F405000

General Info

Members Datasets Scaffolds Average Seq Length
319 162 319 310

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100040297|Ga0068864_1000402973
Length 338
Sequence MFGASIEKHPRFNPENLVSPVKQRLMNRRTFAKTLSLSLAAIGIQRLPLIASTSTSPQFSITMDDFYWTNAVKLTATERNQSILNTLKSNSIKAALFVIGSNIDSDEGKQLLWEWDKAGHMIGNHSYSHRNYSAPETVVAKYQQDILRAETLLKEFPRFRKYFRFPMLKEGETAAKRDAMRSFLAQHGYRTGHVTIDDSDWLIDQRLNARVKKDPTADVKPYREFYLEHLWSRAEYYDTLARRVLNRPVKHTILVHFNLLNGLFLNDAIAMLKSKGWQPIDAEDAFTDPVFLAKPNVVPAGESIVWALAKENGALAKDSHYPAEEGTAVSAQMDKLGL

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
143 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
146 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
147 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
148 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
149 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
150 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
151 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
152 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
153 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
154 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.94
Rhizosphere 98.75
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10166221 3300003322 Bacteria 4293
2 Ga0065714_10064422 3300005288 Bacteria 270668
3 Ga0065704_10078636 3300005289 Bacteria 4372
4 Ga0065712_10067728 3300005290 Bacteria 178215
5 Ga0065715_10027932 3300005293 Bacteria 1927
6 Ga0065715_10089181 3300005293 Bacteria 13047
7 Ga0065715_10091098 3300005293 Bacteria 6115
8 Ga0065715_10093104 3300005293 Bacteria 4808
9 Ga0065707_10096099 3300005295 Unclassified 3302
10 Ga0070676_10180436 3300005328 Bacteria 1372
11 Ga0070690_100014703 3300005330 Bacteria 4648
12 Ga0070690_100091094 3300005330 Unclassified 2008
13 Ga0070690_100203978 3300005330 Bacteria 1377
14 Ga0070670_100075477 3300005331 Bacteria 2896
15 Ga0070670_100095381 3300005331 Bacteria 2559
16 Ga0068869_100162316 3300005334 Bacteria 1740
17 Ga0070666_10012220 3300005335 Bacteria 5410
18 Ga0070680_100002850 3300005336 Bacteria 12854
19 Ga0070680_100005198 3300005336 Bacteria 9847
20 Ga0070682_100001724 3300005337 Bacteria 12158
21 Ga0070660_100034097 3300005339 Bacteria 3844
22 Ga0070689_100000720 3300005340 Bacteria 20182
23 Ga0070689_100012461 3300005340 Bacteria 6127
24 Ga0070687_100031874 3300005343 Bacteria 2589
25 Ga0070692_10005216 3300005345 Bacteria 5508
26 Ga0070692_10036477 3300005345 Bacteria 2495
27 Ga0070692_10051958 3300005345 Bacteria 2133
28 Ga0070692_10087425 3300005345 Bacteria 1689
29 Ga0070669_100008136 3300005353 Bacteria 7489
30 Ga0070669_100128391 3300005353 Bacteria 1942
31 Ga0070669_100269849 3300005353 Bacteria 1360
32 Ga0070669_100383437 3300005353 Bacteria 1147
33 Ga0070671_100003204 3300005355 Bacteria 12759
34 Ga0070671_100019988 3300005355 Bacteria 5456
35 Ga0070688_100064087 3300005365 Bacteria 2331
36 Ga0070659_100004483 3300005366 Bacteria 9976
37 Ga0070667_100159955 3300005367 Bacteria 1983
38 Ga0070701_10014226 3300005438 Bacteria 3643
39 Ga0070701_10028785 3300005438 Bacteria 2733
40 Ga0070701_10167164 3300005438 Bacteria 1278
41 Ga0070705_100003682 3300005440 Bacteria 7504
42 Ga0070700_100000291 3300005441 Bacteria 26394
43 Ga0070700_100005275 3300005441 Bacteria 6838
44 Ga0070700_100025747 3300005441 Bacteria 3467
45 Ga0070700_100166134 3300005441 Bacteria 1524
46 Ga0070700_100175386 3300005441 Unclassified 1487
47 Ga0070694_100002496 3300005444 Bacteria 10861
48 Ga0070694_100024284 3300005444 Bacteria 3912
49 Ga0070694_100066313 3300005444 Unclassified 2476
50 Ga0070694_100155578 3300005444 Bacteria 1673
51 Ga0070708_100018609 3300005445 Bacteria 5815
52 Ga0070678_100084560 3300005456 Bacteria 2415
53 Ga0070662_100182768 3300005457 Bacteria 1654
54 Ga0070662_100204448 3300005457 Bacteria 1569
55 Ga0070662_100360739 3300005457 Unclassified 1192
56 Ga0070681_10000700 3300005458 Bacteria 27818
57 Ga0070681_10010288 3300005458 Bacteria 9233
58 Ga0070681_10249300 3300005458 Bacteria 1688
59 Ga0070706_100000128 3300005467 Bacteria 92969
60 Ga0070707_100353728 3300005468 Bacteria 1427
61 Ga0070698_100033849 3300005471 Bacteria 5293
62 Ga0070699_100034016 3300005518 Bacteria 4405
63 Ga0070699_100132437 3300005518 Bacteria 2198
64 Ga0070679_100000642 3300005530 Bacteria 29738
65 Ga0070679_100012040 3300005530 Bacteria 8256
66 Ga0070697_100000262 3300005536 Bacteria 42644
67 Ga0068853_100479630 3300005539 Bacteria 1172
68 Ga0070672_100035270 3300005543 Bacteria 3802
69 Ga0070686_100016347 3300005544 Bacteria 4316
70 Ga0070686_100029185 3300005544 Bacteria 3353
71 Ga0070695_100183062 3300005545 Bacteria 1486
72 Ga0070696_100099490 3300005546 Bacteria 2082
