F405251

General Info

Members Datasets Scaffolds Average Seq Length
319 211 638 131

Family's Representative Sequence

Representative Sequence 3300048906|Ga0496103_0274773|Ga0496103_0274773_200_622
Length 140
Sequence MLPRIRAPVRTLTITTDRRTQVLDITSLVREAVVDARGAAVLVYVPHTTAGVTINENADPMVARDFEMALERIVPEGWGWQHIEEGEENAPSHIRASLMGPQILIPLTPEGELALGKWQGVFFCELDGPRTRSVYVSVLV

Samples

Sample ID Description Type Environment
1 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
37 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
68 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
71 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
74 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
75 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
76 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
86 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
89 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
92 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
106 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
107 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
108 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
111 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
112 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
156 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 1.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 6.9
Rhizosphere 90.91
Stem 0
Stem Tuber 0
Unclassified 17.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496103_0274773 3300048906 Bacteria 1084
2 JGI25407J50210_10010459 3300003373 Bacteria 2361
3 JGI25407J50210_10095797 3300003373 Bacteria 734
4 Ga0070658_10321507 3300005327 Unclassified 1321
5 Ga0070658_10407258 3300005327 Bacteria 1168
6 Ga0070658_10417937 3300005327 Bacteria 1153
7 Ga0070683_100019465 3300005329 Bacteria 6029
8 Ga0070683_100220881 3300005329 Bacteria 1801
9 Ga0070680_100007520 3300005336 Bacteria 8308
10 Ga0070660_100003089 3300005339 Bacteria 11445
11 Ga0070660_100071262 3300005339 Unclassified 2713
12 Ga0070661_100398482 3300005344 Unclassified 1088
13 Ga0070661_101292288 3300005344 Bacteria 612
14 Ga0070671_100115726 3300005355 Bacteria 2254
15 Ga0070659_101357586 3300005366 Unclassified 631
16 Ga0070714_100590663 3300005435 Bacteria 1066
17 Ga0070713_100160634 3300005436 Bacteria 2006
18 Ga0070713_100204434 3300005436 Bacteria 1785
19 Ga0070710_10204732 3300005437 Bacteria 1248
20 Ga0070711_100126891 3300005439 Unclassified 1895
21 Ga0070678_100213039 3300005456 Bacteria 1602
22 Ga0070681_10002637 3300005458 Bacteria 16464
23 Ga0070681_10006033 3300005458 Bacteria 11742
24 Ga0070681_10134926 3300005458 Bacteria 2399
25 Ga0070681_10272810 3300005458 Unclassified 1603
26 Ga0070679_100003184 3300005530 Bacteria 14999
27 Ga0070679_100071588 3300005530 Bacteria 3458
28 Ga0070684_100026767 3300005535 Bacteria 4861
29 Ga0070684_100822050 3300005535 Bacteria 869
30 Ga0068853_101012167 3300005539 Unclassified 800
31 Ga0068855_100008848 3300005563 Bacteria 12171
32 Ga0068855_100192028 3300005563 Bacteria 2303
33 Ga0068852_100080234 3300005616 Bacteria 2892
34 Ga0081455_10114492 3300005937 Bacteria 2137
