F404966

General Info

Members Datasets Scaffolds Average Seq Length
319 190 638 75

Family's Representative Sequence

Representative Sequence 3300005438|Ga0070701_10257971|Ga0070701_102579712
Length 80
Sequence MPIEITATKDGPYKVKGDLSELTLLDPSGNAYDLTGKKAVFLCRCGGSTTKPFCDGTHSRIGFQAAEAAVPSSEDRPATP

Samples

Sample ID Description Type Environment
1 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
134 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
135 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
136 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
137 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
138 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
139 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
140 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
141 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
142 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
145 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
146 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
147 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
151 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
152 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
153 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
154 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
160 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
173 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.19
Nodule 0
Rhizoplane 2.51
Rhizosphere 95.3
Stem 0
Stem Tuber 0
Unclassified 7.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070701_10257971 3300005438 Bacteria 1055
2 SwRhRL2b_contig_3643838 2162886007 Unclassified 1019
3 Ga0065704_10079105 3300005289 Unclassified 4255
4 Ga0065715_10095942 3300005293 Bacteria 3976
5 Ga0065707_10196681 3300005295 Bacteria 1332
6 Ga0070690_101163197 3300005330 Bacteria 614
7 Ga0070677_10358356 3300005333 Bacteria 758
8 Ga0068869_100492446 3300005334 Bacteria 1022
9 Ga0068869_101255285 3300005334 Bacteria 652
10 Ga0070666_10113048 3300005335 Bacteria 1879
11 Ga0070666_10259991 3300005335 Bacteria 1230
12 Ga0070666_10480882 3300005335 Bacteria 899
13 Ga0070682_102004777 3300005337 Bacteria 509
14 Ga0068868_100004525 3300005338 Bacteria 9757
15 Ga0068868_100224175 3300005338 Bacteria 1575
16 Ga0070689_101550908 3300005340 Bacteria 601
17 Ga0070691_10093704 3300005341 Bacteria 1484
18 Ga0070692_10121178 3300005345 Bacteria 1459
19 Ga0070692_10385063 3300005345 Bacteria 881
20 Ga0070668_101656417 3300005347 Bacteria 587
21 Ga0070675_100000134 3300005354 Bacteria 44325
22 Ga0070675_100973727 3300005354 Bacteria 779
23 Ga0070671_100923962 3300005355 Bacteria 763
24 Ga0070674_100405602 3300005356 Bacteria 1115
25 Ga0070674_100792521 3300005356 Bacteria 818
26 Ga0070673_100146184 3300005364 Bacteria 1998
27 Ga0070673_101122726 3300005364 Bacteria 735
28 Ga0070701_10010453 3300005438 Bacteria 4104
29 Ga0070701_10317659 3300005438 Bacteria 963
30 Ga0070701_10845842 3300005438 Bacteria 628