73 Ga0070696_100232322 3300005546 Unclassified 1388
74 Ga0070693_100004948 3300005547 Bacteria 6359
75 Ga0070693_100006924 3300005547 Bacteria 5513
76 Ga0070693_100022800 3300005547 Bacteria 3336
77 Ga0070693_100099570 3300005547 Bacteria 1768
78 Ga0070693_100213817 3300005547 Bacteria 1259
79 Ga0070704_100026978 3300005549 Bacteria 3802
80 Ga0070704_100127038 3300005549 Bacteria 1969
81 Ga0070704_100335032 3300005549 Unclassified 1272
82 Ga0070704_100426535 3300005549 Bacteria 1137
83 Ga0068855_100207806 3300005563 Bacteria 2202
84 Ga0070664_100002675 3300005564 Bacteria 14380
85 Ga0070664_100105455 3300005564 Bacteria 2455
86 Ga0070664_100300974 3300005564 Unclassified 1449
87 Ga0068857_100002660 3300005577 Bacteria 14669
88 Ga0068854_100210467 3300005578 Bacteria 1533
89 Ga0068854_100361993 3300005578 Bacteria 1190
90 Ga0068856_100196124 3300005614 Bacteria 2033
91 Ga0070702_100011205 3300005615 Bacteria 4453
92 Ga0070702_100083982 3300005615 Bacteria 1914
93 Ga0070702_100251369 3300005615 Unclassified 1199
94 Ga0068852_100088799 3300005616 Bacteria 2761
95 Ga0068859_100004145 3300005617 Bacteria 14803
96 Ga0068859_100016738 3300005617 Bacteria 7361
97 Ga0068859_100022296 3300005617 Bacteria 6350
98 Ga0068859_100044506 3300005617 Bacteria 4460
99 Ga0068859_100226933 3300005617 Unclassified 1956
100 Ga0068864_100013767 3300005618 Bacteria 6708
101 Ga0068864_100017837 3300005618 Bacteria 5920
102 Ga0068864_100040297 3300005618 Bacteria 3996
103 Ga0068864_100179946 3300005618 Bacteria 1933
104 Ga0068864_100341355 3300005618 Bacteria 1411
105 Ga0068864_100443792 3300005618 Bacteria 1240
106 Ga0068851_10024465 3300005834 Bacteria 2957
107 Ga0068863_100061505 3300005841 Bacteria 3551
108 Ga0068863_100073674 3300005841 Bacteria 3231
109 Ga0068863_100430367 3300005841 Bacteria 1293
110 Ga0068858_100037776 3300005842 Bacteria 4478
111 Ga0068858_100075119 3300005842 Bacteria 3139
112 Ga0068858_100145386 3300005842 Bacteria 2226
113 Ga0068858_100265945 3300005842 Bacteria 1631
114 Ga0068860_100280238 3300005843 Bacteria 1629
115 Ga0068862_100013543 3300005844 Bacteria 6756
116 Ga0068862_100109686 3300005844 Unclassified 2421
117 Ga0081539_10000586 3300005985 Bacteria 74721
118 Ga0070716_100012130 3300006173 Bacteria 4360
119 Ga0097621_100003183 3300006237 Bacteria 11285
120 Ga0097621_100017214 3300006237 Bacteria 5485
121 Ga0068871_100006350 3300006358 Bacteria 8354
122 Ga0068871_100035979 3300006358 Bacteria 3938
123 Ga0068871_100341237 3300006358 Bacteria 1323
124 Ga0075428_100221329 3300006844 Bacteria 2044
125 Ga0075430_100037696 3300006846 Bacteria 4097
126 Ga0075433_10020508 3300006852 Bacteria 5529
127 Ga0075433_10048250 3300006852 Bacteria 3703
128 Ga0075433_10061728 3300006852 Bacteria 3283
129 Ga0075433_10136519 3300006852 Bacteria 2180
130 Ga0075433_10281337 3300006852 Bacteria 1474
131 Ga0075434_100069215 3300006871 Bacteria 3518
132 Ga0075434_100118544 3300006871 Bacteria 2661
133 Ga0068865_100011711 3300006881 Bacteria 5494
134 Ga0068865_100083674 3300006881 Bacteria 2297
135 Ga0075436_100015866 3300006914 Bacteria 5157
136 Ga0075436_100074838 3300006914 Bacteria 2344
137 Ga0097620_100004145 3300006931 Bacteria 14803
138 Ga0097620_100016738 3300006931 Bacteria 7361
139 Ga0097620_100022295 3300006931 Bacteria 6350
140 Ga0097620_100044505 3300006931 Bacteria 4460
141 Ga0097620_100226934 3300006931 Unclassified 1956
142 Ga0105240_10061463 3300009093 Bacteria 4681
143 Ga0105240_10287387 3300009093 Bacteria 1887
144 Ga0111539_10007238 3300009094 Bacteria 14219
145 Ga0111539_10049305 3300009094 Bacteria 5023
146 Ga0111539_10178513 3300009094 Bacteria 2481
147 Ga0111539_10792732 3300009094 Bacteria 1103
148 Ga0105245_10083111 3300009098 Bacteria 2931
149 Ga0114129_10007779 3300009147 Bacteria 15250
150 Ga0114129_10023888 3300009147 Bacteria 8663
151 Ga0114129_10029927 3300009147 Bacteria 7711
152 Ga0114129_10082186 3300009147 Bacteria 4477
153 Ga0114129_10120739 3300009147 Bacteria 3608
154 Ga0114129_10275656 3300009147 Bacteria 2249
155 Ga0114129_10418631 3300009147 Bacteria 1762
156 Ga0114129_10574742 3300009147 Unclassified 1463
157 Ga0105243_10015041 3300009148 Bacteria 5857
158 Ga0105243_10257100 3300009148 Bacteria 1562
159 Ga0105241_10112502 3300009174 Unclassified 2181
160 Ga0105248_10003128 3300009177 Bacteria 18316
161 Ga0105248_10003793 3300009177 Bacteria 16746
162 Ga0105248_10014676 3300009177 Bacteria 8621
163 Ga0105248_10032230 3300009177 Bacteria 5858
164 Ga0105248_10626106 3300009177 Bacteria 1214
165 Ga0105237_10000502 3300009545 Bacteria 55436
166 Ga0105237_10161697 3300009545 Bacteria 2238
167 Ga0105249_10080485 3300009553 Bacteria 3026
168 Ga0105246_10111158 3300011119 Unclassified 2013
