F405309

General Info

Members Datasets Scaffolds Average Seq Length
319 210 314 248

Family's Representative Sequence

Representative Sequence 3300053130|Ga0500642_0053092|Ga0500642_0053092_284_1066
Length 260
Sequence MSTDPDYPQMAATRGRIEPAPRRVRGYLGDELVFDTTAARYVWEVPYYPAYYVPLVDVRAEFLRDDDHPQKVQFGPSRLHSLVGAGQTHKSAARVFDADSDSPVAGTVRFEWEPLRWFEEDEPIYGHPRNPYVRVDALRSHRHVRVELDNVVLADTRAPVLLFETGLPTRYYIDPTDIAFEHLEPSTTQTLCPYKGTTSGYWSVRVGPLGEGVVHPDLAWTYHYPLPAVAPIAGLVAFYNEKLDIIVDGVALPRAQTKFS

Samples

Sample ID Description Type Environment
1 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
2 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
3 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
4 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
5 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
6 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
7 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
149 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
150 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
151 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
160 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
193 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
205 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
206 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
207 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
208 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 0
Isolates 1.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.73
Nodule 0
Rhizoplane 9.4
Rhizosphere 69.59
Stem 0
Stem Tuber 0
Unclassified 6.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1003801 3300000546 Bacteria 1711
2 JGI24746J21847_1000281 3300001977 Bacteria 7239
3 JGI24744J21845_10004254 3300002077 Bacteria 2953
4 JGI24744J21845_10005224 3300002077 Bacteria 2685
5 JGI24034J26672_10002735 3300002239 Bacteria 2434
6 JGI24742J22300_10005951 3300002244 Bacteria 2007
7 Ga0055540_1002144 3300003792 Bacteria 10753
8 Ga0070690_100018861 3300005330 Bacteria 4176
9 Ga0070666_10010532 3300005335 Bacteria 5784
10 Ga0070682_100014853 3300005337 Bacteria 4506
11 Ga0068868_100003813 3300005338 Bacteria 10527
12 Ga0068868_100100345 3300005338 Bacteria 2342
13 Ga0070691_10002842 3300005341 Bacteria 7747
14 Ga0070687_100149604 3300005343 Bacteria 1369
15 Ga0070692_10090579 3300005345 Bacteria 1662
16 Ga0070668_100011018 3300005347 Bacteria 6729
17 Ga0070668_100269423 3300005347 Bacteria 1419
18 Ga0070668_100488537 3300005347 Bacteria 1064
19 Ga0070671_100007188 3300005355 Bacteria 8901
20 Ga0070671_100049453 3300005355 Bacteria 3498
21 Ga0070671_100158316 3300005355 Bacteria 1914
22 Ga0070674_100017985 3300005356 Bacteria 4459
23 Ga0070673_100038595 3300005364 Bacteria 3648
24 Ga0070688_100057876 3300005365 Bacteria 2438
25 Ga0070659_100104379 3300005366 Bacteria 2283
26 Ga0070667_100002821 3300005367 Bacteria 14997
27 Ga0070667_100004900 3300005367 Bacteria 11212
28 Ga0070667_100069377 3300005367 Bacteria 2999
29 Ga0070703_10073518 3300005406 Bacteria 1147
30 Ga0070709_10021559 3300005434 Bacteria 3754
31 Ga0070714_100152022 3300005435 Bacteria 2087
32 Ga0070710_10006864 3300005437 Bacteria 5494
33 Ga0070710_10016568 3300005437 Bacteria 3754
34 Ga0070701_10039998 3300005438 Bacteria 2381
35 Ga0070711_100001137 3300005439 Bacteria 14245
36 Ga0070711_100029112 3300005439 Bacteria 3641
37 Ga0070694_100005346 3300005444 Bacteria 7764
38 Ga0070678_100000395 3300005456 Bacteria 20536
39 Ga0070662_100001778 3300005457 Bacteria 13273
40 Ga0068867_100013026 3300005459 Bacteria 5885
41 Ga0070685_10024635 3300005466 Bacteria 3307
42 Ga0070685_10065620 3300005466 Bacteria 2137
43 Ga0068853_100002863 3300005539 Bacteria 13085
44 Ga0068853_100040399 3300005539 Bacteria 3980
45 Ga0068853_100069353 3300005539 Bacteria 3067
46 Ga0070672_100106226 3300005543 Bacteria 2284
47 Ga0070686_100038661 3300005544 Bacteria 2967
48 Ga0070695_100044711 3300005545 Bacteria 2821
49 Ga0070696_100001182 3300005546 Bacteria 16914
50 Ga0070696_100075670 3300005546 Bacteria 2376
51 Ga0070693_100007380 3300005547 Bacteria 5372
52 Ga0070665_100014137 3300005548 Bacteria 8021
53 Ga0070665_100019887 3300005548 Bacteria 6742
54 Ga0070665_100137898 3300005548 Bacteria 2442
55 Ga0070704_100000792 3300005549 Bacteria 15625
56 Ga0070704_100067660 3300005549 Bacteria 2580
57 Ga0068855_100379610 3300005563 Bacteria 1552
58 Ga0068854_100011976 3300005578 Bacteria 5666
59 Ga0070702_100003764 3300005615 Bacteria 6845
60 Ga0068859_100032172 3300005617 Bacteria 5269
61 Ga0068866_10002412 3300005718 Bacteria 7722
62 Ga0068861_100002992 3300005719 Bacteria 11154
63 Ga0068863_100001515 3300005841 Bacteria 22936
64 Ga0068858_100010911 3300005842 Bacteria 8587
65 Ga0068858_100303271 3300005842 Bacteria 1524
66 Ga0068860_100001753 3300005843 Bacteria 23130
67 Ga0068860_100178213 3300005843 Bacteria 2054
68 Ga0068862_100016796 3300005844 Bacteria 6093
69 Ga0068862_100267307 3300005844 Bacteria 1563
70 Ga0081455_10099737 3300005937 Bacteria 2335
71 Ga0081455_10190296 3300005937 Bacteria 1546
72 Ga0081455_10221400 3300005937 Bacteria 1402
73 Ga0075365_10011454 3300006038 Bacteria 5215
74 Ga0075365_10045065 3300006038 Bacteria 2892
75 Ga0075365_10087920 3300006038 Bacteria 2113
76 Ga0075363_100036539 3300006048 Bacteria 2577
77 Ga0075363_100079579 3300006048 Bacteria 1791
78 Ga0075363_100331028 3300006048 Bacteria 887
79 Ga0075364_10005434 3300006051 Bacteria 7404
80 Ga0075364_10032131 3300006051 Bacteria 3372
81 Ga0075364_10035561 3300006051 Bacteria 3220
82 Ga0075364_10281205 3300006051 Bacteria 1132
83 Ga0070715_10024318 3300006163 Bacteria 2384