35 Ga0081538_10004031 3300005981 Bacteria 13664
36 Ga0070716_101329249 3300006173 Bacteria 582
37 Ga0070712_100308166 3300006175 Unclassified 1284
38 Ga0070712_100426585 3300006175 Bacteria 1100
39 Ga0075434_100899487 3300006871 Bacteria 900
40 Ga0075429_100060017 3300006880 Bacteria 3314
41 Ga0075436_100320259 3300006914 Bacteria 1114
42 Ga0105240_10026386 3300009093 Bacteria 7621
43 Ga0105245_10310594 3300009098 Bacteria 1550
44 Ga0105245_11333104 3300009098 Bacteria 767
45 Ga0105241_10031337 3300009174 Bacteria 3981
46 Ga0105238_10874923 3300009551 Bacteria 916
47 Ga0157371_10367025 3300013102 Unclassified 1050
48 Ga0157371_11376800 3300013102 Unclassified 547
49 Ga0157371_11387052 3300013102 Unclassified 546
50 Ga0157370_10060288 3300013104 Bacteria 3603
51 Ga0157370_10064391 3300013104 Bacteria 3471
52 Ga0157372_11237262 3300013307 Unclassified 862
53 Ga0163163_10271331 3300014325 Bacteria 1748
54 Ga0182006_1058644 3300015261 Bacteria 1459
55 Ga0197907_10833220 3300020069 Unclassified 1883
56 Ga0206356_10509765 3300020070 Unclassified 1920
57 Ga0206354_10581800 3300020081 Bacteria 1837
58 Ga0206353_11305421 3300020082 Bacteria 3456
59 Ga0213876_10138703 3300021384 Bacteria 1293
60 Ga0224712_10014978 3300022467 Unclassified 2513
61 Ga0207705_10250241 3300025909 Unclassified 1351
62 Ga0207707_10007068 3300025912 Bacteria 9785
63 Ga0207707_10085552 3300025912 Bacteria 2755
64 Ga0207695_10354484 3300025913 Bacteria 1354
65 Ga0207693_10032755 3300025915 Bacteria 4101
66 Ga0207693_10276195 3300025915 Bacteria 1316
67 Ga0207663_10838173 3300025916 Bacteria 733
68 Ga0207663_10849615 3300025916 Bacteria 728
69 Ga0207660_10185549 3300025917 Bacteria 1617
70 Ga0207660_10188486 3300025917 Bacteria 1605
71 Ga0207660_10198989 3300025917 Unclassified 1564
72 Ga0207657_10001335 3300025919 Bacteria 26208
73 Ga0207657_10049157 3300025919 Bacteria 3677
74 Ga0207649_10218999 3300025920 Unclassified 1355
75 Ga0207652_10038798 3300025921 Bacteria 4039
76 Ga0207687_10132859 3300025927 Bacteria 1878
77 Ga0207700_10929063 3300025928 Bacteria 779
78 Ga0207700_10929110 3300025928 Bacteria 779
79 Ga0207664_10389856 3300025929 Bacteria 1237
80 Ga0207644_10497695 3300025931 Unclassified 1005
81 Ga0207709_10167231 3300025935 Bacteria 1540
82 Ga0207669_10300948 3300025937 Bacteria 1219
83 Ga0207711_11463448 3300025941 Bacteria 626
84 Ga0207661_10426336 3300025944 Unclassified 1205
85 Ga0207661_10427326 3300025944 Bacteria 1204
86 Ga0207667_10723737 3300025949 Unclassified 996
87 Ga0207667_11271540 3300025949 Bacteria 713
88 Ga0207639_10342173 3300026041 Bacteria 1334
89 Ga0207639_10819729 3300026041 Unclassified 868
90 Ga0207676_10915699 3300026095 Bacteria 861
91 Ga0207675_101067057 3300026118 Bacteria 827
92 Ga0207683_10257118 3300026121 Bacteria 1594
93 Ga0207698_10154741 3300026142 Bacteria 1995
94 Ga0268266_11023639 3300028379 Bacteria 799
95 Ga0268266_11661775 3300028379 Bacteria 614
96 Ga0265334_10049516 3300028573 Bacteria 1616
97 Ga0265318_10080964 3300028577 Bacteria 1199
98 Ga0265338_10015604 3300028800 Bacteria 8325
99 Ga0265330_10136237 3300031235 Bacteria 1044
100 Ga0265320_10070474 3300031240 Unclassified 1649