169 Ga0105246_10145850 3300011119 Unclassified 1786
170 Ga0157373_10006310 3300013100 Bacteria 8860
171 Ga0157373_10184164 3300013100 Bacteria 1471
172 Ga0157374_10011073 3300013296 Bacteria 7792
173 Ga0157378_10010524 3300013297 Bacteria 8082
174 Ga0157378_10250899 3300013297 Bacteria 1694
175 Ga0157378_10286527 3300013297 Bacteria 1590
176 Ga0157378_10358697 3300013297 Bacteria 1426
177 Ga0157378_10480666 3300013297 Unclassified 1238
178 Ga0157378_10507300 3300013297 Unclassified 1206
179 Ga0163162_10005870 3300013306 Bacteria 11879
180 Ga0163162_10010913 3300013306 Bacteria 8844
181 Ga0163162_10012429 3300013306 Bacteria 8317
182 Ga0163162_10012948 3300013306 Bacteria 8142
183 Ga0163162_10034545 3300013306 Bacteria 5032
184 Ga0163162_10138764 3300013306 Bacteria 2543
185 Ga0157372_10015855 3300013307 Bacteria 8083
186 Ga0157372_10068831 3300013307 Bacteria 3980
187 Ga0157372_10084737 3300013307 Bacteria 3593
188 Ga0157375_10005682 3300013308 Bacteria 10851
189 Ga0157375_10015175 3300013308 Bacteria 6892
190 Ga0157375_10040652 3300013308 Bacteria 4484
191 Ga0157375_10217328 3300013308 Unclassified 2069
192 Ga0157375_10762821 3300013308 Unclassified 1118
193 Ga0163163_10002079 3300014325 Bacteria 16899
194 Ga0163163_10043672 3300014325 Bacteria 4395
195 Ga0163163_10087954 3300014325 Bacteria 3118
196 Ga0163163_10147937 3300014325 Bacteria 2393
197 Ga0157380_10026345 3300014326 Bacteria 4414
198 Ga0157380_10049772 3300014326 Bacteria 3306
199 Ga0157380_10075575 3300014326 Unclassified 2738
200 Ga0157380_10192955 3300014326 Bacteria 1800
201 Ga0157380_10424638 3300014326 Unclassified 1269
202 Ga0157380_10447272 3300014326 Bacteria 1240
203 Ga0157377_10201325 3300014745 Bacteria 1264
204 Ga0157376_10046695 3300014969 Bacteria 3573
205 Ga0157376_10498537 3300014969 Bacteria 1196
206 Ga0163161_10042531 3300017792 Bacteria 3268
207 Ga0207697_10041301 3300025315 Bacteria 1894
208 Ga0207656_10015419 3300025321 Bacteria 2957
209 Ga0207680_10018777 3300025903 Bacteria 3685
210 Ga0207645_10313368 3300025907 Bacteria 1046
211 Ga0207643_10003403 3300025908 Bacteria 8579
212 Ga0207684_10000150 3300025910 Bacteria 121849
213 Ga0207654_10077825 3300025911 Bacteria 1989
214 Ga0207654_10087325 3300025911 Unclassified 1892
215 Ga0207654_10098571 3300025911 Bacteria 1796
216 Ga0207707_10000016 3300025912 Bacteria 256002
217 Ga0207707_10035492 3300025912 Bacteria 4360
218 Ga0207671_10008181 3300025914 Bacteria 8917
219 Ga0207671_10272254 3300025914 Bacteria 1334
220 Ga0207660_10000805 3300025917 Bacteria 20711
221 Ga0207662_10212599 3300025918 Bacteria 1256
222 Ga0207657_10053724 3300025919 Bacteria 3488
223 Ga0207652_10000693 3300025921 Bacteria 32703
224 Ga0207681_10087668 3300025923 Bacteria 2215
225 Ga0207644_10046253 3300025931 Bacteria 3099
226 Ga0207690_10009862 3300025932 Bacteria 5673
227 Ga0207706_10250430 3300025933 Bacteria 1547
228 Ga0207706_10403040 3300025933 Unclassified 1186
229 Ga0207686_10059997 3300025934 Bacteria 2406
230 Ga0207670_10003721 3300025936 Bacteria 8096
231 Ga0207704_10029738 3300025938 Bacteria 3052
232 Ga0207665_10062918 3300025939 Bacteria 2519
233 Ga0207691_10002242 3300025940 Bacteria 18943
234 Ga0207691_10055012 3300025940 Bacteria 3628
235 Ga0207711_10001913 3300025941 Bacteria 18913
236 Ga0207711_10016267 3300025941 Bacteria 6178
237 Ga0207711_10055963 3300025941 Bacteria 3388
238 Ga0207689_10008541 3300025942 Bacteria 8928
239 Ga0207689_10119551 3300025942 Bacteria 2168
240 Ga0207689_10128672 3300025942 Bacteria 2083
241 Ga0207689_10171071 3300025942 Bacteria 1791
242 Ga0207679_10008595 3300025945 Bacteria 6509
243 Ga0207651_10101538 3300025960 Unclassified 2136
244 Ga0207712_10023830 3300025961 Bacteria 4045
245 Ga0207712_10086702 3300025961 Bacteria 2294
246 Ga0207640_10234513 3300025981 Bacteria 1414
247 Ga0207640_10351923 3300025981 Bacteria 1184
248 Ga0207640_10414262 3300025981 Unclassified 1101
249 Ga0207703_10063883 3300026035 Bacteria 3020
250 Ga0207703_10134058 3300026035 Bacteria 2142
251 Ga0207708_10000136 3300026075 Bacteria 57790
252 Ga0207702_10215909 3300026078 Bacteria 1785
253 Ga0207641_10183585 3300026088 Bacteria 1917
254 Ga0207648_10098849 3300026089 Bacteria 2555
255 Ga0207648_10153822 3300026089 Bacteria 2030
256 Ga0207676_10010667 3300026095 Bacteria 6553
257 Ga0207676_10013658 3300026095 Bacteria 5831
258 Ga0207676_10029564 3300026095 Bacteria 4104
259 Ga0207674_10000108 3300026116 Bacteria 95567
260 Ga0207674_10102827 3300026116 Bacteria 2837
261 Ga0207675_100002861 3300026118 Bacteria 16978
262 Ga0207675_100053968 3300026118 Bacteria 3749
263 Ga0207683_10141255 3300026121 Bacteria 2170
264 Ga0207428_10152038 3300027907 Unclassified 1761
265 Ga0268265_10010924 3300028380 Bacteria 6131