84 Ga0070716_100001575 3300006173 Bacteria 10248
85 Ga0070716_100021832 3300006173 Bacteria 3376
86 Ga0070716_100029693 3300006173 Bacteria 2959
87 Ga0070712_100001039 3300006175 Bacteria 16755
88 Ga0070712_100001485 3300006175 Bacteria 14316
89 Ga0075362_10015672 3300006177 Bacteria 3087
90 Ga0075362_10068648 3300006177 Bacteria 1615
91 Ga0075362_10240104 3300006177 Bacteria 889
92 Ga0075367_10002197 3300006178 Bacteria 8796
93 Ga0075367_10021295 3300006178 Bacteria 3621
94 Ga0075369_10017983 3300006186 Bacteria 2873
95 Ga0075369_10024175 3300006186 Bacteria 2516
96 Ga0075366_10023680 3300006195 Bacteria 3578
97 Ga0075370_10000254 3300006353 Bacteria 19168
98 Ga0075370_10126813 3300006353 Bacteria 1488
99 Ga0075428_100013526 3300006844 Bacteria 9084
100 Ga0075430_100009466 3300006846 Bacteria 8233
101 Ga0075430_100361259 3300006846 Bacteria 1199
102 Ga0075431_100162390 3300006847 Bacteria 2297
103 Ga0075429_100568988 3300006880 Bacteria 993
104 Ga0068865_100005770 3300006881 Bacteria 7525
105 Ga0068865_100018483 3300006881 Bacteria 4498
106 Ga0097620_100032172 3300006931 Bacteria 5269
107 Ga0099795_10004819 3300007788 Bacteria 3522
108 Ga0111539_10219721 3300009094 Bacteria 2213
109 Ga0105245_10002892 3300009098 Bacteria 15415
110 Ga0105247_10002070 3300009101 Bacteria 13888
111 Ga0105247_10319227 3300009101 Bacteria 1083
112 Ga0114129_10020751 3300009147 Bacteria 9336
113 Ga0105243_10003046 3300009148 Bacteria 13816
114 Ga0105242_10002306 3300009176 Bacteria 15055
115 Ga0105248_10004841 3300009177 Bacteria 14908
116 Ga0105248_10225510 3300009177 Bacteria 2109
117 Ga0105248_10490813 3300009177 Bacteria 1384
118 Ga0105237_10001274 3300009545 Bacteria 33620
119 Ga0105237_10016893 3300009545 Bacteria 7573
120 Ga0105237_10199666 3300009545 Bacteria 1999
121 Ga0105238_10062704 3300009551 Bacteria 3718
122 Ga0105238_10268694 3300009551 Bacteria 1686
123 Ga0105249_10004631 3300009553 Bacteria 11882
124 Ga0105249_10022473 3300009553 Bacteria 5651
125 Ga0105249_10067007 3300009553 Bacteria 3306
126 Ga0105239_10011088 3300010375 Bacteria 10060
127 Ga0105239_10023242 3300010375 Bacteria 6829
128 Ga0105239_10122820 3300010375 Bacteria 2885
129 Ga0157373_10405099 3300013100 Bacteria 978
130 Ga0157369_10097855 3300013105 Bacteria 3129
131 Ga0163162_10065581 3300013306 Bacteria 3678
132 Ga0163162_10209327 3300013306 Bacteria 2080
133 Ga0157372_10047913 3300013307 Bacteria 4749
134 Ga0157375_10009454 3300013308 Bacteria 8559
135 Ga0157375_10530223 3300013308 Bacteria 1340
136 Ga0163163_10014559 3300014325 Bacteria 7235
137 Ga0163163_10758973 3300014325 Bacteria 1033
138 Ga0157380_10001171 3300014326 Bacteria 16979
139 Ga0157377_10020722 3300014745 Bacteria 3449
140 Ga0157379_10003053 3300014968 Bacteria 14150
141 Ga0157376_10128508 3300014969 Bacteria 2258
142 Ga0163161_10001523 3300017792 Bacteria 17161
143 Ga0163161_10111239 3300017792 Bacteria 2048
144 Ga0213876_10000971 3300021384 Bacteria 18862
145 Ga0213876_10032212 3300021384 Bacteria 2765
146 Ga0209051_1000337 3300025303 Bacteria 70482
147 Ga0207653_10022132 3300025885 Bacteria 2019
148 Ga0207692_10038296 3300025898 Bacteria 2351
149 Ga0207642_10044376 3300025899 Bacteria 1967
150 Ga0207688_10000378 3300025901 Bacteria 20732
151 Ga0207688_10000391 3300025901 Bacteria 20567
152 Ga0207688_10065813 3300025901 Bacteria 2049
153 Ga0207647_10106116 3300025904 Bacteria 1663
154 Ga0207685_10015715 3300025905 Bacteria 2405
155 Ga0207645_10012644 3300025907 Bacteria 5721
156 Ga0207645_10066040 3300025907 Bacteria 2313
157 Ga0207671_10027453 3300025914 Bacteria 4256
158 Ga0207671_10057099 3300025914 Bacteria 2893
159 Ga0207693_10000583 3300025915 Bacteria 32667
160 Ga0207693_10002167 3300025915 Bacteria 17111
161 Ga0207663_10004849 3300025916 Bacteria 6732
162 Ga0207662_10370678 3300025918 Bacteria 965
163 Ga0207657_10127005 3300025919 Bacteria 2094
164 Ga0207694_10128185 3300025924 Bacteria 2032
165 Ga0207687_10066349 3300025927 Bacteria 2565
166 Ga0207664_10176184 3300025929 Bacteria 1834
167 Ga0207644_10015492 3300025931 Bacteria 5119
168 Ga0207644_10063286 3300025931 Bacteria 2686
169 Ga0207690_10079211 3300025932 Bacteria 2289
170 Ga0207706_10004230 3300025933 Bacteria 13523
171 Ga0207706_10009404 3300025933 Bacteria 8972
172 Ga0207686_10052524 3300025934 Bacteria 2544
173 Ga0207709_10065129 3300025935 Bacteria 2291
174 Ga0207670_10004799 3300025936 Bacteria 7338
175 Ga0207669_10001371 3300025937 Bacteria 10368
176 Ga0207704_10038848 3300025938 Bacteria 2765
177 Ga0207704_10120694 3300025938 Bacteria 1793
178 Ga0207665_10003221 3300025939 Bacteria 10935
179 Ga0207665_10004100 3300025939 Bacteria 9719
180 Ga0207691_10070591 3300025940 Bacteria 3153
181 Ga0207711_10009942 3300025941 Bacteria 7909
182 Ga0207711_10391715 3300025941 Bacteria 1290
183 Ga0207667_10192667 3300025949 Bacteria 2091
184 Ga0207667_10211400 3300025949 Bacteria 1988
185 Ga0207712_10009869 3300025961 Bacteria 6052
186 Ga0207712_10066423 3300025961 Bacteria 2578
187 Ga0207668_10291912 3300025972 Bacteria 1342
188 Ga0207668_10546907 3300025972 Bacteria 1002
189 Ga0207640_10010782 3300025981 Bacteria 5158
190 Ga0207640_10041609 3300025981 Bacteria 2924
191 Ga0207658_10001937 3300025986 Bacteria 15449
192 Ga0207658_10009449 3300025986 Bacteria 6614
193 Ga0207658_10533839 3300025986 Bacteria 1048
194 Ga0207677_10063320 3300026023 Bacteria 2570
195 Ga0207703_10086450 3300026035 Bacteria 2627
196 Ga0207639_10027539 3300026041 Bacteria 4142
197 Ga0207678_10170211 3300026067 Bacteria 1860
198 Ga0207702_10313631 3300026078 Bacteria 1492
199 Ga0207641_10020652 3300026088 Bacteria 5411