101 Ga0265325_10030687 3300031241 Bacteria 2881
102 Ga0265340_10388409 3300031247 Bacteria 616
103 Ga0265327_10022706 3300031251 Bacteria 3739
104 Ga0265327_10093742 3300031251 Unclassified 1460
105 Ga0265327_10266566 3300031251 Bacteria 760
106 Ga0265316_10015767 3300031344 Bacteria 6590
107 Ga0265313_10002750 3300031595 Bacteria 14827
108 Ga0265314_10003582 3300031711 Bacteria 14953
109 Ga0265314_10230812 3300031711 Bacteria 1074
110 Ga0307413_10144173 3300031824 Bacteria 1650
111 Ga0307410_10086672 3300031852 Bacteria 2212
112 Ga0307406_10107992 3300031901 Unclassified 1909
113 Ga0307407_10426376 3300031903 Unclassified 957
114 Ga0307409_100419723 3300031995 Unclassified 1283
115 Ga0307416_100041508 3300032002 Bacteria 3584
116 Ga0307416_100172319 3300032002 Bacteria 2016
117 Ga0307411_10054688 3300032005 Bacteria 2622
118 Ga0373944_0003973 3300035089 Unclassified 3828
119 Ga0373923_0128250 3300035111 Bacteria 1138
120 Ga0373936_0036759 3300035113 Unclassified 1954
121 Ga0373945_0007357 3300035116 Bacteria 3569
122 Ga0373954_0336512 3300035118 Bacteria 745
123 Ga0373943_0000357 3300035170 Bacteria 19352
124 Ga0373946_0007636 3300035171 Bacteria 3961
125 Ga0373924_0179382 3300035410 Unclassified 932
126 Ga0373935_0012920 3300035692 Bacteria 5032
127 Ga0373947_0000467 3300035725 Bacteria 23084
128 Ga0373937_0031311 3300036401 Bacteria 4819
129 Ga0373925_0002153 3300037068 Bacteria 16096
130 Ga0395899_0001360 3300037312 Bacteria 20970
131 Ga0395899_0004032 3300037312 Bacteria 11580
132 Ga0395900_0003938 3300037418 Bacteria 15848
133 Ga0395900_0036268 3300037418 Bacteria 5082
134 Ga0395900_0135264 3300037418 Bacteria 2525
135 Ga0395900_0289194 3300037418 Bacteria 1628
136 Ga0395900_0497391 3300037418 Bacteria 1170
137 Ga0395898_0013844 3300037466 Bacteria 8289
138 Ga0395898_0044569 3300037466 Unclassified 4365
139 Ga0395898_0163148 3300037466 Bacteria 2131
140 Ga0395898_0230097 3300037466 Bacteria 1768
141 Ga0395905_0010176 3300037471 Bacteria 9165
142 Ga0395905_0019356 3300037471 Bacteria 6453
143 Ga0436364_0731682 3300037853 Bacteria 4102
144 Ga0395901_0035985 3300038443 Bacteria 5115
145 Ga0395901_0168190 3300038443 Unclassified 2301
146 Ga0395901_0441123 3300038443 Bacteria 1332
147 Ga0395901_0697224 3300038443 Bacteria 1013
148 Ga0436365_0180289 3300039437 Bacteria 3471
149 Ga0436365_1033925 3300039437 Bacteria 1902
150 Ga0436363_0658362 3300039450 Bacteria 802
151 Ga0436362_0827070 3300039453 Bacteria 740
152 Ga0451839_1063193 3300041496 Unclassified 600
153 Ga0439463_214139 3300042016 Bacteria 500
154 Ga0466965_0330042 3300044683 Unclassified 832
155 Ga0466961_0228733 3300044693 Unclassified 1145
156 Ga0466964_0131267 3300044706 Bacteria 1141
157 Ga0466971_0111008 3300044719 Bacteria 1265
158 Ga0466968_0533969 3300044735 Unclassified 587
159 Ga0466957_0023115 3300044842 Bacteria 3672
160 Ga0466957_0919693 3300044842 Bacteria 626
161 Ga0466959_0275688 3300045049 Unclassified 1155
162 Ga0466958_0004767 3300045836 Bacteria 7211
163 Ga0466958_0198242 3300045836 Unclassified 1277
164 Ga0466967_0611582 3300045976 Bacteria 1076
165 Ga0466967_1091186 3300045976 Unclassified 795
166 Ga0495603_0016339 3300046455 Bacteria 4490