266 Ga0268265_10052369 3300028380 Bacteria 3087
267 Ga0268265_10077996 3300028380 Bacteria 2604
268 Ga0268265_10279448 3300028380 Bacteria 1493
269 Ga0268265_10474290 3300028380 Unclassified 1174
270 Ga0268264_10272504 3300028381 Bacteria 1582
271 Ga0268264_10400169 3300028381 Bacteria 1319
272 Ga0307408_100160244 3300031548 Unclassified 1786
273 Ga0307408_100162561 3300031548 Bacteria 1775
274 Ga0307408_100289471 3300031548 Bacteria 1367
275 Ga0307405_10044150 3300031731 Bacteria 2724
276 Ga0307410_10087195 3300031852 Bacteria 2207
277 Ga0307406_10014175 3300031901 Bacteria 4581
278 Ga0307412_10395714 3300031911 Bacteria 1123
279 Ga0307409_100142390 3300031995 Bacteria 2068
280 Ga0307416_100092525 3300032002 Archaea 2601
281 Ga0307414_10047843 3300032004 Bacteria 2946
282 Ga0307414_10287787 3300032004 Bacteria 1384
283 Ga0307415_100032565 3300032126 Bacteria 3372
284 Ga0395898_0266423 3300037466 Bacteria 1634
285 Ga0495621_0002020 3300046539 Bacteria 5355
286 Ga0496112_0180513 3300048915 Unclassified 2075
287 Ga0496112_0199867 3300048915 Bacteria 1959
288 Ga0496112_0284913 3300048915 Unclassified 1599
289 Ga0501292_018327 3300049515 Unclassified 1113
290 Ga0501296_000390 3300049519 Bacteria 4374
291 Ga0501038_0032035 3300049574 Bacteria 4642
292 Ga0501202_028344 3300049652 Bacteria 1155
293 Ga0501209_020055 3300049656 Unclassified 1570
294 Ga0501216_000927 3300049660 Bacteria 3727
295 Ga0501217_014225 3300049661 Bacteria 1794
296 Ga0501223_012199 3300049663 Unclassified 1720
297 Ga0501235_016982 3300049669 Bacteria 1609
298 Ga0501249_016311 3300049679 Unclassified 1595
299 Ga0501257_016259 3300049686 Bacteria 1725
300 Ga0501225_0038321 3300049705 Unclassified 1321
301 Ga0501212_005605 3300049851 Unclassified 1664
302 nmdc:mga05p37_1015172_c1 3300050507 Unclassified 879
303 nmdc:mga05p37_110_c1 3300050507 Bacteria 74328
304 nmdc:mga05p37_220455_c1 3300050507 Bacteria 2289
305 nmdc:mga05p37_373941_c1 3300050507 Bacteria 1671
306 nmdc:mga05p37_383886_c1 3300050507 Bacteria 1645
307 nmdc:mga05p37_56800_c1 3300050507 Bacteria 4819
308 nmdc:mga09592_681219_c1 3300050508 Bacteria 876
309 nmdc:mga0qj67_41757_c1 3300050509 Bacteria 3609
310 nmdc:mga08y16_146514_c1 3300050511 Bacteria 2455
311 nmdc:mga0n895_168780_c1 3300050512 Bacteria 2220
312 nmdc:mga0n895_319575_c1 3300050512 Bacteria 1573
313 nmdc:mga0n895_506114_c1 3300050512 Unclassified 1216
314 nmdc:mga0rr50_253075_c1 3300050513 Bacteria 1463
315 nmdc:mga0a205_117533_c1 3300050515 Bacteria 2557
316 nmdc:mga0a205_45013_c1 3300050515 Bacteria 4256
317 nmdc:mga0a205_6976_c1 3300050515 Bacteria 10214
318 nmdc:mga0a205_7280_c1 3300050515 Bacteria 10011
319 Ga0501084_0322911 3300054114 Unclassified 1304

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005365 Ga0070688_100064087 Ga0070688_1000640873 275
2 3300005457 Ga0070662_100182768 Ga0070662_1001827682 275
3 3300006844 Ga0075428_100221329 Ga0075428_1002213292 275
4 3300014745 Ga0157377_10201325 Ga0157377_102013251 275
5 3300005353 Ga0070669_100383437 Ga0070669_1003834371 276
6 3300009094 Ga0111539_10178513 Ga0111539_101785133 276
7 3300009147 Ga0114129_10007779 Ga0114129_100077793 276
8 3300009177 Ga0105248_10014676 Ga0105248_100146768 276
9 3300049669 Ga0501235_016982 Ga0501235_016982_734_1564 276
10 3300050507 nmdc:mga05p37_1015172_c1 nmdc:mga05p37_1015172_c1_27_857 276
11 3300050507 nmdc:mga05p37_383886_c1 nmdc:mga05p37_383886_c1_694_1527 276
12 3300050508 nmdc:mga09592_681219_c1 nmdc:mga09592_681219_c1_24_857 276
13 3300050512 nmdc:mga0n895_506114_c1 nmdc:mga0n895_506114_c1_332_1165 276
14 3300005445 Ga0070708_100018609 Ga0070708_1000186092 280
15 3300006846 Ga0075430_100037696 Ga0075430_1000376964 291
16 3300009147 Ga0114129_10418631 Ga0114129_104186312 291
17 3300050509 nmdc:mga0qj67_41757_c1 nmdc:mga0qj67_41757_c1_865_1803 291
18 3300005549 Ga0070704_100335032 Ga0070704_1003350322 292
19 3300014326 Ga0157380_10026345 Ga0157380_100263453 294
20 3300025941 Ga0207711_10055963 Ga0207711_100559632 298
21 3300006852 Ga0075433_10020508 Ga0075433_100205084 299
22 3300009147 Ga0114129_10120739 Ga0114129_101207393 299
23 3300013297 Ga0157378_10286527 Ga0157378_102865272 299
24 3300050507 nmdc:mga05p37_56800_c1 nmdc:mga05p37_56800_c1_2975_3874 299
25 3300050515 nmdc:mga0a205_7280_c1 nmdc:mga0a205_7280_c1_3110_4009 299
26 3300005328 Ga0070676_10180436 Ga0070676_101804362 301
27 3300005330 Ga0070690_100014703 Ga0070690_1000147032 301
28 3300005353 Ga0070669_100128391 Ga0070669_1001283912 301
29 3300005438 Ga0070701_10014226 Ga0070701_100142264 301
30 3300005444 Ga0070694_100155578 Ga0070694_1001555782 301
31 3300005457 Ga0070662_100360739 Ga0070662_1003607392 301
32 3300025907 Ga0207645_10313368 Ga0207645_103133681 301