31 Ga0070705_100184935 3300005440 Bacteria 1415
32 Ga0070705_100213785 3300005440 Unclassified 1331
33 Ga0070705_100431380 3300005440 Bacteria 984
34 Ga0070700_100999103 3300005441 Bacteria 688
35 Ga0070694_100077643 3300005444 Bacteria 2301
36 Ga0070694_100221731 3300005444 Bacteria 1418
37 Ga0070694_100303416 3300005444 Bacteria 1224
38 Ga0070662_100541187 3300005457 Bacteria 975
39 Ga0068867_100011213 3300005459 Bacteria 6322
40 Ga0068867_100043869 3300005459 Bacteria 3274
41 Ga0068867_101470481 3300005459 Bacteria 634
42 Ga0068867_101712210 3300005459 Bacteria 590
43 Ga0070685_10268316 3300005466 Bacteria 1138
44 Ga0070707_100228463 3300005468 Bacteria 1812
45 Ga0070707_101048963 3300005468 Bacteria 781
46 Ga0070698_100756531 3300005471 Bacteria 915
47 Ga0070699_101805071 3300005518 Bacteria 560
48 Ga0070697_100010261 3300005536 Bacteria 7299
49 Ga0070697_101098990 3300005536 Bacteria 708
50 Ga0070697_101343185 3300005536 Unclassified 638
51 Ga0070697_102105904 3300005536 Unclassified 505
52 Ga0070686_100179605 3300005544 Bacteria 1503
53 Ga0070686_101928267 3300005544 Bacteria 504
54 Ga0070695_100484180 3300005545 Unclassified 954
55 Ga0070695_101060446 3300005545 Bacteria 662
56 Ga0070696_100505675 3300005546 Bacteria 962
57 Ga0070665_100107360 3300005548 Bacteria 2794
58 Ga0070704_100006526 3300005549 Bacteria 6880
59 Ga0070704_100039721 3300005549 Bacteria 3232
60 Ga0070704_100398581 3300005549 Unclassified 1174
61 Ga0068855_101087014 3300005563 Bacteria 837
62 Ga0070664_100779426 3300005564 Bacteria 893
63 Ga0068854_101308331 3300005578 Bacteria 653
64 Ga0070702_100232843 3300005615 Bacteria 1239
65 Ga0068859_100009273 3300005617 Bacteria 9936
66 Ga0068859_101927073 3300005617 Bacteria 652
67 Ga0068864_100161524 3300005618 Bacteria 2037
68 Ga0068864_102262177 3300005618 Bacteria 550
69 Ga0068866_10006112 3300005718 Bacteria 5009
70 Ga0068861_100689448 3300005719 Bacteria 948
71 Ga0068861_100794321 3300005719 Bacteria 888
72 Ga0068861_100797770 3300005719 Bacteria 886
73 Ga0068870_10414672 3300005840 Bacteria 880
74 Ga0068863_100268559 3300005841 Bacteria 1651
75 Ga0068863_100422655 3300005841 Bacteria 1306
76 Ga0068858_100162233 3300005842 Bacteria 2105
77 Ga0068860_102001394 3300005843 Bacteria 601
78 Ga0068860_102109490 3300005843 Bacteria 585
79 Ga0068862_100457065 3300005844 Bacteria 1205
80 Ga0068862_100952283 3300005844 Bacteria 847
81 Ga0068862_101671685 3300005844 Bacteria 645
82 Ga0075368_10305323 3300006042 Bacteria 687
83 Ga0075367_10429937 3300006178 Unclassified 836
84 Ga0075366_10102923 3300006195 Bacteria 1715
85 Ga0097621_100003857 3300006237 Bacteria 10384
86 Ga0097621_101340743 3300006237 Bacteria 676
87 Ga0075370_10198581 3300006353 Bacteria 1183
88 Ga0068871_100013311 3300006358 Bacteria 6103
89 Ga0068871_100064895 3300006358 Bacteria 2990
90 Ga0075428_100000010 3300006844 Bacteria 213631
91 Ga0075428_100002943 3300006844 Bacteria 18557
92 Ga0075430_100948777 3300006846 Bacteria 709
93 Ga0075431_100015591 3300006847 Bacteria 7702