167 Ga0495629_0004054 3300046459 Bacteria 11005
168 Ga0495629_0135462 3300046459 Bacteria 1715
169 Ga0495629_0155693 3300046459 Bacteria 1588
170 Ga0495641_0001617 3300046461 Bacteria 18950
171 Ga0495651_0005899 3300046462 Bacteria 9343
172 Ga0495651_0035638 3300046462 Bacteria 3873
173 Ga0495653_0010306 3300046463 Bacteria 7647
174 Ga0495653_0016351 3300046463 Bacteria 6043
175 Ga0495582_0000682 3300046473 Bacteria 18675
176 Ga0495582_0070442 3300046473 Unclassified 1934
177 Ga0495582_0595896 3300046473 Bacteria 639
178 Ga0495582_0622851 3300046473 Bacteria 624
179 Ga0495639_0000987 3300046475 Bacteria 12848
180 Ga0495639_0134130 3300046475 Bacteria 1187
181 Ga0495662_0001640 3300046476 Bacteria 11143
182 Ga0495664_0035769 3300046477 Bacteria 2926
183 Ga0495594_0135378 3300046499 Unclassified 1396
184 Ga0495608_0003436 3300046511 Bacteria 11343
185 Ga0495608_0317746 3300046511 Bacteria 962
186 Ga0495618_0053158 3300046514 Bacteria 2561
187 Ga0495618_0302376 3300046514 Unclassified 994
188 Ga0495628_0026600 3300046516 Bacteria 4714
189 Ga0495628_0095791 3300046516 Unclassified 2293
190 Ga0495630_0005888 3300046517 Bacteria 8670
191 Ga0495630_0020878 3300046517 Bacteria 4834
192 Ga0495630_0078129 3300046517 Bacteria 2496
193 Ga0495652_0016196 3300046529 Bacteria 6667
194 Ga0495652_0036852 3300046529 Bacteria 4247
195 Ga0495665_0000215 3300046531 Bacteria 29257
196 Ga0495640_0012345 3300046533 Bacteria 6530
197 Ga0495640_0145070 3300046533 Bacteria 1528
198 Ga0495587_0002231 3300046536 Bacteria 12952
199 Ga0495587_0556512 3300046536 Bacteria 633
200 Ga0495645_0033685 3300046543 Bacteria 3737
201 Ga0495667_0002507 3300046559 Bacteria 12258
202 Ga0495667_0013997 3300046559 Bacteria 5416
203 Ga0495667_0040427 3300046559 Unclassified 3096
204 Ga0495667_0120319 3300046559 Bacteria 1695
205 Ga0495634_0044609 3300046642 Bacteria 3000
206 Ga0495635_0059932 3300046663 Bacteria 2617
207 Ga0495635_0079057 3300046663 Unclassified 2251
208 Ga0495588_0692863 3300046674 Bacteria 533
209 Ga0495657_0066131 3300046675 Unclassified 2375
210 Ga0495599_0146174 3300046678 Bacteria 1465
211 Ga0495599_0306931 3300046678 Unclassified 957
212 Ga0495623_0006230 3300046679 Bacteria 7759
213 Ga0495646_0063773 3300046680 Unclassified 2186
214 Ga0495658_0000330 3300046683 Bacteria 26505
215 Ga0495658_0142298 3300046683 Bacteria 1468
216 Ga0495613_0003457 3300046689 Bacteria 11809
217 Ga0495613_0010477 3300046689 Bacteria 6883
218 Ga0495613_0272835 3300046689 Bacteria 1176
219 Ga0495624_0110275 3300046690 Bacteria 1692
220 Ga0495624_0136380 3300046690 Bacteria 1504
221 Ga0495624_0143640 3300046690 Bacteria 1461
222 Ga0495600_0001291 3300046809 Bacteria 13844
223 Ga0495600_0050722 3300046809 Bacteria 2708
224 Ga0495600_0065586 3300046809 Unclassified 2374
225 Ga0495581_0001504 3300047315 Bacteria 12978
226 Ga0495581_0456282 3300047315 Bacteria 744
227 Ga0495604_0003733 3300047317 Bacteria 12128
228 Ga0495604_0024710 3300047317 Bacteria 4794
229 Ga0495604_0274812 3300047317 Bacteria 1140
230 Ga0495674_0010699 3300047319 Bacteria 8680
231 Ga0495674_0084851 3300047319 Unclassified 2713
232 Ga0495674_0176025 3300047319 Unclassified 1783