33 3300025923 Ga0207681_10087668 Ga0207681_100876682 301
34 3300025933 Ga0207706_10403040 Ga0207706_104030401 301
35 3300028380 Ga0268265_10077996 Ga0268265_100779962 301
36 3300046539 Ga0495621_0002020 Ga0495621_0002020_177_1124 301
37 3300005353 Ga0070669_100269849 Ga0070669_1002698492 302
38 3300013297 Ga0157378_10358697 Ga0157378_103586972 303
39 3300049656 Ga0501209_020055 Ga0501209_020055_292_1203 303
40 3300005617 Ga0068859_100016738 Ga0068859_1000167383 309
41 3300006931 Ga0097620_100016738 Ga0097620_1000167383 309
42 3300009174 Ga0105241_10112502 Ga0105241_101125022 309
43 3300025911 Ga0207654_10087325 Ga0207654_100873252 309
44 3300025961 Ga0207712_10023830 Ga0207712_100238302 309
45 3300025981 Ga0207640_10414262 Ga0207640_104142621 309
46 3300031548 Ga0307408_100162561 Ga0307408_1001625612 309
47 3300048915 Ga0496112_0180513 Ga0496112_0180513_217_1146 309
48 3300049679 Ga0501249_016311 Ga0501249_016311_632_1561 309
49 3300049705 Ga0501225_0038321 Ga0501225_0038321_368_1297 309
50 3300005293 Ga0065715_10091098 Ga0065715_100910985 310
51 3300005334 Ga0068869_100162316 Ga0068869_1001623162 310
52 3300005336 Ga0070680_100002850 Ga0070680_10000285010 310
53 3300005441 Ga0070700_100166134 Ga0070700_1001661342 310
54 3300005458 Ga0070681_10000700 Ga0070681_1000070015 310
55 3300005467 Ga0070706_100000128 Ga0070706_10000012837 310
56 3300005468 Ga0070707_100353728 Ga0070707_1003537282 310
57 3300005530 Ga0070679_100000642 Ga0070679_10000064215 310
58 3300005546 Ga0070696_100099490 Ga0070696_1000994902 310
59 3300005547 Ga0070693_100099570 Ga0070693_1000995701 310
60 3300005614 Ga0068856_100196124 Ga0068856_1001961242 310
61 3300005617 Ga0068859_100044506 Ga0068859_1000445063 310
62 3300005618 Ga0068864_100013767 Ga0068864_1000137673 310
63 3300005618 Ga0068864_100443792 Ga0068864_1004437922 310
64 3300005842 Ga0068858_100037776 Ga0068858_1000377762 310
65 3300005844 Ga0068862_100013543 Ga0068862_1000135436 310
66 3300006237 Ga0097621_100017214 Ga0097621_1000172144 310
67 3300006358 Ga0068871_100006350 Ga0068871_1000063506 310
68 3300006852 Ga0075433_10048250 Ga0075433_100482505 310
69 3300006852 Ga0075433_10281337 Ga0075433_102813371 310
70 3300006871 Ga0075434_100118544 Ga0075434_1001185442 310
71 3300006881 Ga0068865_100083674 Ga0068865_1000836742 310
72 3300006914 Ga0075436_100074838 Ga0075436_1000748381 310
73 3300006931 Ga0097620_100044505 Ga0097620_1000445053 310
74 3300009093 Ga0105240_10287387 Ga0105240_102873871 310
75 3300009147 Ga0114129_10023888 Ga0114129_100238884 310
76 3300009147 Ga0114129_10029927 Ga0114129_100299274 310
77 3300009177 Ga0105248_10003128 Ga0105248_1000312813 310
78 3300009545 Ga0105237_10161697 Ga0105237_101616972 310
79 3300013296 Ga0157374_10011073 Ga0157374_100110733 310
80 3300013297 Ga0157378_10010524 Ga0157378_100105244 310
81 3300013306 Ga0163162_10005870 Ga0163162_100058707 310
82 3300013307 Ga0157372_10015855 Ga0157372_100158552 310
83 3300013308 Ga0157375_10005682 Ga0157375_100056824 310
84 3300013308 Ga0157375_10217328 Ga0157375_102173282 310
85 3300014325 Ga0163163_10002079 Ga0163163_1000207911 310
86 3300014325 Ga0163163_10147937 Ga0163163_101479372 310
87 3300014326 Ga0157380_10424638 Ga0157380_104246382 310
88 3300014969 Ga0157376_10046695 Ga0157376_100466953 310
89 3300025903 Ga0207680_10018777 Ga0207680_100187774 310
90 3300025910 Ga0207684_10000150 Ga0207684_1000015037 310
91 3300025911 Ga0207654_10077825 Ga0207654_100778252 310
92 3300025912 Ga0207707_10000016 Ga0207707_1000001673 310
93 3300025914 Ga0207671_10272254 Ga0207671_102722541 310
94 3300025917 Ga0207660_10000805 Ga0207660_100008052 310
95 3300025921 Ga0207652_10000693 Ga0207652_1000069329 310
96 3300025942 Ga0207689_10128672 Ga0207689_101286722 310
97 3300025942 Ga0207689_10171071 Ga0207689_101710712 310
98 3300025961 Ga0207712_10086702 Ga0207712_100867022 310
99 3300026035 Ga0207703_10063883 Ga0207703_100638832 310
100 3300026078 Ga0207702_10215909 Ga0207702_102159092 310
101 3300026095 Ga0207676_10029564 Ga0207676_100295642 310
102 3300037466 Ga0395898_0266423 Ga0395898_0266423_526_1464 310
103 3300048915 Ga0496112_0199867 Ga0496112_0199867_610_1545 310
104 3300050507 nmdc:mga05p37_110_c1 nmdc:mga05p37_110_c1_73088_74023 310
105 3300050512 nmdc:mga0n895_319575_c1 nmdc:mga0n895_319575_c1_101_1033 310
106 3300050513 nmdc:mga0rr50_253075_c1 nmdc:mga0rr50_253075_c1_70_1002 310
107 3300050515 nmdc:mga0a205_117533_c1 nmdc:mga0a205_117533_c1_517_1449 310
108 3300050515 nmdc:mga0a205_6976_c1 nmdc:mga0a205_6976_c1_5045_5980 310
109 3300005288 Ga0065714_10064422 Ga0065714_1006442294 311
110 3300005290 Ga0065712_10067728 Ga0065712_1006772871 311
111 3300005293 Ga0065715_10027932 Ga0065715_100279322 311