200 Ga0207648_10000636 3300026089 Bacteria 39372
201 Ga0207648_10022884 3300026089 Bacteria 5605
202 Ga0207676_10180707 3300026095 Bacteria 1847
203 Ga0207675_100000192 3300026118 Bacteria 55745
204 Ga0207675_100010034 3300026118 Bacteria 8877
205 Ga0207683_10000790 3300026121 Bacteria 28867
206 Ga0268266_10001191 3300028379 Bacteria 32115
207 Ga0268266_10025470 3300028379 Bacteria 5033
208 Ga0268266_10071229 3300028379 Bacteria 3013
209 Ga0268264_10012812 3300028381 Bacteria 6901
210 Ga0307413_10737373 3300031824 Bacteria 822
211 Ga0307410_10063957 3300031852 Bacteria 2526
212 Ga0307407_10207128 3300031903 Bacteria 1318
213 Ga0307412_10183982 3300031911 Bacteria 1574
214 Ga0307415_100190428 3300032126 Bacteria 1618
215 Ga0307415_100439559 3300032126 Bacteria 1125
216 Ga0373959_0064864 3300034820 Bacteria 815
217 Ga0436365_0539792 3300039437 Bacteria 8157
218 Ga0436365_1083994 3300039437 Bacteria 225582
219 Ga0436365_1253726 3300039437 Bacteria 22924
220 Ga0436361_1188566 3300039447 Bacteria 904
221 Ga0439465_0003341 3300041413 Bacteria 5242
222 Ga0439442_023196 3300042002 Bacteria 1289
223 Ga0439434_0068571 3300042435 Bacteria 1115
224 Ga0466972_0024564 3300044658 Bacteria 2990
225 Ga0466972_0025574 3300044658 Bacteria 2925
226 Ga0466970_0037966 3300044765 Bacteria 2555
227 Ga0466959_0057169 3300045049 Bacteria 2845
228 Ga0466958_0080658 3300045836 Bacteria 2002
229 Ga0466967_0037008 3300045976 Bacteria 4172
230 Ga0495638_0016104 3300046460 Bacteria 5010
231 Ga0495638_0019533 3300046460 Bacteria 4483
232 Ga0495653_0226407 3300046463 Bacteria 1254
233 Ga0495583_0042629 3300046506 Bacteria 2118
234 Ga0495606_0029161 3300046507 Bacteria 3879
235 Ga0495648_0009292 3300046524 Bacteria 7640
236 Ga0495611_0113305 3300046648 Bacteria 1263
237 Ga0495671_0056946 3300046692 Bacteria 1935
238 Ga0495672_0001853 3300047320 Bacteria 20157
239 Ga0495672_0038069 3300047320 Bacteria 2937
240 Ga0495686_0019991 3300047472 Bacteria 4469
241 Ga0496100_0001532 3300048903 Bacteria 11335
242 Ga0496100_0162726 3300048903 Bacteria 1601
243 Ga0496101_0000096 3300048904 Bacteria 92678
244 Ga0496101_0001203 3300048904 Bacteria 15482
245 Ga0496101_0076383 3300048904 Bacteria 2468
246 Ga0496101_0445360 3300048904 Bacteria 1022
247 Ga0496102_0000006 3300048905 Bacteria 471494
248 Ga0496102_0001504 3300048905 Bacteria 20586
249 Ga0496102_0102517 3300048905 Bacteria 2660
250 Ga0496102_0152486 3300048905 Bacteria 2172
251 Ga0496103_0000006 3300048906 Bacteria 470539
252 Ga0496103_0225225 3300048906 Bacteria 1206
253 Ga0496104_0252517 3300048907 Bacteria 1676
254 Ga0496105_0042746 3300048908 Bacteria 3737
255 Ga0496106_0004500 3300048909 Bacteria 10334
256 Ga0496106_0022996 3300048909 Bacteria 4630
257 Ga0496107_0060163 3300048910 Bacteria 2749
258 Ga0496108_0001627 3300048911 Bacteria 17802
259 Ga0496108_0174468 3300048911 Bacteria 1860
260 Ga0496108_0265134 3300048911 Bacteria 1495
261 Ga0496109_0003017 3300048912 Bacteria 14050
262 Ga0496109_0063015 3300048912 Bacteria 3391
263 Ga0496109_0141469 3300048912 Bacteria 2250
264 Ga0496110_0013299 3300048913 Bacteria 6799
265 Ga0496111_0021334 3300048914 Bacteria 4522
266 Ga0496112_0013139 3300048915 Bacteria 7641
267 Ga0496112_0031298 3300048915 Bacteria 5160
268 Ga0496113_0125844 3300048916 Bacteria 2007
269 Ga0496114_0028855 3300048917 Bacteria 4557
270 Ga0496115_0016596 3300048918 Bacteria 5610
271 Ga0496116_0000025 3300048919 Bacteria 470539
272 Ga0496117_0000006 3300048920 Bacteria 758420
273 Ga0496118_0000004 3300048921 Bacteria 758420
274 Ga0496118_0003661 3300048921 Bacteria 19087
275 Ga0496119_0000041 3300048922 Bacteria 203687
276 Ga0496120_0000027 3300048923 Bacteria 231507
277 Ga0496121_0000171 3300048924 Bacteria 144073
278 Ga0496125_0146389 3300048928 Bacteria 1632
279 Ga0496126_0001352 3300048929 Bacteria 38905
280 Ga0496126_0005213 3300048929 Bacteria 14998
281 Ga0496126_0073428 3300048929 Bacteria 3041
282 Ga0501033_0088144 3300049570 Bacteria 2271
283 Ga0501034_0120031 3300049571 Bacteria 2616
284 Ga0501034_0681541 3300049571 Bacteria 928
285 nmdc:mga03683_13792_c1 3300050489 Bacteria 2979
286 nmdc:mga03683_22230_c2 3300050489 Bacteria 1480
287 nmdc:mga03n38_232029_c1 3300050490 Bacteria 968
288 nmdc:mga03n38_59135_c1 3300050490 Bacteria 1739
289 nmdc:mga00v17_167369_c1 3300050491 Bacteria 1416
290 nmdc:mga00v17_19293_c1 3300050491 Bacteria 3891
291 nmdc:mga00v17_4250_c1 3300050491 Bacteria 7435
292 nmdc:mga00v17_70653_c1 3300050491 Bacteria 2163
293 nmdc:mga00v17_98331_c1 3300050491 Bacteria 1845
294 nmdc:mga0yw44_28126_c1 3300050492 Bacteria 3231
295 nmdc:mga0k408_61439_c1 3300050493 Bacteria 2184
296 nmdc:mga06z11_78339_c1 3300050494 Bacteria 1766
297 nmdc:mga06z11_8866_c1 3300050494 Bacteria 4215
298 nmdc:mga04h51_203953_c1 3300050495 Bacteria 778
299 nmdc:mga07m45_728_c1 3300050496 Bacteria 14018
300 nmdc:mga05p37_14072_c1 3300050507 Bacteria 9600
301 nmdc:mga0qj67_16353_c1 3300050509 Bacteria 5625
302 nmdc:mga0qj67_241891_c1 3300050509 Bacteria 1464
303 nmdc:mga06r32_273115_c1 3300050510 Bacteria 1678
304 nmdc:mga08y16_172232_c1 3300050511 Bacteria 2248
305 nmdc:mga0sz30_103340_c1 3300050516 Bacteria 1246
306 nmdc:mga0sz30_104415_c1 3300050516 Bacteria 1239
307 nmdc:mga0sz30_18425_c1 3300050516 Bacteria 2793
308 Ga0500643_002508 3300053087 Bacteria 9414
309 Ga0500643_019759 3300053087 Bacteria 2213
310 Ga0500569_085062 3300053109 Bacteria 1017
311 Ga0500642_0053092 3300053130 Bacteria 1796
312 Ga0500568_0048024 3300053139 Bacteria 1689
313 Ga0500616_0130180 3300053153 Bacteria 1190
314 Ga0500645_000046 3300053730 Bacteria 106127

