F405170

General Info

Members Datasets Scaffolds Average Seq Length
319 172 636 255

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1096563|Ga0436365_1096563_1399_2220
Length 273
Sequence VDFSLDEYVAINQALWTRSNAQYTDARALAAWQDAEMSWGVWQVPESQVHALPEQVEGLDVVELGCGTAYWSAWLARRGARPVGVDPTPAQLETARRCQRELGIDFPLVEAPAEKVPLPDASFDLALSEYGASIWADPYVWVPEAARLLRPGGRLVFLRNSMLVVLCAPDQGSVGERLMRPQFGSYRVDWKDFDGGIEFHIGHGEWIRVLRASGFEVLDLIELQAPADAQTHEFYDFVPAEWAKRWPSEDIWVAQKRAAPTGTPQRHQSVDEA

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
58 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
59 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
60 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
61 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
62 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
63 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
66 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
67 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
68 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
69 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
70 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
71 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
72 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
73 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
74 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
82 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
88 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
101 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
102 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 9.4
Rhizosphere 88.4
Stem 0
Stem Tuber 0
Unclassified 3.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1096563 3300039437 Bacteria 2645
2 JGI25407J50210_10027900 3300003373 Bacteria 1465
3 Ga0070658_10017461 3300005327 Bacteria 5740
4 Ga0070658_10080800 3300005327 Bacteria 2670
5 Ga0070683_100003297 3300005329 Bacteria 13045
6 Ga0070683_100035799 3300005329 Bacteria 4538
7 Ga0070680_100084590 3300005336 Bacteria 2620
8 Ga0070680_100368495 3300005336 Bacteria 1222
9 Ga0070682_100126251 3300005337 Bacteria 1725
10 Ga0070660_100017019 3300005339 Bacteria 5292
11 Ga0070660_100095928 3300005339 Bacteria 2344
12 Ga0070661_100200390 3300005344 Bacteria 1525
13 Ga0070675_100133909 3300005354 Bacteria 2114
14 Ga0070659_100167222 3300005366 Bacteria 1800
15 Ga0070714_100028172 3300005435 Bacteria 4657
16 Ga0070681_10070169 3300005458 Bacteria 3469
17 Ga0070706_100221430 3300005467 Bacteria 1766
18 Ga0070706_100387588 3300005467 Bacteria 1301
19 Ga0070707_100295297 3300005468 Bacteria 1575
20 Ga0070698_100103232 3300005471 Bacteria 2821
21 Ga0070699_100014904 3300005518 Bacteria 6683
22 Ga0070699_100061180 3300005518 Bacteria 3264
23 Ga0070699_100090893 3300005518 Bacteria 2669
24 Ga0070699_100324609 3300005518 Unclassified 1384
25 Ga0070679_100071354 3300005530 Bacteria 3464
26 Ga0070679_100250197 3300005530 Bacteria 1729
27 Ga0070679_100751394 3300005530 Bacteria 918
28 Ga0070684_100009409 3300005535 Bacteria 7694
29 Ga0070684_100082868 3300005535 Bacteria 2841
30 Ga0068853_100196298 3300005539 Bacteria 1836
31 Ga0070664_100012395 3300005564 Bacteria 6928
32 Ga0068857_100066232 3300005577 Bacteria 3213
33 Ga0068857_100325336 3300005577 Bacteria 1420
34 Ga0068854_100211820 3300005578 Bacteria 1529
35 Ga0068852_100240889 3300005616 Bacteria 1728
36 Ga0081455_10020237 3300005937 Bacteria 6273