94 Ga0075431_100173975 3300006847 Bacteria 2212
95 Ga0075433_10232268 3300006852 Bacteria 1638
96 Ga0075434_100002119 3300006871 Bacteria 17262
97 Ga0075434_102024828 3300006871 Bacteria 581
98 Ga0075429_100026022 3300006880 Bacteria 5078
99 Ga0075429_100144463 3300006880 Bacteria 2082
100 Ga0068865_100053500 3300006881 Bacteria 2801
101 Ga0068865_100081009 3300006881 Bacteria 2330
102 Ga0097620_100009273 3300006931 Bacteria 9936
103 Ga0097620_101090918 3300006931 Bacteria 878
104 Ga0097620_101927101 3300006931 Bacteria 652
105 Ga0075435_100168417 3300007076 Bacteria 1848
106 Ga0075435_100946594 3300007076 Bacteria 752
107 Ga0105240_12384017 3300009093 Bacteria 548
108 Ga0111539_10000001 3300009094 Bacteria 1035431
109 Ga0111539_10157323 3300009094 Unclassified 2659
110 Ga0111539_10279564 3300009094 Unclassified 1942
111 Ga0105245_10025960 3300009098 Bacteria 5154
112 Ga0105245_10207431 3300009098 Bacteria 1884
113 Ga0105245_12858022 3300009098 Bacteria 535
114 Ga0114129_10008349 3300009147 Bacteria 14765
115 Ga0114129_10065142 3300009147 Bacteria 5086
116 Ga0114129_10227695 3300009147 Bacteria 2512
117 Ga0114129_11450434 3300009147 Bacteria 845
118 Ga0105243_11346761 3300009148 Bacteria 733
119 Ga0105243_11849183 3300009148 Bacteria 636
120 Ga0105242_10004931 3300009176 Bacteria 10334
121 Ga0105242_10041499 3300009176 Bacteria 3712
122 Ga0105242_10860147 3300009176 Bacteria 903
123 Ga0105242_11158518 3300009176 Bacteria 790
124 Ga0105248_10046215 3300009177 Bacteria 4879
125 Ga0105248_10194924 3300009177 Bacteria 2282
126 Ga0105248_10478153 3300009177 Bacteria 1404
127 Ga0105249_11218859 3300009553 Bacteria 824
128 Ga0105249_11851010 3300009553 Bacteria 676
129 Ga0105246_10364339 3300011119 Bacteria 1189
130 Ga0105246_10681256 3300011119 Bacteria 899
131 Ga0157374_12158399 3300013296 Bacteria 584
132 Ga0157378_10373659 3300013297 Bacteria 1398
133 Ga0157378_10824203 3300013297 Bacteria 955
134 Ga0163162_10050659 3300013306 Bacteria 4164
135 Ga0163162_11030784 3300013306 Bacteria 931
136 Ga0157375_10192343 3300013308 Bacteria 2195
137 Ga0157375_12264422 3300013308 Bacteria 648
138 Ga0163163_10154317 3300014325 Bacteria 2340
139 Ga0163163_10844663 3300014325 Bacteria 979
140 Ga0157380_10033152 3300014326 Bacteria 3977
141 Ga0157380_10267640 3300014326 Unclassified 1556
142 Ga0157380_11076731 3300014326 Bacteria 842
143 Ga0157380_11488331 3300014326 Bacteria 730
144 Ga0157380_11965117 3300014326 Bacteria 646
145 Ga0157377_10013098 3300014745 Bacteria 4189
146 Ga0157377_10695198 3300014745 Bacteria 738
147 Ga0157377_11003921 3300014745 Bacteria 632
148 Ga0157379_11039393 3300014968 Bacteria 782
149 Ga0157376_10262686 3300014969 Bacteria 1618
150 Ga0163161_10836549 3300017792 Bacteria 776
151 Ga0206353_10496583 3300020082 Unclassified 612
152 Ga0207697_10383000 3300025315 Bacteria 625
153 Ga0207653_10066464 3300025885 Bacteria 1225
154 Ga0207642_10040926 3300025899 Bacteria 2025
155 Ga0207680_10096993 3300025903 Bacteria 1887
156 Ga0207680_10220145 3300025903 Bacteria 1301