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006048 Ga0075363_100036539 Ga0075363_1000365393 220
2 3300006051 Ga0075364_10005434 Ga0075364_100054347 221
3 3300006177 Ga0075362_10015672 Ga0075362_100156721 221
4 3300006178 Ga0075367_10002197 Ga0075367_100021974 221
5 3300006195 Ga0075366_10023680 Ga0075366_100236802 221
6 3300006353 Ga0075370_10000254 Ga0075370_100002547 221
7 3300050491 nmdc:mga00v17_19293_c1 nmdc:mga00v17_19293_c1_474_1139 221
8 3300050493 nmdc:mga0k408_61439_c1 nmdc:mga0k408_61439_c1_537_1202 221
9 3300050494 nmdc:mga06z11_8866_c1 nmdc:mga06z11_8866_c1_48_713 221
10 3300050495 nmdc:mga04h51_203953_c1 nmdc:mga04h51_203953_c1_100_765 221
11 3300050496 nmdc:mga07m45_728_c1 nmdc:mga07m45_728_c1_11977_12642 221
12 3300048928 Ga0496125_0146389 Ga0496125_0146389_485_1195 232
13 3300006048 Ga0075363_100331028 Ga0075363_1003310281 233
14 3300006051 Ga0075364_10032131 Ga0075364_100321314 233
15 3300006051 Ga0075364_10035561 Ga0075364_100355613 233
16 3300006177 Ga0075362_10068648 Ga0075362_100686481 233
17 3300031824 Ga0307413_10737373 Ga0307413_107373731 233
18 3300032126 Ga0307415_100439559 Ga0307415_1004395592 233
19 3300050489 nmdc:mga03683_22230_c2 nmdc:mga03683_22230_c2_727_1428 233
20 3300050490 nmdc:mga03n38_232029_c1 nmdc:mga03n38_232029_c1_243_944 233
21 3300050490 nmdc:mga03n38_59135_c1 nmdc:mga03n38_59135_c1_662_1363 233
22 3300050491 nmdc:mga00v17_70653_c1 nmdc:mga00v17_70653_c1_702_1403 233
23 3300050491 nmdc:mga00v17_98331_c1 nmdc:mga00v17_98331_c1_213_914 233
24 3300050494 nmdc:mga06z11_78339_c1 nmdc:mga06z11_78339_c1_480_1181 233
25 3300050516 nmdc:mga0sz30_18425_c1 nmdc:mga0sz30_18425_c1_2001_2702 233
26 3300053109 Ga0500569_085062 Ga0500569_085062_270_971 233
27 3300053153 Ga0500616_0130180 Ga0500616_0130180_122_823 233
28 3300031852 Ga0307410_10063957 Ga0307410_100639575 234
29 3300031903 Ga0307407_10207128 Ga0307407_102071282 234
30 3300031911 Ga0307412_10183982 Ga0307412_101839822 234
31 3300032126 Ga0307415_100190428 Ga0307415_1001904282 234
32 3300025981 Ga0207640_10010782 Ga0207640_100107824 236
33 3300025918 Ga0207662_10370678 Ga0207662_103706782 237
34 3300005937 Ga0081455_10190296 Ga0081455_101902962 245
35 3300001977 JGI24746J21847_1000281 JGI24746J21847_10002814 246
36 3300002077 JGI24744J21845_10004254 JGI24744J21845_100042542 246
37 3300002077 JGI24744J21845_10005224 JGI24744J21845_100052242 246
38 3300002239 JGI24034J26672_10002735 JGI24034J26672_100027352 246
39 3300002244 JGI24742J22300_10005951 JGI24742J22300_100059512 246
40 3300003792 Ga0055540_1002144 Ga0055540_10021444 246
41 3300005330 Ga0070690_100018861 Ga0070690_1000188614 246
42 3300005335 Ga0070666_10010532 Ga0070666_100105324 246
43 3300005337 Ga0070682_100014853 Ga0070682_1000148537 246
44 3300005338 Ga0068868_100003813 Ga0068868_1000038138 246
45 3300005338 Ga0068868_100100345 Ga0068868_1001003453 246
46 3300005341 Ga0070691_10002842 Ga0070691_100028426 246
47 3300005343 Ga0070687_100149604 Ga0070687_1001496042 246
48 3300005345 Ga0070692_10090579 Ga0070692_100905792 246
49 3300005347 Ga0070668_100011018 Ga0070668_1000110185 246
50 3300005347 Ga0070668_100269423 Ga0070668_1002694232 246
51 3300005347 Ga0070668_100488537 Ga0070668_1004885371 246
52 3300005355 Ga0070671_100007188 Ga0070671_1000071886 246
53 3300005355 Ga0070671_100049453 Ga0070671_1000494532 246
54 3300005355 Ga0070671_100158316 Ga0070671_1001583163 246
55 3300005356 Ga0070674_100017985 Ga0070674_1000179852 246
56 3300005364 Ga0070673_100038595 Ga0070673_1000385955 246
57 3300005365 Ga0070688_100057876 Ga0070688_1000578762 246
58 3300005366 Ga0070659_100104379 Ga0070659_1001043793 246
59 3300005367 Ga0070667_100002821 Ga0070667_10000282116 246
60 3300005367 Ga0070667_100004900 Ga0070667_1000049007 246
61 3300005367 Ga0070667_100069377 Ga0070667_1000693772 246
62 3300005406 Ga0070703_10073518 Ga0070703_100735181 246
63 3300005434 Ga0070709_10021559 Ga0070709_100215593 246
64 3300005435 Ga0070714_100152022 Ga0070714_1001520222 246
65 3300005437 Ga0070710_10006864 Ga0070710_100068647 246
66 3300005437 Ga0070710_10016568 Ga0070710_100165686 246
67 3300005438 Ga0070701_10039998 Ga0070701_100399983 246
68 3300005439 Ga0070711_100001137 Ga0070711_1000011375 246
69 3300005439 Ga0070711_100029112 Ga0070711_1000291123 246
70 3300005444 Ga0070694_100005346 Ga0070694_1000053466 246
71 3300005456 Ga0070678_100000395 Ga0070678_10000039522 246
72 3300005457 Ga0070662_100001778 Ga0070662_1000017786 246
73 3300005459 Ga0068867_100013026 Ga0068867_1000130264 246
74 3300005466 Ga0070685_10024635 Ga0070685_100246355 246
75 3300005466 Ga0070685_10065620 Ga0070685_100656203 246
76 3300005539 Ga0068853_100002863 Ga0068853_10000286313 246
77 3300005543 Ga0070672_100106226 Ga0070672_1001062262 246
78 3300005544 Ga0070686_100038661 Ga0070686_1000386613 246
79 3300005545 Ga0070695_100044711 Ga0070695_1000447112 246