112 3300005293 Ga0065715_10089181 Ga0065715_1008918110 311
113 3300005330 Ga0070690_100203978 Ga0070690_1002039781 311
114 3300005336 Ga0070680_100005198 Ga0070680_1000051985 311
115 3300005339 Ga0070660_100034097 Ga0070660_1000340973 311
116 3300005340 Ga0070689_100012461 Ga0070689_1000124616 311
117 3300005355 Ga0070671_100003204 Ga0070671_1000032046 311
118 3300005366 Ga0070659_100004483 Ga0070659_1000044835 311
119 3300005457 Ga0070662_100204448 Ga0070662_1002044482 311
120 3300005458 Ga0070681_10010288 Ga0070681_100102888 311
121 3300005530 Ga0070679_100012040 Ga0070679_1000120402 311
122 3300005563 Ga0068855_100207806 Ga0068855_1002078062 311
123 3300005564 Ga0070664_100002675 Ga0070664_1000026758 311
124 3300005577 Ga0068857_100002660 Ga0068857_1000026604 311
125 3300005618 Ga0068864_100017837 Ga0068864_1000178375 311
126 3300005841 Ga0068863_100430367 Ga0068863_1004303672 311
127 3300006358 Ga0068871_100035979 Ga0068871_1000359793 311
128 3300006358 Ga0068871_100341237 Ga0068871_1003412372 311
129 3300009147 Ga0114129_10275656 Ga0114129_102756562 311
130 3300009148 Ga0105243_10015041 Ga0105243_100150414 311
131 3300013297 Ga0157378_10507300 Ga0157378_105073001 311
132 3300013306 Ga0163162_10012429 Ga0163162_100124295 311
133 3300013306 Ga0163162_10012948 Ga0163162_100129482 311
134 3300013307 Ga0157372_10084737 Ga0157372_100847372 311
135 3300013308 Ga0157375_10040652 Ga0157375_100406525 311
136 3300014325 Ga0163163_10043672 Ga0163163_100436722 311
137 3300014325 Ga0163163_10087954 Ga0163163_100879543 311
138 3300014326 Ga0157380_10075575 Ga0157380_100755751 311
139 3300014969 Ga0157376_10498537 Ga0157376_104985371 311
140 3300017792 Ga0163161_10042531 Ga0163161_100425311 311
141 3300025315 Ga0207697_10041301 Ga0207697_100413011 311
142 3300025912 Ga0207707_10035492 Ga0207707_100354923 311
143 3300025919 Ga0207657_10053724 Ga0207657_100537242 311
144 3300025931 Ga0207644_10046253 Ga0207644_100462533 311
145 3300025932 Ga0207690_10009862 Ga0207690_100098625 311
146 3300025933 Ga0207706_10250430 Ga0207706_102504302 311
147 3300025942 Ga0207689_10008541 Ga0207689_100085418 311
148 3300025945 Ga0207679_10008595 Ga0207679_100085954 311
149 3300026035 Ga0207703_10134058 Ga0207703_101340582 311
150 3300026116 Ga0207674_10000108 Ga0207674_1000010839 311
151 3300026118 Ga0207675_100002861 Ga0207675_1000028619 311
152 3300028380 Ga0268265_10279448 Ga0268265_102794481 311
153 3300054114 Ga0501084_0322911 Ga0501084_0322911_176_1111 311
154 3300003322 rootL2_10166221 rootL2_101662212 312
155 3300005289 Ga0065704_10078636 Ga0065704_100786363 312
156 3300005293 Ga0065715_10093104 Ga0065715_100931042 312
157 3300005295 Ga0065707_10096099 Ga0065707_100960993 312
158 3300005330 Ga0070690_100091094 Ga0070690_1000910942 312
159 3300005331 Ga0070670_100075477 Ga0070670_1000754772 312
160 3300005331 Ga0070670_100095381 Ga0070670_1000953811 312
161 3300005335 Ga0070666_10012220 Ga0070666_100122202 312
162 3300005337 Ga0070682_100001724 Ga0070682_10000172410 312
163 3300005340 Ga0070689_100000720 Ga0070689_10000072019 312
164 3300005343 Ga0070687_100031874 Ga0070687_1000318742 312
165 3300005345 Ga0070692_10005216 Ga0070692_100052162 312
166 3300005345 Ga0070692_10036477 Ga0070692_100364772 312
167 3300005345 Ga0070692_10051958 Ga0070692_100519582 312
168 3300005345 Ga0070692_10087425 Ga0070692_100874252 312
169 3300005353 Ga0070669_100008136 Ga0070669_1000081365 312
170 3300005355 Ga0070671_100019988 Ga0070671_1000199883 312
171 3300005367 Ga0070667_100159955 Ga0070667_1001599551 312
172 3300005438 Ga0070701_10028785 Ga0070701_100287852 312
173 3300005438 Ga0070701_10167164 Ga0070701_101671642 312
174 3300005440 Ga0070705_100003682 Ga0070705_1000036822 312
175 3300005441 Ga0070700_100000291 Ga0070700_1000002919 312
176 3300005441 Ga0070700_100005275 Ga0070700_1000052755 312
177 3300005441 Ga0070700_100025747 Ga0070700_1000257472 312
178 3300005441 Ga0070700_100175386 Ga0070700_1001753862 312
179 3300005444 Ga0070694_100002496 Ga0070694_1000024963 312
180 3300005444 Ga0070694_100024284 Ga0070694_1000242843 312
181 3300005444 Ga0070694_100066313 Ga0070694_1000663132 312
182 3300005456 Ga0070678_100084560 Ga0070678_1000845601 312
183 3300005458 Ga0070681_10249300 Ga0070681_102493002 312
184 3300005471 Ga0070698_100033849 Ga0070698_1000338493 312
185 3300005518 Ga0070699_100034016 Ga0070699_1000340164 312
186 3300005518 Ga0070699_100132437 Ga0070699_1001324373 312
187 3300005536 Ga0070697_100000262 Ga0070697_10000026216 312
188 3300005539 Ga0068853_100479630 Ga0068853_1004796302 312
189 3300005543 Ga0070672_100035270 Ga0070672_1000352702 312
190 3300005544 Ga0070686_100016347 Ga0070686_1000163474 312
191 3300005544 Ga0070686_100029185 Ga0070686_1000291852 312