233 Ga0495676_0000450 3300047321 Bacteria 33719
234 Ga0495680_0017673 3300047322 Bacteria 6077
235 Ga0495680_0022313 3300047322 Bacteria 5278
236 Ga0495675_0006597 3300047444 Bacteria 7106
237 Ga0495675_0105015 3300047444 Unclassified 1766
238 Ga0495684_0016325 3300047471 Bacteria 5717
239 Ga0495684_0019331 3300047471 Bacteria 5243
240 Ga0495684_0040061 3300047471 Bacteria 3592
241 Ga0495593_0008216 3300047673 Bacteria 6073
242 Ga0495614_0006348 3300048089 Bacteria 5312
243 Ga0496100_0356551 3300048903 Bacteria 1106
244 Ga0496102_0023593 3300048905 Bacteria 5466
245 Ga0496102_0056030 3300048905 Bacteria 3595
246 Ga0496103_0091616 3300048906 Bacteria 1918
247 Ga0496103_0497667 3300048906 Bacteria 780
248 Ga0496104_0080723 3300048907 Bacteria 3101
249 Ga0496105_0208721 3300048908 Bacteria 1592
250 Ga0496105_0739944 3300048908 Bacteria 752
251 Ga0496106_0143634 3300048909 Bacteria 1878
252 Ga0496106_0615416 3300048909 Bacteria 869
253 Ga0496107_0012419 3300048910 Bacteria 5946
254 Ga0496108_0324136 3300048911 Bacteria 1343
255 Ga0496112_0006964 3300048915 Bacteria 9982
256 Ga0496112_0076948 3300048915 Bacteria 3299
257 Ga0496113_0048830 3300048916 Bacteria 3150
258 Ga0496114_0180062 3300048917 Bacteria 1845
259 Ga0496115_0010783 3300048918 Bacteria 6836
260 Ga0496115_0116519 3300048918 Bacteria 2197
261 Ga0496115_0372030 3300048918 Bacteria 1163
262 Ga0496115_0408051 3300048918 Bacteria 1102
263 Ga0496115_0775928 3300048918 Bacteria 748
264 Ga0501031_0004880 3300049568 Bacteria 8720
265 Ga0501032_0006544 3300049569 Bacteria 8556
266 Ga0501033_0004060 3300049570 Bacteria 11820
267 Ga0501034_0205129 3300049571 Bacteria 1928
268 Ga0501036_0914773 3300049572 Bacteria 720
269 Ga0501037_0014808 3300049573 Bacteria 5738
270 Ga0501038_0001571 3300049574 Bacteria 21153
271 Ga0501039_0005062 3300049575 Bacteria 9993
272 Ga0501039_0291072 3300049575 Bacteria 1284
273 Ga0501040_0001822 3300049576 Bacteria 13705
274 Ga0501040_0523221 3300049576 Bacteria 855
275 Ga0501041_0080856 3300049577 Bacteria 2000
276 Ga0501042_0001481 3300049578 Bacteria 13851
277 Ga0501042_0311243 3300049578 Bacteria 1138
278 Ga0501043_0005959 3300049579 Bacteria 9801
279 Ga0501046_0002584 3300049580 Bacteria 16929
280 Ga0501046_0298867 3300049580 Bacteria 1176
281 Ga0501048_0008574 3300049582 Bacteria 7717
282 Ga0501067_0046090 3300049583 Bacteria 2420
283 Ga0501068_0001853 3300049584 Bacteria 11226
284 Ga0501069_0033838 3300049585 Bacteria 2815
285 Ga0501070_0002915 3300049586 Bacteria 14886
286 Ga0501071_0002890 3300049587 Bacteria 10594
287 Ga0501072_0059563 3300049588 Bacteria 3010
288 Ga0501072_0910141 3300049588 Bacteria 687
289 Ga0501073_0011054 3300049589 Bacteria 6603
290 Ga0501074_0067738 3300049590 Bacteria 2566
291 Ga0501075_0046874 3300049591 Bacteria 3247
292 Ga0501075_0199115 3300049591 Bacteria 1528
293 Ga0501075_0592443 3300049591 Bacteria 846
294 Ga0501076_0098414 3300049592 Bacteria 2356
295 Ga0501077_0006090 3300049593 Bacteria 7361
296 Ga0501077_0806013 3300049593 Archaea 604
297 Ga0501209_232915 3300049656 Unclassified 573
298 Ga0501079_0142263 3300049741 Bacteria 1868
299 Ga0501080_0006485 3300049742 Bacteria 10511