37 Ga0081455_10050629 3300005937 Bacteria 3570
38 Ga0081455_10166035 3300005937 Unclassified 1686
39 Ga0081538_10002559 3300005981 Bacteria 17673
40 Ga0081538_10057806 3300005981 Bacteria 2256
41 Ga0081538_10058094 3300005981 Bacteria 2247
42 Ga0081540_1005361 3300005983 Bacteria 9593
43 Ga0081539_10122419 3300005985 Bacteria 1290
44 Ga0075365_10319814 3300006038 Unclassified 1093
45 Ga0075430_100372875 3300006846 Bacteria 1178
46 Ga0075431_100038408 3300006847 Bacteria 4930
47 Ga0075434_100084696 3300006871 Bacteria 3169
48 Ga0075434_100396945 3300006871 Bacteria 1400
49 Ga0075436_100232023 3300006914 Bacteria 1311
50 Ga0105240_11081293 3300009093 Bacteria 854
51 Ga0114129_10039866 3300009147 Bacteria 6625
52 Ga0114129_10562101 3300009147 Bacteria 1482
53 Ga0105238_10592846 3300009551 Bacteria 1116
54 Ga0157373_10075182 3300013100 Bacteria 2383
55 Ga0157373_10375911 3300013100 Bacteria 1016
56 Ga0157370_10614553 3300013104 Bacteria 994
57 Ga0157369_10024193 3300013105 Bacteria 6760
58 Ga0157372_10741431 3300013307 Bacteria 1142
59 Ga0157380_10250803 3300014326 Bacteria 1602
60 Ga0157377_10272807 3300014745 Bacteria 1105
61 Ga0206353_11751408 3300020082 Bacteria 2336
62 Ga0213876_10007421 3300021384 Bacteria 5963
63 Ga0207705_10049014 3300025909 Bacteria 3039
64 Ga0207684_10394484 3300025910 Bacteria 1190
65 Ga0207707_10017826 3300025912 Bacteria 6193
66 Ga0207707_10053231 3300025912 Bacteria 3524
67 Ga0207657_10003291 3300025919 Bacteria 17267
68 Ga0207657_10047043 3300025919 Bacteria 3775
69 Ga0207652_10048483 3300025921 Bacteria 3631
70 Ga0207652_10262834 3300025921 Bacteria 1557
71 Ga0207652_10681836 3300025921 Bacteria 918
72 Ga0207646_10030754 3300025922 Bacteria 4865
73 Ga0207646_10445713 3300025922 Bacteria 1168
74 Ga0207664_10041715 3300025929 Bacteria 3576
75 Ga0207664_10223463 3300025929 Bacteria 1634
76 Ga0207690_10114101 3300025932 Bacteria 1951
77 Ga0207690_10690686 3300025932 Bacteria 838
78 Ga0207661_10036687 3300025944 Bacteria 3828
79 Ga0207661_10040172 3300025944 Bacteria 3676
80 Ga0207661_10091401 3300025944 Bacteria 2536
81 Ga0207661_10332500 3300025944 Bacteria 1368
82 Ga0207679_10059956 3300025945 Bacteria 2825
83 Ga0207639_10232806 3300026041 Bacteria 1598
84 Ga0207702_10252733 3300026078 Bacteria 1656
85 Ga0207674_10012854 3300026116 Bacteria 9346
86 Ga0207674_10075250 3300026116 Bacteria 3387
87 Ga0265337_1018666 3300028556 Bacteria 2199
88 Ga0265337_1031329 3300028556 Bacteria 1580
89 Ga0265319_1019526 3300028563 Bacteria 2527
90 Ga0265319_1022537 3300028563 Bacteria 2293
91 Ga0265334_10008172 3300028573 Bacteria 4456
92 Ga0265334_10013412 3300028573 Bacteria 3433
93 Ga0265318_10000497 3300028577 Bacteria 28834
94 Ga0265318_10009914 3300028577 Bacteria 4172
95 Ga0265323_10027324 3300028653 Bacteria 2144
96 Ga0265322_10012106 3300028654 Bacteria 2495
97 Ga0265336_10029568 3300028666 Bacteria 1709
98 Ga0265338_10005206 3300028800 Bacteria 17061
99 Ga0265338_10008570 3300028800 Bacteria 12374
100 Ga0265338_10028665 3300028800 Bacteria 5546
101 Ga0265338_10085677 3300028800 Bacteria 2625
102 Ga0265338_10223581 3300028800 Bacteria 1405
103 Ga0265338_10336128 3300028800 Bacteria 1089
104 Ga0265324_10006250 3300029957 Bacteria 5002
105 Ga0265324_10023571 3300029957 Bacteria 2192
106 Ga0265330_10021458 3300031235 Bacteria 2947
107 Ga0265330_10042133 3300031235 Bacteria 2024
108 Ga0265332_10028772 3300031238 Bacteria 2430
109 Ga0265328_10000442 3300031239 Bacteria 19383