157 Ga0207680_11086445 3300025903 Bacteria 572
158 Ga0207645_10795545 3300025907 Bacteria 643
159 Ga0207643_10410490 3300025908 Bacteria 857
160 Ga0207643_10466876 3300025908 Bacteria 804
161 Ga0207654_10231689 3300025911 Bacteria 1230
162 Ga0207662_10105714 3300025918 Bacteria 1750
163 Ga0207646_10449420 3300025922 Bacteria 1163
164 Ga0207646_11000765 3300025922 Bacteria 739
165 Ga0207681_10386202 3300025923 Bacteria 1128
166 Ga0207694_11342969 3300025924 Bacteria 604
167 Ga0207659_10000363 3300025926 Bacteria 27150
168 Ga0207659_10721430 3300025926 Bacteria 854
169 Ga0207659_11435832 3300025926 Unclassified 591
170 Ga0207687_10002164 3300025927 Bacteria 13401
171 Ga0207644_10578845 3300025931 Bacteria 931
172 Ga0207706_10850664 3300025933 Bacteria 773
173 Ga0207686_10003880 3300025934 Bacteria 8021
174 Ga0207686_10005853 3300025934 Bacteria 6598
175 Ga0207686_10348285 3300025934 Bacteria 1114
176 Ga0207709_10272981 3300025935 Bacteria 1245
177 Ga0207709_10633227 3300025935 Bacteria 850
178 Ga0207669_10189565 3300025937 Bacteria 1482
179 Ga0207669_10738651 3300025937 Bacteria 812
180 Ga0207704_10022610 3300025938 Bacteria 3373
181 Ga0207704_10071398 3300025938 Bacteria 2203
182 Ga0207704_11720666 3300025938 Bacteria 539
183 Ga0207665_10525284 3300025939 Bacteria 917
184 Ga0207691_10783207 3300025940 Bacteria 802
185 Ga0207711_10112363 3300025941 Bacteria 2424
186 Ga0207711_10275854 3300025941 Bacteria 1547
187 Ga0207711_10621824 3300025941 Bacteria 1008
188 Ga0207711_11107363 3300025941 Bacteria 733
189 Ga0207689_10483531 3300025942 Bacteria 1037
190 Ga0207689_10615928 3300025942 Bacteria 914
191 Ga0207689_10901875 3300025942 Bacteria 746
192 Ga0207679_11086459 3300025945 Bacteria 734
193 Ga0207651_10065838 3300025960 Bacteria 2543
194 Ga0207651_10436988 3300025960 Bacteria 1120
195 Ga0207651_11928161 3300025960 Bacteria 531
196 Ga0207640_10006235 3300025981 Bacteria 6535
197 Ga0207677_10008065 3300026023 Bacteria 5865
198 Ga0207703_10134353 3300026035 Bacteria 2140
199 Ga0207639_10112996 3300026041 Bacteria 2218
200 Ga0207708_10125921 3300026075 Bacteria 1999
201 Ga0207708_10608453 3300026075 Bacteria 926
202 Ga0207708_12004575 3300026075 Unclassified 507
203 Ga0207641_10599384 3300026088 Bacteria 1078
204 Ga0207648_10019336 3300026089 Bacteria 6148
205 Ga0207648_10153883 3300026089 Bacteria 2030
206 Ga0207648_10791772 3300026089 Bacteria 882
207 Ga0207676_10070358 3300026095 Bacteria 2806
208 Ga0207676_12181453 3300026095 Bacteria 552
209 Ga0207675_100116226 3300026118 Bacteria 2528
210 Ga0207675_100817422 3300026118 Bacteria 946
211 Ga0207675_101176070 3300026118 Bacteria 787
212 Ga0207675_101683318 3300026118 Bacteria 654
213 Ga0207698_11464468 3300026142 Bacteria 698
214 Ga0207428_10000002 3300027907 Bacteria 854851
215 Ga0268266_10050523 3300028379 Bacteria 3568
216 Ga0268265_10537940 3300028380 Bacteria 1107
217 Ga0268265_10727696 3300028380 Bacteria 961
218 Ga0268264_10758835 3300028381 Bacteria 967
219 Ga0268264_11737767 3300028381 Bacteria 634