300 Ga0501081_0008251 3300049743 Bacteria 6760
301 Ga0501081_0182952 3300049743 Bacteria 1516
302 Ga0501083_0010288 3300049744 Bacteria 6591
303 Ga0501035_0006613 3300049822 Bacteria 10851
304 Ga0501045_0174253 3300049824 Bacteria 1602
305 nmdc:mga0yw44_73783_c1 3300050492 Bacteria 2123
306 nmdc:mga05p37_1278871_c1 3300050507 Bacteria 750
307 nmdc:mga09592_62346_c1 3300050508 Bacteria 3154
308 nmdc:mga06r32_112248_c1 3300050510 Bacteria 2682
309 Ga0495601_0049950 3300053077 Unclassified 2638
310 Ga0495601_0543365 3300053077 Unclassified 748
311 Ga0495612_0051261 3300053078 Unclassified 1696
312 Ga0495595_0002918 3300053084 Bacteria 6745
313 Ga0495619_0002961 3300053085 Bacteria 11026
314 Ga0495619_0023527 3300053085 Bacteria 3951
315 Ga0501084_0016817 3300054114 Bacteria 6078
316 Ga0501084_1610969 3300054114 Unclassified 543
317 Ga0501082_0111730 3300060353 Bacteria 2365
318 Ga0466962_0022867 3300061719 Bacteria 3004
319 Ga0530510_0112312 3300061734 Bacteria 1996
320 Ga0496103_0274773
321 JGI25407J50210_10010459
322 JGI25407J50210_10095797
323 Ga0070658_10321507
324 Ga0070658_10407258
325 Ga0070658_10417937
326 Ga0070683_100019465
327 Ga0070683_100220881
328 Ga0070680_100007520
329 Ga0070660_100003089
330 Ga0070660_100071262
331 Ga0070661_100398482
332 Ga0070661_101292288
333 Ga0070671_100115726
334 Ga0070659_101357586
335 Ga0070714_100590663
336 Ga0070713_100160634
337 Ga0070713_100204434
338 Ga0070710_10204732
339 Ga0070711_100126891
340 Ga0070678_100213039
341 Ga0070681_10002637
342 Ga0070681_10006033
343 Ga0070681_10134926
344 Ga0070681_10272810
345 Ga0070679_100003184
346 Ga0070679_100071588
347 Ga0070684_100026767
348 Ga0070684_100822050
349 Ga0068853_101012167
350 Ga0068855_100008848
351 Ga0068855_100192028
352 Ga0068852_100080234
353 Ga0081455_10114492
354 Ga0081538_10004031
355 Ga0070716_101329249
356 Ga0070712_100308166
357 Ga0070712_100426585
358 Ga0075434_100899487
359 Ga0075429_100060017
360 Ga0075436_100320259
361 Ga0105240_10026386
362 Ga0105245_10310594
363 Ga0105245_11333104
364 Ga0105241_10031337
365 Ga0105238_10874923
366 Ga0157371_10367025
367 Ga0157371_11376800
368 Ga0157371_11387052
369 Ga0157370_10060288
370 Ga0157370_10064391
371 Ga0157372_11237262
372 Ga0163163_10271331
373 Ga0182006_1058644
374 Ga0197907_10833220
375 Ga0206356_10509765
376 Ga0206354_10581800
377 Ga0206353_11305421
378 Ga0213876_10138703
379 Ga0224712_10014978
380 Ga0207705_10250241
381 Ga0207707_10007068
382 Ga0207707_10085552
383 Ga0207695_10354484
384 Ga0207693_10032755
385 Ga0207693_10276195
386 Ga0207663_10838173
387 Ga0207663_10849615
388 Ga0207660_10185549
389 Ga0207660_10188486
390 Ga0207660_10198989
391 Ga0207657_10001335
392 Ga0207657_10049157
393 Ga0207649_10218999
394 Ga0207652_10038798
395 Ga0207687_10132859
396 Ga0207700_10929063
397 Ga0207700_10929110
398 Ga0207664_10389856
399 Ga0207644_10497695
400 Ga0207709_10167231
401 Ga0207669_10300948
402 Ga0207711_11463448
403 Ga0207661_10426336
404 Ga0207661_10427326
405 Ga0207667_10723737
406 Ga0207667_11271540
407 Ga0207639_10342173
408 Ga0207639_10819729
409 Ga0207676_10915699
410 Ga0207675_101067057
411 Ga0207683_10257118
