 Unclassified 2964
242 Ga0265760_10013332 3300031090 Unclassified 2354
243 Ga0373938_0008906 3300034957 Unclassified 1804
244 Ga0373926_0001291 3300035083 Bacteria 7536
245 Ga0373951_0023311 3300035091 Unclassified 1430
246 Ga0373923_0000647 3300035111 Bacteria 8780
247 Ga0373936_0078948 3300035113 Unclassified 1367
248 Ga0373945_0085875 3300035116 Unclassified 1212
249 Ga0373945_0271414 3300035116 Unclassified 721
250 Ga0373956_0167477 3300035119 Bacteria 1037
251 Ga0373943_0106378 3300035170 Bacteria 1474
252 Ga0373943_0131584 3300035170 Bacteria 1339
253 Ga0373943_0155883 3300035170 Bacteria 1240
254 Ga0373935_0000269 3300035692 Bacteria 25655
255 Ga0373927_0005951 3300035695 Bacteria 8352
256 Ga0373927_0160921 3300035695 Bacteria 1471
257 Ga0373927_0205277 3300035695 Unclassified 1294
258 Ga0373933_0257353 3300035724 Bacteria 1125
259 Ga0373947_0000632 3300035725 Bacteria 20796
260 Ga0373947_0020725 3300035725 Bacteria 3799
261 Ga0373937_0009898 3300036401 Bacteria 8312
262 Ga0373925_0006247 3300037068 Bacteria 8786
263 Ga0373925_0932944 3300037068 Unclassified 715
264 Ga0373925_1034016 3300037068 Bacteria 676
265 Ga0395900_0705280 3300037418 Unclassified 942
266 Ga0395905_0299478 3300037471 Bacteria 1495
267 Ga0436365_1703302 3300039437 Unclassified 3899
268 Ga0436361_0784669 3300039447 Bacteria 1412
269 Ga0436363_0724764 3300039450 Unclassified 860
270 Ga0436363_1043062 3300039450 Bacteria 1428
271 Ga0451577_1373892 3300042876 Bacteria 627
272 Ga0453683_0037003 3300044673 Unclassified 3070
273 Ga0453683_0897959 3300044673 Unclassified 586
274 Ga0453684_1543154 3300044712 Bacteria 684
275 Ga0451576_0048982 3300045051 Unclassified 4434
276 Ga0495603_0415514 3300046455 Bacteria 771
277 Ga0495629_0087003 3300046459 Bacteria 2180
278 Ga0495651_0034780 3300046462 Bacteria 3927
279 Ga0495580_0001878 3300046472 Bacteria 18487
280 Ga0495580_0046779 3300046472 Unclassified 3069
281 Ga0495580_0189112 3300046472 Unclassified 1420
282 Ga0495580_0355304 3300046472 Unclassified 992
283 Ga0495582_0649659 3300046473 Unclassified 610
284 Ga0495608_0119874 3300046511 Unclassified 1688
285 Ga0495665_0005064 3300046531 Bacteria 7105
286 Ga0495665_0051024 3300046531 Bacteria 2192
287 Ga0495665_0142213 3300046531 Unclassified 1254
288 Ga0495665_0337407 3300046531 Unclassified 768
289 Ga0495586_0045954 3300046535 Bacteria 2354
290 Ga0495645_0895805 3300046543 Bacteria 527
291 Ga0495667_0109259 3300046559 Unclassified 1787
292 Ga0495667_0739252 3300046559 Unclassified 608
293 Ga0495657_0490958 3300046675 Bacteria 717
294 Ga0495613_0183958 3300046689 Bacteria 1479
295 Ga0495581_0033735 3300047315 Unclassified 2963
296 Ga0495674_0521045 3300047319 Bacteria 949
297 Ga0495674_0815031 3300047319 Unclassified 725
298 Ga0495675_0099156 3300047444 Bacteria 1824
299 Ga0495602_0686656 3300048088 Bacteria 696
300 Ga0495614_0423460 3300048089 Unclassified 628
301 Ga0496100_0018636 3300048903 Unclassified 4122
302 Ga0496101_0024720 3300048904 Bacteria 4161
303 Ga0496101_0384924 3300048904 Unclassified 1104
304 Ga0496102_0186702 3300048905 Unclassified 1954
305 Ga0496102_0401694 3300048905 Unclassified 1288
306 Ga0496105_0040427 3300048908 Bacteria 3845
307 Ga0496107_0291509 3300048910 Bacteria 1215
308 Ga0496112_0252236 3300048915 Unclassified 1715
309 Ga0496112_0253192 3300048915 Bacteria 1712
310 Ga0496112_0357077 3300048915 Bacteria 1403
311 Ga0496113_0075606 3300048916 Unclassified 2571
312 Ga0496115_0042209 3300048918 Bacteria 3633
313 Ga0496115_1057742 3300048918 Unclassified 617
314 nmdc:mga0n895_58962_c1 3300050512 Bacteria 3787
315 nmdc:mga0n895_6406_c1 3300050512 Bacteria 9987
316 nmdc:mga0rr50_65554_c1 3300050513 Unclassified 2751
317 nmdc:mga08x19_1192190_c1 3300050514 Bacteria 540