80 3300005546 Ga0070696_100001182 Ga0070696_10000118211 246
81 3300005546 Ga0070696_100075670 Ga0070696_1000756702 246
82 3300005547 Ga0070693_100007380 Ga0070693_1000073802 246
83 3300005548 Ga0070665_100014137 Ga0070665_1000141377 246
84 3300005548 Ga0070665_100019887 Ga0070665_1000198875 246
85 3300005548 Ga0070665_100137898 Ga0070665_1001378983 246
86 3300005549 Ga0070704_100000792 Ga0070704_10000079212 246
87 3300005549 Ga0070704_100067660 Ga0070704_1000676604 246
88 3300005578 Ga0068854_100011976 Ga0068854_1000119765 246
89 3300005615 Ga0070702_100003764 Ga0070702_1000037643 246
90 3300005617 Ga0068859_100032172 Ga0068859_1000321725 246
91 3300005718 Ga0068866_10002412 Ga0068866_100024125 246
92 3300005719 Ga0068861_100002992 Ga0068861_1000029927 246
93 3300005841 Ga0068863_100001515 Ga0068863_1000015157 246
94 3300005842 Ga0068858_100010911 Ga0068858_1000109118 246
95 3300005842 Ga0068858_100303271 Ga0068858_1003032712 246
96 3300005843 Ga0068860_100001753 Ga0068860_1000017539 246
97 3300005843 Ga0068860_100178213 Ga0068860_1001782133 246
98 3300005844 Ga0068862_100016796 Ga0068862_1000167964 246
99 3300005844 Ga0068862_100267307 Ga0068862_1002673072 246
100 3300005937 Ga0081455_10099737 Ga0081455_100997371 246
101 3300006038 Ga0075365_10045065 Ga0075365_100450652 246
102 3300006163 Ga0070715_10024318 Ga0070715_100243184 246
103 3300006173 Ga0070716_100001575 Ga0070716_10000157512 246
104 3300006173 Ga0070716_100021832 Ga0070716_1000218323 246
105 3300006175 Ga0070712_100001039 Ga0070712_10000103912 246
106 3300006175 Ga0070712_100001485 Ga0070712_1000014854 246
107 3300006177 Ga0075362_10240104 Ga0075362_102401041 246
108 3300006178 Ga0075367_10021295 Ga0075367_100212952 246
109 3300006186 Ga0075369_10017983 Ga0075369_100179834 246
110 3300006186 Ga0075369_10024175 Ga0075369_100241753 246
111 3300006353 Ga0075370_10126813 Ga0075370_101268132 246
112 3300006846 Ga0075430_100361259 Ga0075430_1003612592 246
113 3300006881 Ga0068865_100005770 Ga0068865_1000057704 246
114 3300006881 Ga0068865_100018483 Ga0068865_1000184833 246
115 3300006931 Ga0097620_100032172 Ga0097620_1000321725 246
116 3300009098 Ga0105245_10002892 Ga0105245_1000289213 246
117 3300009101 Ga0105247_10002070 Ga0105247_1000207013 246
118 3300009101 Ga0105247_10319227 Ga0105247_103192272 246
119 3300009148 Ga0105243_10003046 Ga0105243_100030465 246
120 3300009176 Ga0105242_10002306 Ga0105242_100023065 246
121 3300009177 Ga0105248_10004841 Ga0105248_100048414 246
122 3300009177 Ga0105248_10225510 Ga0105248_102255102 246
123 3300009177 Ga0105248_10490813 Ga0105248_104908133 246
124 3300009545 Ga0105237_10016893 Ga0105237_100168938 246
125 3300009545 Ga0105237_10199666 Ga0105237_101996663 246
126 3300009551 Ga0105238_10062704 Ga0105238_100627041 246
127 3300009553 Ga0105249_10004631 Ga0105249_1000463114 246
128 3300009553 Ga0105249_10022473 Ga0105249_100224732 246
129 3300009553 Ga0105249_10067007 Ga0105249_100670075 246
130 3300010375 Ga0105239_10023242 Ga0105239_100232425 246
131 3300010375 Ga0105239_10122820 Ga0105239_101228203 246
132 3300013100 Ga0157373_10405099 Ga0157373_104050991 246
133 3300013105 Ga0157369_10097855 Ga0157369_100978553 246
134 3300013306 Ga0163162_10065581 Ga0163162_100655815 246
135 3300013306 Ga0163162_10209327 Ga0163162_102093272 246
136 3300013307 Ga0157372_10047913 Ga0157372_100479137 246
137 3300013308 Ga0157375_10009454 Ga0157375_100094546 246
138 3300013308 Ga0157375_10530223 Ga0157375_105302232 246
139 3300014325 Ga0163163_10014559 Ga0163163_100145593 246
140 3300014326 Ga0157380_10001171 Ga0157380_1000117117 246
141 3300014745 Ga0157377_10020722 Ga0157377_100207222 246
142 3300014968 Ga0157379_10003053 Ga0157379_1000305315 246
143 3300014969 Ga0157376_10128508 Ga0157376_101285082 246
144 3300017792 Ga0163161_10001523 Ga0163161_1000152315 246
145 3300025303 Ga0209051_1000337 Ga0209051_100033716 246
146 3300025885 Ga0207653_10022132 Ga0207653_100221323 246
147 3300025898 Ga0207692_10038296 Ga0207692_100382962 246
148 3300025899 Ga0207642_10044376 Ga0207642_100443762 246
149 3300025901 Ga0207688_10000378 Ga0207688_1000037822 246
150 3300025901 Ga0207688_10065813 Ga0207688_100658132 246
151 3300025904 Ga0207647_10106116 Ga0207647_101061162 246
152 3300025905 Ga0207685_10015715 Ga0207685_100157153 246
153 3300025907 Ga0207645_10012644 Ga0207645_100126447 246
154 3300025914 Ga0207671_10027453 Ga0207671_100274534 246
155 3300025915 Ga0207693_10000583 Ga0207693_1000058317 246
156 3300025915 Ga0207693_10002167 Ga0207693_1000216716 246
157 3300025916 Ga0207663_10004849 Ga0207663_100048496 246
158 3300025919 Ga0207657_10127005 Ga0207657_101270052 246
159 3300025927 Ga0207687_10066349 Ga0207687_100663492 246
160 3300025929 Ga0207664_10176184 Ga0207664_101761842 246
161 3300025931 Ga0207644_10015492 Ga0207644_100154922 246
162 3300025931 Ga0207644_10063286 Ga0207644_100632862 246
163 3300025932 Ga0207690_10079211 Ga0207690_100792114 246