192 3300005545 Ga0070695_100183062 Ga0070695_1001830623 312
193 3300005546 Ga0070696_100232322 Ga0070696_1002323222 312
194 3300005547 Ga0070693_100004948 Ga0070693_1000049481 312
195 3300005547 Ga0070693_100006924 Ga0070693_1000069243 312
196 3300005547 Ga0070693_100022800 Ga0070693_1000228002 312
197 3300005547 Ga0070693_100213817 Ga0070693_1002138171 312
198 3300005549 Ga0070704_100026978 Ga0070704_1000269782 312
199 3300005549 Ga0070704_100127038 Ga0070704_1001270382 312
200 3300005549 Ga0070704_100426535 Ga0070704_1004265351 312
201 3300005564 Ga0070664_100105455 Ga0070664_1001054553 312
202 3300005564 Ga0070664_100300974 Ga0070664_1003009742 312
203 3300005578 Ga0068854_100210467 Ga0068854_1002104672 312
204 3300005578 Ga0068854_100361993 Ga0068854_1003619931 312
205 3300005615 Ga0070702_100011205 Ga0070702_1000112052 312
206 3300005615 Ga0070702_100083982 Ga0070702_1000839822 312
207 3300005615 Ga0070702_100251369 Ga0070702_1002513691 312
208 3300005616 Ga0068852_100088799 Ga0068852_1000887994 312
209 3300005617 Ga0068859_100004145 Ga0068859_10000414511 312
210 3300005617 Ga0068859_100022296 Ga0068859_1000222966 312
211 3300005617 Ga0068859_100226933 Ga0068859_1002269332 312
212 3300005618 Ga0068864_100040297 Ga0068864_1000402973 312
213 3300005618 Ga0068864_100179946 Ga0068864_1001799461 312
214 3300005618 Ga0068864_100341355 Ga0068864_1003413551 312
215 3300005834 Ga0068851_10024465 Ga0068851_100244652 312
216 3300005841 Ga0068863_100061505 Ga0068863_1000615052 312
217 3300005841 Ga0068863_100073674 Ga0068863_1000736742 312
218 3300005842 Ga0068858_100075119 Ga0068858_1000751192 312
219 3300005842 Ga0068858_100145386 Ga0068858_1001453864 312
220 3300005842 Ga0068858_100265945 Ga0068858_1002659452 312
221 3300005843 Ga0068860_100280238 Ga0068860_1002802382 312
222 3300005844 Ga0068862_100109686 Ga0068862_1001096862 312
223 3300005985 Ga0081539_10000586 Ga0081539_1000058623 312
224 3300006173 Ga0070716_100012130 Ga0070716_1000121303 312
225 3300006237 Ga0097621_100003183 Ga0097621_1000031832 312
226 3300006852 Ga0075433_10061728 Ga0075433_100617284 312
227 3300006852 Ga0075433_10136519 Ga0075433_101365192 312
228 3300006871 Ga0075434_100069215 Ga0075434_1000692154 312
229 3300006881 Ga0068865_100011711 Ga0068865_1000117114 312
230 3300006914 Ga0075436_100015866 Ga0075436_1000158663 312
231 3300006931 Ga0097620_100004145 Ga0097620_10000414511 312
232 3300006931 Ga0097620_100022295 Ga0097620_1000222952 312
233 3300006931 Ga0097620_100226934 Ga0097620_1002269342 312
234 3300009093 Ga0105240_10061463 Ga0105240_100614632 312
235 3300009094 Ga0111539_10007238 Ga0111539_100072389 312
236 3300009094 Ga0111539_10049305 Ga0111539_100493054 312
237 3300009094 Ga0111539_10792732 Ga0111539_107927321 312
238 3300009098 Ga0105245_10083111 Ga0105245_100831111 312
239 3300009147 Ga0114129_10082186 Ga0114129_100821865 312
240 3300009147 Ga0114129_10574742 Ga0114129_105747421 312
241 3300009148 Ga0105243_10257100 Ga0105243_102571002 312
242 3300009177 Ga0105248_10003793 Ga0105248_100037937 312
243 3300009177 Ga0105248_10032230 Ga0105248_100322303 312
244 3300009177 Ga0105248_10626106 Ga0105248_106261061 312
245 3300009545 Ga0105237_10000502 Ga0105237_1000050231 312
246 3300009553 Ga0105249_10080485 Ga0105249_100804853 312
247 3300011119 Ga0105246_10111158 Ga0105246_101111582 312
248 3300011119 Ga0105246_10145850 Ga0105246_101458502 312
249 3300013100 Ga0157373_10006310 Ga0157373_100063102 312
250 3300013100 Ga0157373_10184164 Ga0157373_101841642 312
251 3300013297 Ga0157378_10250899 Ga0157378_102508992 312
252 3300013297 Ga0157378_10480666 Ga0157378_104806662 312
253 3300013306 Ga0163162_10010913 Ga0163162_100109135 312
254 3300013306 Ga0163162_10034545 Ga0163162_100345453 312
255 3300013306 Ga0163162_10138764 Ga0163162_101387642 312
256 3300013307 Ga0157372_10068831 Ga0157372_100688312 312
257 3300013308 Ga0157375_10015175 Ga0157375_100151755 312
258 3300013308 Ga0157375_10762821 Ga0157375_107628212 312
259 3300014326 Ga0157380_10049772 Ga0157380_100497723 312
260 3300014326 Ga0157380_10192955 Ga0157380_101929552 312
261 3300014326 Ga0157380_10447272 Ga0157380_104472722 312
262 3300025321 Ga0207656_10015419 Ga0207656_100154192 312
263 3300025908 Ga0207643_10003403 Ga0207643_100034032 312
264 3300025911 Ga0207654_10098571 Ga0207654_100985712 312
265 3300025914 Ga0207671_10008181 Ga0207671_100081812 312
266 3300025918 Ga0207662_10212599 Ga0207662_102125991 312
267 3300025934 Ga0207686_10059997 Ga0207686_100599972 312
268 3300025936 Ga0207670_10003721 Ga0207670_100037211 312
269 3300025938 Ga0207704_10029738 Ga0207704_100297383 312
270 3300025939 Ga0207665_10062918 Ga0207665_100629182 312
271 3300025940 Ga0207691_10002242 Ga0207691_1000224216 312