110 Ga0265320_10022968 3300031240 Bacteria 3328
111 Ga0265320_10024094 3300031240 Bacteria 3226
112 Ga0265325_10002335 3300031241 Bacteria 12863
113 Ga0265329_10010259 3300031242 Bacteria 3449
114 Ga0265329_10025488 3300031242 Bacteria 1956
115 Ga0265340_10009425 3300031247 Bacteria 5239
116 Ga0265339_10010018 3300031249 Bacteria 5910
117 Ga0265339_10038471 3300031249 Bacteria 2669
118 Ga0265339_10091708 3300031249 Bacteria 1591
119 Ga0265339_10141310 3300031249 Bacteria 1224
120 Ga0265339_10183169 3300031249 Bacteria 1042
121 Ga0265331_10108125 3300031250 Bacteria 1276
122 Ga0265327_10010709 3300031251 Bacteria 6407
123 Ga0265327_10032081 3300031251 Bacteria 2944
124 Ga0265327_10033424 3300031251 Bacteria 2865
125 Ga0265327_10121424 3300031251 Bacteria 1237
126 Ga0265316_10001406 3300031344 Bacteria 25888
127 Ga0265316_10010294 3300031344 Bacteria 8529
128 Ga0265316_10092654 3300031344 Bacteria 2303
129 Ga0265313_10001425 3300031595 Bacteria 22389
130 Ga0265314_10013750 3300031711 Bacteria 6523
131 Ga0265314_10018394 3300031711 Bacteria 5447
132 Ga0265314_10047410 3300031711 Bacteria 3024
133 Ga0265342_10046993 3300031712 Bacteria 2592
134 Ga0265342_10284629 3300031712 Bacteria 874
135 Ga0307413_10160525 3300031824 Bacteria 1579
136 Ga0373940_0027916 3300035088 Unclassified 1487
137 Ga0373945_0127941 3300035116 Unclassified 1015
138 Ga0373956_0051593 3300035119 Bacteria 1849
139 Ga0373957_0048765 3300035120 Bacteria 1615
140 Ga0373946_0046541 3300035171 Bacteria 1798
141 Ga0373955_0169958 3300035172 Bacteria 1290
142 Ga0316574_0193715 3300035398 Bacteria 1307
143 Ga0373924_0093360 3300035410 Bacteria 1289
144 Ga0373924_0298404 3300035410 Unclassified 715
145 Ga0373935_0077935 3300035692 Bacteria 2149
146 Ga0373927_0027508 3300035695 Bacteria 3713
147 Ga0373947_0002451 3300035725 Bacteria 11168
148 Ga0373937_0200245 3300036401 Bacteria 1877
149 Ga0316584_0038517 3300036712 Bacteria 3557
150 Ga0373925_0204103 3300037068 Bacteria 1573
151 Ga0395899_0005602 3300037312 Bacteria 9741
152 Ga0395899_0008633 3300037312 Bacteria 7839
153 Ga0395899_0009426 3300037312 Bacteria 7499
154 Ga0395899_0025151 3300037312 Bacteria 4496
155 Ga0395899_0135519 3300037312 Bacteria 1755
156 Ga0395899_0328904 3300037312 Unclassified 1027
157 Ga0395900_0002595 3300037418 Bacteria 19762
158 Ga0395900_0006113 3300037418 Bacteria 12556
159 Ga0395900_0016928 3300037418 Bacteria 7440
160 Ga0395900_0025495 3300037418 Bacteria 6053
161 Ga0395900_0035568 3300037418 Bacteria 5130
162 Ga0395900_0142460 3300037418 Bacteria 2454
163 Ga0395898_0005888 3300037466 Bacteria 13179
164 Ga0395898_0008562 3300037466 Bacteria 10799
165 Ga0395898_0021466 3300037466 Bacteria 6548
166 Ga0395898_0143267 3300037466 Bacteria 2288
167 Ga0395898_0174925 3300037466 Bacteria 2052
168 Ga0395898_0216400 3300037466 Bacteria 1827
169 Ga0395905_0005281 3300037471 Bacteria 13208
170 Ga0395905_0012579 3300037471 Bacteria 8141
171 Ga0395905_0040922 3300037471 Bacteria 4347
172 Ga0395905_0052411 3300037471 Bacteria 3819
173 Ga0395905_0177563 3300037471 Bacteria 1999
174 Ga0395905_0225199 3300037471 Bacteria 1754
175 Ga0395905_0231242 3300037471 Bacteria 1729
176 Ga0395905_0446155 3300037471 Bacteria 1191
177 Ga0395901_0008399 3300038443 Bacteria 10437
178 Ga0395901_0012483 3300038443 Bacteria 8621
179 Ga0395901_0013486 3300038443 Bacteria 8309
180 Ga0395901_0020704 3300038443 Bacteria 6733
181 Ga0395901_0051132 3300038443 Bacteria 4295