412 Ga0207698_10154741
413 Ga0268266_11023639
414 Ga0268266_11661775
415 Ga0265334_10049516
416 Ga0265318_10080964
417 Ga0265338_10015604
418 Ga0265330_10136237
419 Ga0265320_10070474
420 Ga0265325_10030687
421 Ga0265340_10388409
422 Ga0265327_10022706
423 Ga0265327_10093742
424 Ga0265327_10266566
425 Ga0265316_10015767
426 Ga0265313_10002750
427 Ga0265314_10003582
428 Ga0265314_10230812
429 Ga0307413_10144173
430 Ga0307410_10086672
431 Ga0307406_10107992
432 Ga0307407_10426376
433 Ga0307409_100419723
434 Ga0307416_100041508
435 Ga0307416_100172319
436 Ga0307411_10054688
437 Ga0373944_0003973
438 Ga0373923_0128250
439 Ga0373936_0036759
440 Ga0373945_0007357
441 Ga0373954_0336512
442 Ga0373943_0000357
443 Ga0373946_0007636
444 Ga0373924_0179382
445 Ga0373935_0012920
446 Ga0373947_0000467
447 Ga0373937_0031311
448 Ga0373925_0002153
449 Ga0395899_0001360
450 Ga0395899_0004032
451 Ga0395900_0003938
452 Ga0395900_0036268
453 Ga0395900_0135264
454 Ga0395900_0289194
455 Ga0395900_0497391
456 Ga0395898_0013844
457 Ga0395898_0044569
458 Ga0395898_0163148
459 Ga0395898_0230097
460 Ga0395905_0010176
461 Ga0395905_0019356
462 Ga0436364_0731682
463 Ga0395901_0035985
464 Ga0395901_0168190
465 Ga0395901_0441123
466 Ga0395901_0697224
467 Ga0436365_0180289
468 Ga0436365_1033925
469 Ga0436363_0658362
470 Ga0436362_0827070
471 Ga0451839_1063193
472 Ga0439463_214139
473 Ga0466965_0330042
474 Ga0466961_0228733
475 Ga0466964_0131267
476 Ga0466971_0111008
477 Ga0466968_0533969
478 Ga0466957_0023115
479 Ga0466957_0919693
480 Ga0466959_0275688
481 Ga0466958_0004767
482 Ga0466958_0198242
483 Ga0466967_0611582
484 Ga0466967_1091186
485 Ga0495603_0016339
486 Ga0495629_0004054
487 Ga0495629_0135462
488 Ga0495629_0155693
489 Ga0495641_0001617
490 Ga0495651_0005899
491 Ga0495651_0035638
492 Ga0495653_0010306
493 Ga0495653_0016351
494 Ga0495582_0000682
495 Ga0495582_0070442
496 Ga0495582_0595896
497 Ga0495582_0622851
498 Ga0495639_0000987
499 Ga0495639_0134130
500 Ga0495662_0001640
501 Ga0495664_0035769
502 Ga0495594_0135378
503 Ga0495608_0003436
504 Ga0495608_0317746
505 Ga0495618_0053158
506 Ga0495618_0302376
507 Ga0495628_0026600
508 Ga0495628_0095791
509 Ga0495630_0005888
510 Ga0495630_0020878
511 Ga0495630_0078129
512 Ga0495652_0016196
513 Ga0495652_0036852
514 Ga0495665_0000215
515 Ga0495640_0012345
516 Ga0495640_0145070
517 Ga0495587_0002231
518 Ga0495587_0556512
519 Ga0495645_0033685
520 Ga0495667_0002507
521 Ga0495667_0013997
522 Ga0495667_0040427
523 Ga0495667_0120319
524 Ga0495634_0044609
525 Ga0495635_0059932
526 Ga0495635_0079057
527 Ga0495588_0692863
528 Ga0495657_0066131
529 Ga0495599_0146174
530 Ga0495599_0306931
531 Ga0495623_0006230
532 Ga0495646_0063773
533 Ga0495658_0000330
534 Ga0495658_0142298
535 Ga0495613_0003457
536 Ga0495613_0010477
537 Ga0495613_0272835
538 Ga0495624_0110275
539 Ga0495624_0136380
540 Ga0495624_0143640
541 Ga0495600_0001291
542 Ga0495600_0050722
543 Ga0495600_0065586
544 Ga0495581_0001504
545 Ga0495581_0456282
546 Ga0495604_0003733
547 Ga0495604_0024710
548 Ga0495604_0274812
549 Ga0495674_0010699
550 Ga0495674_0084851
551 Ga0495674_0176025
552 Ga0495676_0000450
553 Ga0495680_0017673