272 3300025940 Ga0207691_10055012 Ga0207691_100550122 312
273 3300025941 Ga0207711_10001913 Ga0207711_100019134 312
274 3300025941 Ga0207711_10016267 Ga0207711_100162671 312
275 3300025942 Ga0207689_10119551 Ga0207689_101195512 312
276 3300025960 Ga0207651_10101538 Ga0207651_101015382 312
277 3300025981 Ga0207640_10234513 Ga0207640_102345132 312
278 3300025981 Ga0207640_10351923 Ga0207640_103519231 312
279 3300026075 Ga0207708_10000136 Ga0207708_1000013647 312
280 3300026088 Ga0207641_10183585 Ga0207641_101835852 312
281 3300026089 Ga0207648_10098849 Ga0207648_100988493 312
282 3300026089 Ga0207648_10153822 Ga0207648_101538222 312
283 3300026095 Ga0207676_10010667 Ga0207676_100106674 312
284 3300026095 Ga0207676_10013658 Ga0207676_100136585 312
285 3300026116 Ga0207674_10102827 Ga0207674_101028272 312
286 3300026118 Ga0207675_100053968 Ga0207675_1000539683 312
287 3300026121 Ga0207683_10141255 Ga0207683_101412551 312
288 3300027907 Ga0207428_10152038 Ga0207428_101520382 312
289 3300028380 Ga0268265_10010924 Ga0268265_100109245 312
290 3300028380 Ga0268265_10052369 Ga0268265_100523691 312
291 3300028380 Ga0268265_10474290 Ga0268265_104742901 312
292 3300028381 Ga0268264_10272504 Ga0268264_102725041 312
293 3300028381 Ga0268264_10400169 Ga0268264_104001692 312
294 3300031548 Ga0307408_100160244 Ga0307408_1001602442 312
295 3300031548 Ga0307408_100289471 Ga0307408_1002894712 312
296 3300031731 Ga0307405_10044150 Ga0307405_100441502 312
297 3300031852 Ga0307410_10087195 Ga0307410_100871951 312
298 3300031901 Ga0307406_10014175 Ga0307406_100141753 312
299 3300031911 Ga0307412_10395714 Ga0307412_103957141 312
300 3300031995 Ga0307409_100142390 Ga0307409_1001423903 312
301 3300032002 Ga0307416_100092525 Ga0307416_1000925253 312
302 3300032004 Ga0307414_10047843 Ga0307414_100478432 312
303 3300032004 Ga0307414_10287787 Ga0307414_102877872 312
304 3300032126 Ga0307415_100032565 Ga0307415_1000325652 312
305 3300048915 Ga0496112_0284913 Ga0496112_0284913_540_1481 312
306 3300049515 Ga0501292_018327 Ga0501292_018327_63_1004 312
307 3300049519 Ga0501296_000390 Ga0501296_000390_1647_2585 312
308 3300049574 Ga0501038_0032035 Ga0501038_0032035_2669_3607 312
309 3300049652 Ga0501202_028344 Ga0501202_028344_171_1112 312
310 3300049660 Ga0501216_000927 Ga0501216_000927_2299_3240 312
311 3300049661 Ga0501217_014225 Ga0501217_014225_816_1754 312
312 3300049663 Ga0501223_012199 Ga0501223_012199_106_1047 312
313 3300049686 Ga0501257_016259 Ga0501257_016259_79_1020 312
314 3300049851 Ga0501212_005605 Ga0501212_005605_253_1194 312
315 3300050507 nmdc:mga05p37_220455_c1 nmdc:mga05p37_220455_c1_378_1316 312
316 3300050507 nmdc:mga05p37_373941_c1 nmdc:mga05p37_373941_c1_239_1180 312
317 3300050511 nmdc:mga08y16_146514_c1 nmdc:mga08y16_146514_c1_868_1806 312
318 3300050512 nmdc:mga0n895_168780_c1 nmdc:mga0n895_168780_c1_253_1194 312
319 3300050515 nmdc:mga0a205_45013_c1 nmdc:mga0a205_45013_c1_2349_3287 312

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

51

192

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hm9-assembly1.cif.gz_A crystal structure of a ba3943 mutant,a ce4 family pseudoenzyme with restored enzymatic activity. 0.8563 30 259
6hpa-assembly1.cif.gz_A crystal structure of a ba3943 mutant,a ce4 family pseudoenzyme 0.8276 30 259
7bkf-assembly1.cif.gz_A crystal structure of wt ba3943, a ce4 family pseudoenzyme from bacillus anthracis 0.8168 30 259
7y51-assembly1.cif.gz_A-2 acetylxylan esterase from caldanaerobacter subterraneus subsp. tengcongensis tte0866 delta100 mutant 0.7843 31 260
2c1g-assembly1.cif.gz_A structure of streptococcus pneumoniae peptidoglycan deacetylase (sppgda) 0.7833 28 258
ID Description Score Start End Superfamily
af_O53444_35_232_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8198 30 261 3.20.20.370
2y8uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7796 27 259 3.20.20.370
2j13A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7744 30 259 3.20.20.370
2c1iA03 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7718 33 258 3.20.20.370
af_O53444_35_232_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7704 30 261 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A059X0U7-F1-model_v4 Polysaccharide deacetylase 0.9757 34 312 GO:0005975
GO:0016020
GO:0016810
AF-A0A0D8DFF5-F1-model_v4 deleted 0.9737 51 312
AF-A0A497Z4W6-F1-model_v4 deleted 0.9733 26 312
AF-A0A495LZG3-F1-model_v4 Polysaccharide deacetylase 0.9724 24 309 GO:0005975
GO:0016020
GO:0016810
AF-A0A1G0R7M7-F1-model_v4 NodB homology domain-containing protein 0.9722 57 312 GO:0005975
GO:0016020
GO:0016810

Feature Viewer

pLDDT pTM Quality
88.39 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map