182 Ga0395901_0059235 3300038443 Bacteria 3983
183 Ga0395901_0120476 3300038443 Bacteria 2757
184 Ga0395901_0136242 3300038443 Bacteria 2580
185 Ga0395901_0385092 3300038443 Bacteria 1443
186 Ga0395901_0459698 3300038443 Bacteria 1301
187 Ga0436365_0180837 3300039437 Bacteria 12118
188 Ga0436365_0727479 3300039437 Bacteria 2073
189 Ga0436365_0842464 3300039437 Bacteria 3445
190 Ga0436362_1094119 3300039453 Bacteria 1405
191 Ga0451807_1705086 3300041486 Bacteria 861
192 Ga0451853_1584429 3300041512 Bacteria 2598
193 Ga0466966_0077738 3300044684 Bacteria 2070
194 Ga0466961_0036993 3300044693 Bacteria 3132
195 Ga0466961_0149913 3300044693 Bacteria 1456
196 Ga0466963_0037640 3300044694 Bacteria 3160
197 Ga0466963_0235671 3300044694 Bacteria 1283
198 Ga0466963_0399438 3300044694 Bacteria 969
199 Ga0466971_0011932 3300044719 Bacteria 3806
200 Ga0466968_0006546 3300044735 Bacteria 4397
201 Ga0466957_0128490 3300044842 Bacteria 1621
202 Ga0466959_0013281 3300045049 Bacteria 5965
203 Ga0466959_0064213 3300045049 Bacteria 2665
204 Ga0466959_0390321 3300045049 Unclassified 947
205 Ga0466958_0005619 3300045836 Bacteria 6764
206 Ga0466958_0157641 3300045836 Bacteria 1433
207 Ga0466967_0061150 3300045976 Bacteria 3340
208 Ga0466967_0078722 3300045976 Bacteria 2970
209 Ga0466967_0098199 3300045976 Bacteria 2674
210 Ga0466967_0358289 3300045976 Bacteria 1413
211 Ga0466967_0456663 3300045976 Bacteria 1249
212 Ga0495592_0387149 3300046454 Unclassified 888
213 Ga0495629_0089094 3300046459 Bacteria 2153
214 Ga0495641_0110165 3300046461 Bacteria 1228
215 Ga0495641_0216716 3300046461 Bacteria 858
216 Ga0495651_0067717 3300046462 Bacteria 2723
217 Ga0495653_0114012 3300046463 Bacteria 1937
218 Ga0495580_0049866 3300046472 Bacteria 2961
219 Ga0495582_0129661 3300046473 Bacteria 1424
220 Ga0495608_0051766 3300046511 Bacteria 2720
221 Ga0495608_0114034 3300046511 Bacteria 1736
222 Ga0495630_0173476 3300046517 Bacteria 1643
223 Ga0495640_0063897 3300046533 Bacteria 2490
224 Ga0495640_0097955 3300046533 Bacteria 1928
225 Ga0495645_0132507 3300046543 Bacteria 1745
226 Ga0495634_0007652 3300046642 Bacteria 8092
227 Ga0495635_0167779 3300046663 Bacteria 1493
228 Ga0495635_0211449 3300046663 Bacteria 1313
229 Ga0495657_0028670 3300046675 Bacteria 3913
230 Ga0495657_0046300 3300046675 Bacteria 2946
231 Ga0495657_0143634 3300046675 Bacteria 1486
232 Ga0495623_0124128 3300046679 Bacteria 1552
233 Ga0495623_0200136 3300046679 Bacteria 1149
234 Ga0495646_0054243 3300046680 Bacteria 2412
235 Ga0495658_0096659 3300046683 Bacteria 1757
236 Ga0495600_0102395 3300046809 Bacteria 1866
237 Ga0495581_0080318 3300047315 Bacteria 1887
238 Ga0495581_0150275 3300047315 Bacteria 1360
239 Ga0495604_0086792 3300047317 Bacteria 2332
240 Ga0495674_0108326 3300047319 Bacteria 2357
241 Ga0495676_0074202 3300047321 Bacteria 2606
242 Ga0495676_0448493 3300047321 Bacteria 851
243 Ga0495680_0023296 3300047322 Bacteria 5150
244 Ga0495680_0044563 3300047322 Bacteria 3507
245 Ga0495684_0000645 3300047471 Bacteria 28045
246 Ga0495684_0116903 3300047471 Bacteria 2010
247 Ga0495684_0125153 3300047471 Bacteria 1934
248 Ga0495684_0352971 3300047471 Unclassified 1043
249 Ga0496101_0115931 3300048904 Bacteria 2021
250 Ga0496102_0054154 3300048905 Bacteria 3658
251 Ga0496103_0134792 3300048906 Bacteria 1578
252 Ga0496104_0013824 3300048907 Bacteria 7282
253 Ga0496104_0032253 3300048907 Bacteria 4875