164 3300025933 Ga0207706_10004230 Ga0207706_1000423013 246
165 3300025933 Ga0207706_10009404 Ga0207706_100094048 246
166 3300025934 Ga0207686_10052524 Ga0207686_100525242 246
167 3300025935 Ga0207709_10065129 Ga0207709_100651292 246
168 3300025936 Ga0207670_10004799 Ga0207670_1000479910 246
169 3300025937 Ga0207669_10001371 Ga0207669_100013716 246
170 3300025938 Ga0207704_10038848 Ga0207704_100388483 246
171 3300025938 Ga0207704_10120694 Ga0207704_101206942 246
172 3300025939 Ga0207665_10003221 Ga0207665_100032217 246
173 3300025939 Ga0207665_10004100 Ga0207665_100041007 246
174 3300025940 Ga0207691_10070591 Ga0207691_100705913 246
175 3300025941 Ga0207711_10009942 Ga0207711_100099427 246
176 3300025941 Ga0207711_10391715 Ga0207711_103917153 246
177 3300025949 Ga0207667_10192667 Ga0207667_101926672 246
178 3300025961 Ga0207712_10009869 Ga0207712_100098692 246
179 3300025961 Ga0207712_10066423 Ga0207712_100664232 246
180 3300025972 Ga0207668_10546907 Ga0207668_105469071 246
181 3300025981 Ga0207640_10041609 Ga0207640_100416092 246
182 3300025986 Ga0207658_10001937 Ga0207658_100019377 246
183 3300025986 Ga0207658_10533839 Ga0207658_105338392 246
184 3300026023 Ga0207677_10063320 Ga0207677_100633203 246
185 3300026035 Ga0207703_10086450 Ga0207703_100864502 246
186 3300026067 Ga0207678_10170211 Ga0207678_101702112 246
187 3300026078 Ga0207702_10313631 Ga0207702_103136312 246
188 3300026088 Ga0207641_10020652 Ga0207641_100206523 246
189 3300026089 Ga0207648_10000636 Ga0207648_1000063619 246
190 3300026089 Ga0207648_10022884 Ga0207648_100228844 246
191 3300026118 Ga0207675_100000192 Ga0207675_10000019220 246
192 3300026118 Ga0207675_100010034 Ga0207675_1000100344 246
193 3300026121 Ga0207683_10000790 Ga0207683_1000079017 246
194 3300028379 Ga0268266_10001191 Ga0268266_100011913 246
195 3300028379 Ga0268266_10025470 Ga0268266_100254704 246
196 3300028379 Ga0268266_10071229 Ga0268266_100712295 246
197 3300028381 Ga0268264_10012812 Ga0268264_100128125 246
198 3300034820 Ga0373959_0064864 Ga0373959_0064864_17_757 246
199 3300041413 Ga0439465_0003341 Ga0439465_0003341_2243_2983 246
200 3300042002 Ga0439442_023196 Ga0439442_023196_13_753 246
201 3300042435 Ga0439434_0068571 Ga0439434_0068571_52_792 246
202 3300044658 Ga0466972_0024564 Ga0466972_0024564_753_1493 246
203 3300044765 Ga0466970_0037966 Ga0466970_0037966_269_1009 246
204 3300045049 Ga0466959_0057169 Ga0466959_0057169_1539_2279 246
205 3300046463 Ga0495653_0226407 Ga0495653_0226407_265_1005 246
206 3300048903 Ga0496100_0001532 Ga0496100_0001532_5397_6137 246
207 3300048903 Ga0496100_0162726 Ga0496100_0162726_490_1230 246
208 3300048904 Ga0496101_0001203 Ga0496101_0001203_4801_5541 246
209 3300048904 Ga0496101_0076383 Ga0496101_0076383_1177_1917 246
210 3300048905 Ga0496102_0001504 Ga0496102_0001504_11132_11872 246
211 3300048905 Ga0496102_0102517 Ga0496102_0102517_718_1458 246
212 3300048906 Ga0496103_0225225 Ga0496103_0225225_261_1001 246
213 3300048907 Ga0496104_0252517 Ga0496104_0252517_243_983 246
214 3300048908 Ga0496105_0042746 Ga0496105_0042746_2816_3556 246
215 3300048909 Ga0496106_0004500 Ga0496106_0004500_8078_8818 246
216 3300048909 Ga0496106_0022996 Ga0496106_0022996_3157_3897 246
217 3300048911 Ga0496108_0001627 Ga0496108_0001627_16759_17499 246
218 3300048911 Ga0496108_0174468 Ga0496108_0174468_1082_1822 246
219 3300048911 Ga0496108_0265134 Ga0496108_0265134_77_817 246
220 3300048912 Ga0496109_0003017 Ga0496109_0003017_12722_13462 246
221 3300048912 Ga0496109_0063015 Ga0496109_0063015_110_850 246
222 3300048912 Ga0496109_0141469 Ga0496109_0141469_758_1498 246
223 3300048913 Ga0496110_0013299 Ga0496110_0013299_4916_5656 246
224 3300048914 Ga0496111_0021334 Ga0496111_0021334_581_1321 246
225 3300048915 Ga0496112_0013139 Ga0496112_0013139_576_1316 246
226 3300048915 Ga0496112_0031298 Ga0496112_0031298_449_1189 246
227 3300048916 Ga0496113_0125844 Ga0496113_0125844_373_1113 246
228 3300048917 Ga0496114_0028855 Ga0496114_0028855_1324_2064 246
229 3300048918 Ga0496115_0016596 Ga0496115_0016596_804_1544 246
230 3300050489 nmdc:mga03683_13792_c1 nmdc:mga03683_13792_c1_461_1201 246
231 3300050491 nmdc:mga00v17_167369_c1 nmdc:mga00v17_167369_c1_439_1179 246
232 3300050492 nmdc:mga0yw44_28126_c1 nmdc:mga0yw44_28126_c1_1779_2519 246
233 3300050509 nmdc:mga0qj67_241891_c1 nmdc:mga0qj67_241891_c1_628_1368 246
234 3300009545 Ga0105237_10001274 Ga0105237_1000127426 247
235 3300046506 Ga0495583_0042629 Ga0495583_0042629_704_1447 247
236 3300046524 Ga0495648_0009292 Ga0495648_0009292_6434_7177 247
237 3300046648 Ga0495611_0113305 Ga0495611_0113305_125_868 247
238 3300047320 Ga0495672_0001853 Ga0495672_0001853_8955_9698 247
239 3300006844 Ga0075428_100013526 Ga0075428_1000135264 252
240 3300006846 Ga0075430_100009466 Ga0075430_1000094663 252
241 3300006847 Ga0075431_100162390 Ga0075431_1001623902 252