554 Ga0495680_0022313
555 Ga0495675_0006597
556 Ga0495675_0105015
557 Ga0495684_0016325
558 Ga0495684_0019331
559 Ga0495684_0040061
560 Ga0495593_0008216
561 Ga0495614_0006348
562 Ga0496100_0356551
563 Ga0496102_0023593
564 Ga0496102_0056030
565 Ga0496103_0091616
566 Ga0496103_0497667
567 Ga0496104_0080723
568 Ga0496105_0208721
569 Ga0496105_0739944
570 Ga0496106_0143634
571 Ga0496106_0615416
572 Ga0496107_0012419
573 Ga0496108_0324136
574 Ga0496112_0006964
575 Ga0496112_0076948
576 Ga0496113_0048830
577 Ga0496114_0180062
578 Ga0496115_0010783
579 Ga0496115_0116519
580 Ga0496115_0372030
581 Ga0496115_0408051
582 Ga0496115_0775928
583 Ga0501031_0004880
584 Ga0501032_0006544
585 Ga0501033_0004060
586 Ga0501034_0205129
587 Ga0501036_0914773
588 Ga0501037_0014808
589 Ga0501038_0001571
590 Ga0501039_0005062
591 Ga0501039_0291072
592 Ga0501040_0001822
593 Ga0501040_0523221
594 Ga0501041_0080856
595 Ga0501042_0001481
596 Ga0501042_0311243
597 Ga0501043_0005959
598 Ga0501046_0002584
599 Ga0501046_0298867
600 Ga0501048_0008574
601 Ga0501067_0046090
602 Ga0501068_0001853
603 Ga0501069_0033838
604 Ga0501070_0002915
605 Ga0501071_0002890
606 Ga0501072_0059563
607 Ga0501072_0910141
608 Ga0501073_0011054
609 Ga0501074_0067738
610 Ga0501075_0046874
611 Ga0501075_0199115
612 Ga0501075_0592443
613 Ga0501076_0098414
614 Ga0501077_0006090
615 Ga0501077_0806013
616 Ga0501209_232915
617 Ga0501079_0142263
618 Ga0501080_0006485
619 Ga0501081_0008251
620 Ga0501081_0182952
621 Ga0501083_0010288
622 Ga0501035_0006613
623 Ga0501045_0174253
624 nmdc:mga0yw44_73783_c1
625 nmdc:mga05p37_1278871_c1
626 nmdc:mga09592_62346_c1
627 nmdc:mga06r32_112248_c1
628 Ga0495601_0049950
629 Ga0495601_0543365
630 Ga0495612_0051261
631 Ga0495595_0002918
632 Ga0495619_0002961
633 Ga0495619_0023527
634 Ga0501084_0016817
635 Ga0501084_1610969
636 Ga0501082_0111730
637 Ga0466962_0022867
638 Ga0530510_0112312

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

24

138

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.909 3 131
1ve0-assembly1.cif.gz_A crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii 0.8956 2 127
1vmh-assembly1.cif.gz_A crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution 0.891 1 130
1vmh-assembly1.cif.gz_A crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution 0.8845 1 130
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.8801 3 131
ID Description Score Start End Superfamily
1ve0A00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8942 2 127 2.60.120.460
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8932 1 131 2.60.120.460
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8865 1 131 2.60.120.460
2p6hB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8792 3 131 2.60.120.460
1vphC00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8758 2 127 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A351U158-F1-model_v4 YjbQ family protein 0.9226 1 131
AF-A0A842S6V3-F1-model_v4 YjbQ family protein 0.9206 1 131
AF-A0A351U158-F1-model_v4 YjbQ family protein 0.9157 1 131
AF-A0A842S6V3-F1-model_v4 YjbQ family protein 0.9137 1 131
AF-A0A660S1G6-F1-model_v4 YjbQ family protein 0.9118 1 130

Map