254 Ga0496105_0004316 3300048908 Bacteria 10707
255 Ga0496105_0354444 3300048908 Bacteria 1171
256 Ga0496108_0087145 3300048911 Bacteria 2651
257 Ga0496108_0125511 3300048911 Bacteria 2203
258 Ga0496109_0004583 3300048912 Bacteria 11537
259 Ga0496109_0119303 3300048912 Bacteria 2456
260 Ga0496109_0140478 3300048912 Unclassified 2258
261 Ga0496110_0008194 3300048913 Bacteria 8398
262 Ga0496110_0068919 3300048913 Bacteria 3132
263 Ga0496110_0077824 3300048913 Bacteria 2951
264 Ga0496111_0176877 3300048914 Bacteria 1586
265 Ga0496111_0447210 3300048914 Bacteria 953
266 Ga0496112_0021682 3300048915 Bacteria 6111
267 Ga0496112_0023270 3300048915 Bacteria 5916
268 Ga0496112_0049447 3300048915 Bacteria 4122
269 Ga0496112_0056138 3300048915 Bacteria 3875
270 Ga0496112_0218502 3300048915 Bacteria 1862
271 Ga0496112_0280015 3300048915 Bacteria 1615
272 Ga0496112_0445247 3300048915 Bacteria 1233
273 Ga0496113_0184981 3300048916 Bacteria 1652
274 Ga0496115_0014628 3300048918 Bacteria 5942
275 Ga0496115_0059754 3300048918 Bacteria 3070
276 Ga0496115_0397633 3300048918 Bacteria 1118
277 Ga0501031_0037730 3300049568 Bacteria 3154
278 Ga0501031_0182138 3300049568 Bacteria 1372
279 Ga0501032_0261061 3300049569 Bacteria 1123
280 Ga0501033_0136929 3300049570 Bacteria 1772
281 Ga0501034_0009243 3300049571 Bacteria 10330
282 Ga0501039_0190227 3300049575 Bacteria 1614
283 Ga0501040_0048293 3300049576 Bacteria 2909
284 Ga0501040_0119280 3300049576 Bacteria 1850
285 Ga0501040_0191630 3300049576 Bacteria 1451
286 Ga0501048_0036798 3300049582 Bacteria 3517
287 Ga0501048_0039600 3300049582 Bacteria 3381
288 Ga0501067_0063066 3300049583 Bacteria 2052
289 Ga0501067_0250286 3300049583 Unclassified 986
290 Ga0501068_0289928 3300049584 Bacteria 1047
291 Ga0501069_0170144 3300049585 Bacteria 1257
292 Ga0501071_0008568 3300049587 Bacteria 6761
293 Ga0501071_0021284 3300049587 Bacteria 4514
294 Ga0501071_0404101 3300049587 Bacteria 1043
295 Ga0501072_0095443 3300049588 Bacteria 2363
296 Ga0501072_0205891 3300049588 Bacteria 1568
297 Ga0501072_0224844 3300049588 Bacteria 1496
298 Ga0501074_0107461 3300049590 Bacteria 1998
299 Ga0501074_0309832 3300049590 Bacteria 1121
300 Ga0501075_0157067 3300049591 Bacteria 1734
301 Ga0501075_0184691 3300049591 Bacteria 1590
302 Ga0501075_0337843 3300049591 Bacteria 1148
303 Ga0501076_0172851 3300049592 Bacteria 1761
304 Ga0501080_0695504 3300049742 Bacteria 897
305 Ga0501081_0285209 3300049743 Bacteria 1209
306 Ga0501045_0091981 3300049824 Bacteria 2243
307 nmdc:mga0n895_60148_c1 3300050512 Bacteria 3748
308 nmdc:mga0a205_137521_c1 3300050515 Bacteria 2343
309 Ga0495595_0003269 3300053084 Bacteria 6436
310 Ga0495595_0059737 3300053084 Bacteria 1783
311 Ga0495595_0177214 3300053084 Bacteria 1056
312 Ga0495619_0017678 3300053085 Bacteria 4517
313 Ga0495619_0021105 3300053085 Bacteria 4156
314 Ga0495619_0041698 3300053085 Bacteria 3003
315 Ga0495619_0280981 3300053085 Bacteria 1153
316 Ga0501084_0187126 3300054114 Bacteria 1747
317 Ga0501082_0157460 3300060353 Bacteria 1973
318 Ga0466962_0015653 3300061719 Bacteria 3656
319 Ga0436365_1096563
320 JGI25407J50210_10027900
321 Ga0070658_10017461
322 Ga0070658_10080800
323 Ga0070683_100003297
324 Ga0070683_100035799
325 Ga0070680_100084590
326 Ga0070680_100368495
327 Ga0070682_100126251
328 Ga0070660_100017019
329 Ga0070660_100095928
330 Ga0070661_100200390
331 Ga0070675_100133909
332 Ga0070659_100167222
333 Ga0070714_100028172