242 3300006880 Ga0075429_100568988 Ga0075429_1005689882 252
243 3300009147 Ga0114129_10020751 Ga0114129_100207518 252
244 3300050507 nmdc:mga05p37_14072_c1 nmdc:mga05p37_14072_c1_7306_8064 252
245 3300050509 nmdc:mga0qj67_16353_c1 nmdc:mga0qj67_16353_c1_652_1410 252
246 3300050510 nmdc:mga06r32_273115_c1 nmdc:mga06r32_273115_c1_778_1536 252
247 iso_pu_bacteria 2939582691 2939584584 252
248 3300005937 Ga0081455_10221400 Ga0081455_102214001 253
249 3300048904 Ga0496101_0445360 Ga0496101_0445360_163_924 253
250 iso_pu_bacteria 2902792274 2902798928 253
251 3300006038 Ga0075365_10011454 Ga0075365_100114543 256
252 3300021384 Ga0213876_10000971 Ga0213876_100009717 256
253 3300039437 Ga0436365_1083994 Ga0436365_1083994_210999_211769 256
254 3300039437 Ga0436365_1253726 Ga0436365_1253726_4648_5418 256
255 3300039447 Ga0436361_1188566 Ga0436361_1188566_34_804 256
256 3300045836 Ga0466958_0080658 Ga0466958_0080658_655_1425 256
257 3300048905 Ga0496102_0152486 Ga0496102_0152486_1101_1871 256
258 3300048921 Ga0496118_0003661 Ga0496118_0003661_249_1019 256
259 3300048929 Ga0496126_0005213 Ga0496126_0005213_13131_13901 256
260 3300049570 Ga0501033_0088144 Ga0501033_0088144_842_1612 256
261 3300049571 Ga0501034_0681541 Ga0501034_0681541_18_788 256
262 3300053130 Ga0500642_0053092 Ga0500642_0053092_284_1066 256
263 iso_pu_bacteria 2738541274 2738704857 256
264 iso_pu_bacteria 2738543028 2739330027 256
265 3300005539 Ga0068853_100040399 Ga0068853_1000403993 257
266 3300005563 Ga0068855_100379610 Ga0068855_1003796102 257
267 3300006051 Ga0075364_10281205 Ga0075364_102812052 257
268 3300009551 Ga0105238_10268694 Ga0105238_102686942 257
269 3300010375 Ga0105239_10011088 Ga0105239_100110886 257
270 3300025914 Ga0207671_10057099 Ga0207671_100570992 257
271 3300025924 Ga0207694_10128185 Ga0207694_101281852 257
272 3300025949 Ga0207667_10211400 Ga0207667_102114002 257
273 3300026041 Ga0207639_10027539 Ga0207639_100275394 257
274 3300046507 Ga0495606_0029161 Ga0495606_0029161_1200_1973 257
275 3300047472 Ga0495686_0019991 Ga0495686_0019991_3332_4105 257
276 3300048904 Ga0496101_0000096 Ga0496101_0000096_75086_75859 257
277 3300048905 Ga0496102_0000006 Ga0496102_0000006_89768_90541 257
278 3300048906 Ga0496103_0000006 Ga0496103_0000006_89566_90339 257
279 3300048910 Ga0496107_0060163 Ga0496107_0060163_1150_1923 257
280 3300048919 Ga0496116_0000025 Ga0496116_0000025_380201_380974 257
281 3300048920 Ga0496117_0000006 Ga0496117_0000006_380201_380974 257
282 3300048921 Ga0496118_0000004 Ga0496118_0000004_380201_380974 257
283 3300048922 Ga0496119_0000041 Ga0496119_0000041_60634_61407 257
284 3300048923 Ga0496120_0000027 Ga0496120_0000027_139598_140371 257
285 3300048924 Ga0496121_0000171 Ga0496121_0000171_34513_35286 257
286 3300048929 Ga0496126_0001352 Ga0496126_0001352_8911_9684 257
287 3300050516 nmdc:mga0sz30_104415_c1 nmdc:mga0sz30_104415_c1_194_967 257
288 3300053087 Ga0500643_002508 Ga0500643_002508_5494_6267 257
289 iso_pu_bacteria 2902799365 2902803439 257
290 3300021384 Ga0213876_10032212 Ga0213876_100322123 259
291 3300039437 Ga0436365_0539792 Ga0436365_0539792_5469_6248 259
292 3300050491 nmdc:mga00v17_4250_c1 nmdc:mga00v17_4250_c1_945_1745 259
293 3300005539 Ga0068853_100069353 Ga0068853_1000693532 260
294 3300006038 Ga0075365_10087920 Ga0075365_100879202 260
295 3300006048 Ga0075363_100079579 Ga0075363_1000795792 260
296 3300006173 Ga0070716_100029693 Ga0070716_1000296932 260
297 3300007788 Ga0099795_10004819 Ga0099795_100048193 260
298 3300017792 Ga0163161_10111239 Ga0163161_101112393 260
299 3300025901 Ga0207688_10000391 Ga0207688_100003918 260
300 3300025907 Ga0207645_10066040 Ga0207645_100660402 260
301 3300025972 Ga0207668_10291912 Ga0207668_102919122 260
302 3300025986 Ga0207658_10009449 Ga0207658_100094497 260
303 3300026095 Ga0207676_10180707 Ga0207676_101807072 260
304 3300044658 Ga0466972_0025574 Ga0466972_0025574_870_1652 260
305 3300045976 Ga0466967_0037008 Ga0466967_0037008_1657_2439 260
306 3300046460 Ga0495638_0016104 Ga0495638_0016104_709_1542 260
307 3300046460 Ga0495638_0019533 Ga0495638_0019533_236_1057 260
308 3300046692 Ga0495671_0056946 Ga0495671_0056946_621_1514 260
309 3300047320 Ga0495672_0038069 Ga0495672_0038069_1195_2004 260
310 3300048929 Ga0496126_0073428 Ga0496126_0073428_931_1725 260
311 3300049571 Ga0501034_0120031 Ga0501034_0120031_1464_2246 260
312 3300050516 nmdc:mga0sz30_103340_c1 nmdc:mga0sz30_103340_c1_260_1063 260
313 3300053087 Ga0500643_019759 Ga0500643_019759_101_883 260
314 3300053139 Ga0500568_0048024 Ga0500568_0048024_538_1320 260
315 3300053730 Ga0500645_000046 Ga0500645_000046_49656_50450 260
316 3300000546 LJNas_1003801 LJNas_10038012 261
317 3300009094 Ga0111539_10219721 Ga0111539_102197212 261
318 3300014325 Ga0163163_10758973 Ga0163163_107589732 261
319 3300050511 nmdc:mga08y16_172232_c1 nmdc:mga08y16_172232_c1_1176_1961 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04248