318 nmdc:mga08x19_43093_c1 3300050514 Bacteria 2879
319 Ga0495601_0003529 3300053077 Bacteria 8994
320 Ga0495595_0276399 3300053084 Archaea 843
321 Ga0070705_100037215
322 LJNas_1000023
323 Ga0070683_100009472
324 Ga0070680_100040194
325 Ga0070680_100228082
326 Ga0068868_101683239
327 Ga0070687_100172378
328 Ga0070661_100034314
329 Ga0070673_101106639
330 Ga0070709_10047348
331 Ga0070709_10114483
332 Ga0070709_10129544
333 Ga0070709_10932201
334 Ga0070709_11260000
335 Ga0070714_100040186
336 Ga0070714_100077770
337 Ga0070714_100179564
338 Ga0070714_100676143
339 Ga0070714_100755074
340 Ga0070713_100108222
341 Ga0070713_100126421
342 Ga0070713_100141934
343 Ga0070713_100596591
344 Ga0070713_100644454
345 Ga0070713_101156086
346 Ga0070713_101299082
347 Ga0070713_101382567
348 Ga0070713_101709218
349 Ga0070710_10167209
350 Ga0070711_100000159
351 Ga0070711_100038509
352 Ga0070708_100134488
353 Ga0070708_100182492
354 Ga0070708_100407233
355 Ga0070708_100446763
356 Ga0070708_100676325
357 Ga0070708_100847721
358 Ga0070663_100189684
359 Ga0070681_10013120
360 Ga0070681_10023043
361 Ga0070706_100777058
362 Ga0070707_100000050
363 Ga0070707_100043153
364 Ga0070707_100204385
365 Ga0070707_100595927
366 Ga0070707_100626020
367 Ga0070707_101064331
368 Ga0070698_100730535
369 Ga0070698_100894948
370 Ga0070698_101136691
371 Ga0070699_100178374
372 Ga0070699_100838357
373 Ga0070679_101023224
374 Ga0070684_100051262
375 Ga0070684_100541143
376 Ga0070697_100000326
377 Ga0070697_100011012
378 Ga0070697_100011538
379 Ga0070697_100053020
380 Ga0070697_100104469
381 Ga0070697_100209413
382 Ga0070693_100406588
383 Ga0070693_100475452
384 Ga0068855_100182725
385 Ga0068855_100606825
386 Ga0070664_100700737
387 Ga0068857_100436525
388 Ga0068854_100012486
389 Ga0068856_100001532
390 Ga0068856_100275654
391 Ga0068856_100289343
392 Ga0068856_100351717
393 Ga0068852_100854562
394 Ga0068852_101394466
395 Ga0068859_100135369
396 Ga0068864_100898564
397 Ga0068863_100026229
398 Ga0068863_100412157
399 Ga0068863_100815185
400 Ga0068858_100039288
401 Ga0068858_100104607
402 Ga0068858_100233690
403 Ga0068858_100542144
404 Ga0070717_10001232
405 Ga0070717_10020392
406 Ga0070717_10022580
407 Ga0070717_10080035
408 Ga0070717_10111476
409 Ga0070717_10165414
410 Ga0070717_10188568
411 Ga0070717_10235282
412 Ga0070717_10249109
413 Ga0070717_10349997
414 Ga0070717_10683682
415 Ga0070717_10723596
416 Ga0070717_11712832
417 Ga0070716_100000354
418 Ga0070716_100003866
419 Ga0070716_100021401
420 Ga0070716_100069700
421 Ga0070716_100161954
422 Ga0070712_100033247
423 Ga0070712_100063059
424 Ga0070712_100295302
425 Ga0070712_101226965
426 Ga0075434_100006014
427 Ga0075434_100020351
428 Ga0068865_100247002
429 Ga0075436_100002580
430 Ga0075436_100008969
431 Ga0075436_100142142
432 Ga0097620_100135361
433 Ga0075435_100063320
434 Ga0075435_100142468
435 Ga0099794_10000882
436 Ga0099794_10111065
437 Ga0099794_10284495
438 Ga0099794_10325416
439 Ga0099794_10579705
440 Ga0099795_10146916
441 Ga0099795_10224134
442 Ga0105240_10038089
443 Ga0105240_10153549
444 Ga0105245_10000411
445 Ga0114129_10840108
446 Ga0105241_10254028
447 Ga0105248_10524712
448 Ga0105237_10038741
449 Ga0105237_10340471
450 Ga0105238_10036544
451 Ga0099796_10180158
452 Ga0105239_10582233
453 Ga0157373_10051986
454 Ga0157373_10061908
455 Ga0157373_10339221
456 Ga0157369_10155259
457 Ga0157369_10594039
458 Ga0157374_10065571
459 Ga0157374_11022451
460 Ga0157378_10183123
461 Ga0163162_10907036
462 Ga0157372_10030521
463 Ga0157372_10319246
464 Ga0163163_10699341
465 Ga0163163_12165403
466 Ga0182008_10009546
467 Ga0157379_10579148
468 Ga0182007_10040366
469 Ga0182005_1011524
470 Ga0213874_10132601
471 Ga0213876_10032500
472 Ga0207692_10040499
473 Ga0207692_10086083
474 Ga0207642_10027827