334 Ga0070681_10070169
335 Ga0070706_100221430
336 Ga0070706_100387588
337 Ga0070707_100295297
338 Ga0070698_100103232
339 Ga0070699_100014904
340 Ga0070699_100061180
341 Ga0070699_100090893
342 Ga0070699_100324609
343 Ga0070679_100071354
344 Ga0070679_100250197
345 Ga0070679_100751394
346 Ga0070684_100009409
347 Ga0070684_100082868
348 Ga0068853_100196298
349 Ga0070664_100012395
350 Ga0068857_100066232
351 Ga0068857_100325336
352 Ga0068854_100211820
353 Ga0068852_100240889
354 Ga0081455_10020237
355 Ga0081455_10050629
356 Ga0081455_10166035
357 Ga0081538_10002559
358 Ga0081538_10057806
359 Ga0081538_10058094
360 Ga0081540_1005361
361 Ga0081539_10122419
362 Ga0075365_10319814
363 Ga0075430_100372875
364 Ga0075431_100038408
365 Ga0075434_100084696
366 Ga0075434_100396945
367 Ga0075436_100232023
368 Ga0105240_11081293
369 Ga0114129_10039866
370 Ga0114129_10562101
371 Ga0105238_10592846
372 Ga0157373_10075182
373 Ga0157373_10375911
374 Ga0157370_10614553
375 Ga0157369_10024193
376 Ga0157372_10741431
377 Ga0157380_10250803
378 Ga0157377_10272807
379 Ga0206353_11751408
380 Ga0213876_10007421
381 Ga0207705_10049014
382 Ga0207684_10394484
383 Ga0207707_10017826
384 Ga0207707_10053231
385 Ga0207657_10003291
386 Ga0207657_10047043
387 Ga0207652_10048483
388 Ga0207652_10262834
389 Ga0207652_10681836
390 Ga0207646_10030754
391 Ga0207646_10445713
392 Ga0207664_10041715
393 Ga0207664_10223463
394 Ga0207690_10114101
395 Ga0207690_10690686
396 Ga0207661_10036687
397 Ga0207661_10040172
398 Ga0207661_10091401
399 Ga0207661_10332500
400 Ga0207679_10059956
401 Ga0207639_10232806
402 Ga0207702_10252733
403 Ga0207674_10012854
404 Ga0207674_10075250
405 Ga0265337_1018666
406 Ga0265337_1031329
407 Ga0265319_1019526
408 Ga0265319_1022537
409 Ga0265334_10008172
410 Ga0265334_10013412
411 Ga0265318_10000497
412 Ga0265318_10009914
413 Ga0265323_10027324
414 Ga0265322_10012106
415 Ga0265336_10029568
416 Ga0265338_10005206
417 Ga0265338_10008570
418 Ga0265338_10028665
419 Ga0265338_10085677
420 Ga0265338_10223581
421 Ga0265338_10336128
422 Ga0265324_10006250
423 Ga0265324_10023571
424 Ga0265330_10021458
425 Ga0265330_10042133
426 Ga0265332_10028772
427 Ga0265328_10000442
428 Ga0265320_10022968
429 Ga0265320_10024094
430 Ga0265325_10002335
431 Ga0265329_10010259
432 Ga0265329_10025488
433 Ga0265340_10009425
434 Ga0265339_10010018
435 Ga0265339_10038471
436 Ga0265339_10091708
437 Ga0265339_10141310
438 Ga0265339_10183169
439 Ga0265331_10108125
440 Ga0265327_10010709
441 Ga0265327_10032081
442 Ga0265327_10033424
443 Ga0265327_10121424
444 Ga0265316_10001406
445 Ga0265316_10010294
446 Ga0265316_10092654
447 Ga0265313_10001425
448 Ga0265314_10013750
449 Ga0265314_10018394
450 Ga0265314_10047410
451 Ga0265342_10046993
452 Ga0265342_10284629
453 Ga0307413_10160525
454 Ga0373940_0027916
455 Ga0373945_0127941
456 Ga0373956_0051593
457 Ga0373957_0048765
458 Ga0373946_0046541
459 Ga0373955_0169958
460 Ga0316574_0193715
461 Ga0373924_0093360
462 Ga0373924_0298404
463 Ga0373935_0077935
464 Ga0373927_0027508
465 Ga0373947_0002451
466 Ga0373937_0200245
467 Ga0316584_0038517
468 Ga0373925_0204103
469 Ga0395899_0005602
470 Ga0395899_0008633
471 Ga0395899_0009426
472 Ga0395899_0025151
473 Ga0395899_0135519
474 Ga0395899_0328904
475 Ga0395900_0002595
476 Ga0395900_0006113
477 Ga0395900_0016928
478 Ga0395900_0025495
479 Ga0395900_0035568
480 Ga0395900_0142460
481 Ga0395898_0005888
482 Ga0395898_0008562
483 Ga0395898_0021466