NTP_transf_9

Domain of unknown function (DUF427)

144

241

0.92

PF04248

NTP_transf_9

Domain of unknown function (DUF427)

24

113

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3djm-assembly5.cif.gz_E crystal structure of a protein of unknown function from duf427 family (rsph17029_0682) from rhodobacter sphaeroides 2.4.1 at 2.51 a resolution 0.8966 141 246
3djm-assembly5.cif.gz_E crystal structure of a protein of unknown function from duf427 family (rsph17029_0682) from rhodobacter sphaeroides 2.4.1 at 2.51 a resolution 0.8519 141 246
6fnh-assembly3.cif.gz_C crystal structure of ephrin a2 (epha2) receptor protein kinase with a pyrazolo[3,4-d]pyrimidine fragment of nvp-bhg712 0.6523 63 99
5ia0-assembly3.cif.gz_C crystal structure of ephrin a2 (epha2) receptor protein kinase with alisertib (mln8237) 0.6346 64 99
6zcs-assembly1.cif.gz_A syk kinase domain in complex with azabenzimidazole inhibitor 3 0.6142 63 99
ID Description Score Start End Superfamily
af_O53404_8_113_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.9804 15 120 2.170.150.40
af_O53404_8_113_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.9714 15 120 2.170.150.40
af_O53404_128_241_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.9604 135 248 2.170.150.40
af_O53404_128_241_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.9523 135 248 2.170.150.40
af_O53917_1_97_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.9031 149 246 2.170.150.40
ID Description Score Start End GO Terms
AF-A0A2S8MMD5-F1-model_v4 deleted 0.9718 176 261
AF-A0A7G1IID3-F1-model_v4 DUF427 domain-containing protein 0.9712 141 261
AF-A0A2T0Z5N5-F1-model_v4 Uncharacterized protein (DUF427 family) 0.9614 139 256
AF-A0A2S8MMD5-F1-model_v4 deleted 0.9609 176 261
AF-A0A655A0G2-F1-model_v4 Short-chain dehydrogenase of uncharacterized substrate specificity 0.9588 158 261

Feature Viewer

pLDDT pTM Quality
84.41 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map