475 Ga0207685_10077256
476 Ga0207699_10072460
477 Ga0207699_10131876
478 Ga0207699_10155871
479 Ga0207699_10158888
480 Ga0207699_10263998
481 Ga0207699_10300300
482 Ga0207699_10497096
483 Ga0207699_10639048
484 Ga0207699_10826097
485 Ga0207684_10125543
486 Ga0207684_10305736
487 Ga0207684_10484074
488 Ga0207684_10613148
489 Ga0207707_10015200
490 Ga0207707_10066300
491 Ga0207707_10086116
492 Ga0207707_10159744
493 Ga0207695_10107005
494 Ga0207695_10337257
495 Ga0207693_10002464
496 Ga0207693_10013939
497 Ga0207693_10015230
498 Ga0207693_10125350
499 Ga0207693_10334213
500 Ga0207663_10000965
501 Ga0207663_10063906
502 Ga0207663_11112611
503 Ga0207660_10349746
504 Ga0207657_10010205
505 Ga0207649_10088524
506 Ga0207652_10654737
507 Ga0207646_10000037
508 Ga0207646_10050454
509 Ga0207646_10105087
510 Ga0207646_10404050
511 Ga0207694_10063306
512 Ga0207694_10812258
513 Ga0207687_10000141
514 Ga0207700_10018967
515 Ga0207700_10028873
516 Ga0207700_10085103
517 Ga0207700_11265432
518 Ga0207664_10136687
519 Ga0207664_10243129
520 Ga0207664_10297813
521 Ga0207664_10450767
522 Ga0207664_10728739
523 Ga0207664_10861754
524 Ga0207644_10341673
525 Ga0207690_10343128
526 Ga0207706_10016470
527 Ga0207704_11425796
528 Ga0207665_10000596
529 Ga0207665_10003730
530 Ga0207665_10014915
531 Ga0207665_10044361
532 Ga0207665_10063331
533 Ga0207661_10005239
534 Ga0207679_10146112
535 Ga0207667_10342982
536 Ga0207640_10068667
537 Ga0207640_10508562
538 Ga0207677_11465199
539 Ga0207703_10038527
540 Ga0207703_10307334
541 Ga0207678_10435524
542 Ga0207702_10001513
543 Ga0207702_10126375
544 Ga0207702_10201118
545 Ga0207702_10217570
546 Ga0207641_10088629
547 Ga0207641_10632715
548 Ga0207641_10643121
549 Ga0207641_10803906
550 Ga0207648_10010627
551 Ga0207676_10834051
552 Ga0207674_10100651
553 Ga0209588_1008568
554 Ga0209588_1009128
555 Ga0209588_1143907
556 Ga0265354_1006113
557 Ga0265762_1001012
558 Ga0265762_1004191
559 Ga0265762_1075077
560 Ga0265760_10001941
561 Ga0265760_10008341
562 Ga0265760_10013332
563 Ga0373938_0008906
564 Ga0373926_0001291
565 Ga0373951_0023311
566 Ga0373923_0000647
567 Ga0373936_0078948
568 Ga0373945_0085875
569 Ga0373945_0271414
570 Ga0373956_0167477
571 Ga0373943_0106378
572 Ga0373943_0131584
573 Ga0373943_0155883
574 Ga0373935_0000269
575 Ga0373927_0005951
576 Ga0373927_0160921
577 Ga0373927_0205277
578 Ga0373933_0257353
579 Ga0373947_0000632
580 Ga0373947_0020725
581 Ga0373937_0009898
582 Ga0373925_0006247
583 Ga0373925_0932944
584 Ga0373925_1034016
585 Ga0395900_0705280
586 Ga0395905_0299478
587 Ga0436365_1703302
588 Ga0436361_0784669
589 Ga0436363_0724764
590 Ga0436363_1043062
591 Ga0451577_1373892
592 Ga0453683_0037003
593 Ga0453683_0897959
594 Ga0453684_1543154
595 Ga0451576_0048982
596 Ga0495603_0415514
597 Ga0495629_0087003
598 Ga0495651_0034780
599 Ga0495580_0001878
600 Ga0495580_0046779
601 Ga0495580_0189112
602 Ga0495580_0355304
603 Ga0495582_0649659
604 Ga0495608_0119874
605 Ga0495665_0005064
606 Ga0495665_0051024
607 Ga0495665_0142213
608 Ga0495665_0337407
609 Ga0495586_0045954
610 Ga0495645_0895805
611 Ga0495667_0109259
612 Ga0495667_0739252
613 Ga0495657_0490958
614 Ga0495613_0183958
615 Ga0495581_0033735
616 Ga0495674_0521045
617 Ga0495674_0815031
618 Ga0495675_0099156
619 Ga0495602_0686656
620 Ga0495614_0423460
621 Ga0496100_0018636
622 Ga0496101_0024720
623 Ga0496101_0384924
624 Ga0496102_0186702
625 Ga0496102_0401694
626 Ga0496105_0040427
627 Ga0496107_0291509
628 Ga0496112_0252236
629 Ga0496112_0253192
630 Ga0496112_0357077
631 Ga0496113_0075606
632 Ga0496115_0042209
633 Ga0496115_1057742
634 nmdc:mga0n895_58962_c1
635 nmdc:mga0n895_6406_c1
636 nmdc:mga0rr50_65554_c1
637 nmdc:mga08x19_1192190_c1
638 nmdc:mga08x19_43093_c1
639 Ga0495601_0003529
640 Ga0495595_0276399