484 Ga0395898_0143267
485 Ga0395898_0174925
486 Ga0395898_0216400
487 Ga0395905_0005281
488 Ga0395905_0012579
489 Ga0395905_0040922
490 Ga0395905_0052411
491 Ga0395905_0177563
492 Ga0395905_0225199
493 Ga0395905_0231242
494 Ga0395905_0446155
495 Ga0395901_0008399
496 Ga0395901_0012483
497 Ga0395901_0013486
498 Ga0395901_0020704
499 Ga0395901_0051132
500 Ga0395901_0059235
501 Ga0395901_0120476
502 Ga0395901_0136242
503 Ga0395901_0385092
504 Ga0395901_0459698
505 Ga0436365_0180837
506 Ga0436365_0727479
507 Ga0436365_0842464
508 Ga0436362_1094119
509 Ga0451807_1705086
510 Ga0451853_1584429
511 Ga0466966_0077738
512 Ga0466961_0036993
513 Ga0466961_0149913
514 Ga0466963_0037640
515 Ga0466963_0235671
516 Ga0466963_0399438
517 Ga0466971_0011932
518 Ga0466968_0006546
519 Ga0466957_0128490
520 Ga0466959_0013281
521 Ga0466959_0064213
522 Ga0466959_0390321
523 Ga0466958_0005619
524 Ga0466958_0157641
525 Ga0466967_0061150
526 Ga0466967_0078722
527 Ga0466967_0098199
528 Ga0466967_0358289
529 Ga0466967_0456663
530 Ga0495592_0387149
531 Ga0495629_0089094
532 Ga0495641_0110165
533 Ga0495641_0216716
534 Ga0495651_0067717
535 Ga0495653_0114012
536 Ga0495580_0049866
537 Ga0495582_0129661
538 Ga0495608_0051766
539 Ga0495608_0114034
540 Ga0495630_0173476
541 Ga0495640_0063897
542 Ga0495640_0097955
543 Ga0495645_0132507
544 Ga0495634_0007652
545 Ga0495635_0167779
546 Ga0495635_0211449
547 Ga0495657_0028670
548 Ga0495657_0046300
549 Ga0495657_0143634
550 Ga0495623_0124128
551 Ga0495623_0200136
552 Ga0495646_0054243
553 Ga0495658_0096659
554 Ga0495600_0102395
555 Ga0495581_0080318
556 Ga0495581_0150275
557 Ga0495604_0086792
558 Ga0495674_0108326
559 Ga0495676_0074202
560 Ga0495676_0448493
561 Ga0495680_0023296
562 Ga0495680_0044563
563 Ga0495684_0000645
564 Ga0495684_0116903
565 Ga0495684_0125153
566 Ga0495684_0352971
567 Ga0496101_0115931
568 Ga0496102_0054154
569 Ga0496103_0134792
570 Ga0496104_0013824
571 Ga0496104_0032253
572 Ga0496105_0004316
573 Ga0496105_0354444
574 Ga0496108_0087145
575 Ga0496108_0125511
576 Ga0496109_0004583
577 Ga0496109_0119303
578 Ga0496109_0140478
579 Ga0496110_0008194
580 Ga0496110_0068919
581 Ga0496110_0077824
582 Ga0496111_0176877
583 Ga0496111_0447210
584 Ga0496112_0021682
585 Ga0496112_0023270
586 Ga0496112_0049447
587 Ga0496112_0056138
588 Ga0496112_0218502
589 Ga0496112_0280015
590 Ga0496112_0445247
591 Ga0496113_0184981
592 Ga0496115_0014628
593 Ga0496115_0059754
594 Ga0496115_0397633
595 Ga0501031_0037730
596 Ga0501031_0182138
597 Ga0501032_0261061
598 Ga0501033_0136929
599 Ga0501034_0009243
600 Ga0501039_0190227
601 Ga0501040_0048293
602 Ga0501040_0119280
603 Ga0501040_0191630
604 Ga0501048_0036798
605 Ga0501048_0039600
606 Ga0501067_0063066
607 Ga0501067_0250286
608 Ga0501068_0289928
609 Ga0501069_0170144
610 Ga0501071_0008568
611 Ga0501071_0021284
612 Ga0501071_0404101
613 Ga0501072_0095443
614 Ga0501072_0205891
615 Ga0501072_0224844
616 Ga0501074_0107461
617 Ga0501074_0309832
618 Ga0501075_0157067
619 Ga0501075_0184691
620 Ga0501075_0337843
621 Ga0501076_0172851
622 Ga0501080_0695504
623 Ga0501081_0285209
624 Ga0501045_0091981
625 nmdc:mga0n895_60148_c1
626 nmdc:mga0a205_137521_c1
627 Ga0495595_0003269
628 Ga0495595_0059737
629 Ga0495595_0177214
630 Ga0495619_0017678
631 Ga0495619_0021105
632 Ga0495619_0041698
633 Ga0495619_0280981
634 Ga0501084_0187126
635 Ga0501082_0157460
636 Ga0466962_0015653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

62

157

0.98

PF13649

Methyltransf_25

Methyltransferase domain

61

153

0.94

PF13847

Methyltransf_31

Methyltransferase domain

55

171

0.93

PF08242

Methyltransf_12

Methyltransferase domain

62

155

0.9

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

32

224

0.88

PF13489

Methyltransf_23

Methyltransferase domain

41

166

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wm5-assembly1.cif.gz_A-2 crystal structure of apo trmm from mycoplasma capricolum 0.8577 54 251
7wm6-assembly1.cif.gz_B crystal structure of sah-bound trmm from mycoplasma capricolum 0.8286 54 251
3grz-assembly1.cif.gz_B crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.8211 44 252
2nxj-assembly2.cif.gz_B t.thermophilus ribosomal protein l11 methyltransferase (prma) in space group p 21 21 2 0.8197 45 251
3grz-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.8146 44 252
ID Description Score Start End Superfamily
af_Q54PP5_28_226_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9119 44 151 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8998 48 108 3.40.50.150
af_Q9VIK9_9_204_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8829 53 151 3.40.50.150
af_Q58847_2_138_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.876 49 122 3.40.50.150
3dlcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.876 41 151 3.40.50.150
ID Description Score Start End GO Terms
AF-I0H5Q0-F1-model_v4 Putative methyltransferase 0.9546 3 203 GO:0008757
GO:0032259
AF-A0A7V0LRI4-F1-model_v4 Class I SAM-dependent methyltransferase 0.9405 41 151 GO:0008757
GO:0032259
AF-A0A559UNQ9-F1-model_v4 deleted 0.9353 1 252
AF-A0A7W0PXW5-F1-model_v4 Methyltransferase domain-containing protein 0.9228 47 151 GO:0008757
GO:0032259
AF-A0A559UNQ9-F1-model_v4 deleted 0.9104 1 252

Map