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07681

DoxX

DoxX

23

127

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rld-assembly1.cif.gz_B crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.48 18 141
2rld-assembly1.cif.gz_B crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.441 18 141
1x8z-assembly2.cif.gz_C crystal structure of a pectin methylesterase inhibitor from arabidopsis thaliana 0.431 17 147
3i9w-assembly1.cif.gz_A crystal structure of the e. coli histidine kinase sensor tors sensor domain 0.3868 17 157
6k4j-assembly1.cif.gz_A crystal structure of the the cd9 0.3724 16 160
ID Description Score Start End Superfamily
af_Q7TP91_4_196_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6893 17 150 1.20.120.550
af_Q8T0T9_12_131_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6404 24 138 1.20.120.550
af_Q8T0T9_12_131_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6132 24 138 1.20.120.550
af_Q4E5C0_1_157_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6075 16 159 1.20.120.550
af_Q7KSM4_10_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5814 17 158 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A2U3K7L6-F1-model_v4 DoxX family protein 0.9875 16 164 GO:0016020
AF-A0A534Q1C8-F1-model_v4 DoxX family membrane protein 0.9857 18 164 GO:0016020
AF-A0A534PVB9-F1-model_v4 DoxX family membrane protein 0.9789 16 164 GO:0016020
AF-A0A2U3K7L6-F1-model_v4 DoxX family protein 0.9746 16 164 GO:0016020
AF-A0A3N5H890-F1-model_v4 DoxX family membrane protein 0.9724 32 164 GO:0016020

Map