220 Ga0307408_100048740 3300031548 Bacteria 3039
221 Ga0307408_100698755 3300031548 Bacteria 911
222 Ga0307405_10007930 3300031731 Bacteria 5352
223 Ga0307405_10536604 3300031731 Bacteria 944
224 Ga0307405_10730058 3300031731 Bacteria 823
225 Ga0307413_10108727 3300031824 Bacteria 1851
226 Ga0307413_10330515 3300031824 Unclassified 1168
227 Ga0307410_10008420 3300031852 Bacteria 5717
228 Ga0307410_10020759 3300031852 Bacteria 4027
229 Ga0307407_10005274 3300031903 Bacteria 5589
230 Ga0307407_10297802 3300031903 Bacteria 1123
231 Ga0307407_10464411 3300031903 Bacteria 921
232 Ga0307412_10024720 3300031911 Bacteria 3711
233 Ga0307412_10682499 3300031911 Unclassified 880
234 Ga0307409_100010230 3300031995 Bacteria 5816
235 Ga0307409_100010298 3300031995 Bacteria 5803
236 Ga0307409_100919927 3300031995 Bacteria 889
237 Ga0307409_101017702 3300031995 Bacteria 847
238 Ga0307416_100008750 3300032002 Bacteria 6559
239 Ga0307416_100020061 3300032002 Bacteria 4759
240 Ga0307416_101126000 3300032002 Bacteria 890
241 Ga0307414_10047085 3300032004 Bacteria 2965
242 Ga0307414_10053496 3300032004 Bacteria 2816
243 Ga0307411_10009954 3300032005 Bacteria 5037
244 Ga0307415_100002923 3300032126 Bacteria 8570
245 Ga0373930_0000336 3300034816 Bacteria 6098
246 Ga0373959_0022954 3300034820 Bacteria 1210
247 Ga0373938_0002646 3300034957 Bacteria 2890
248 Ga0373928_0026213 3300035084 Bacteria 1261
249 Ga0373929_0005425 3300035085 Bacteria 2293
250 Ga0373940_0007199 3300035088 Bacteria 2500
251 Ga0373949_0001196 3300035090 Bacteria 7703
252 Ga0373951_0008162 3300035091 Bacteria 2371
253 Ga0373952_0001330 3300035092 Bacteria 4515
254 Ga0373932_0000924 3300035112 Bacteria 8577
255 Ga0373939_0003777 3300035114 Bacteria 3570
256 Ga0373941_0020450 3300035115 Bacteria 1855
257 Ga0373945_0281354 3300035116 Bacteria 709
258 Ga0373960_0004634 3300035121 Bacteria 3157
259 Ga0373961_0001582 3300035241 Bacteria 6496
260 Ga0373931_0001110 3300035691 Bacteria 11416
261 Ga0373931_0256511 3300035691 Bacteria 1065
262 Ga0395900_1765949 3300037418 Unclassified 529
263 Ga0439436_0103001 3300041404 Bacteria 796
264 Ga0439439_0273875 3300041406 Unclassified 504
265 Ga0439441_086353 3300042001 Bacteria 689
266 Ga0450920_076137 3300042122 Bacteria 685
267 Ga0439435_0006162 3300042436 Bacteria 2684
268 Ga0451576_0131373 3300045051 Bacteria 2610
269 Ga0451576_0202681 3300045051 Unclassified 2072
270 Ga0495580_0298235 3300046472 Unclassified 1098
271 Ga0495584_0493555 3300046491 Bacteria 624
272 Ga0495665_0562587 3300046531 Bacteria 572
273 Ga0495598_0060200 3300046537 Bacteria 1169
274 Ga0495621_0001626 3300046539 Bacteria 5873
275 Ga0495621_0090218 3300046539 Bacteria 1154
276 Ga0495656_0444135 3300046615 Bacteria 683
277 Ga0495659_0057750 3300046664 Bacteria 1426
278 Ga0495669_0042423 3300046684 Bacteria 2023
279 Ga0495669_0364737 3300046684 Bacteria 699
280 Ga0495670_0309911 3300046691 Bacteria 847
281 Ga0495677_0284239 3300047445 Unclassified 649
282 Ga0496102_0338484 3300048905 Bacteria 1417
283 Ga0496104_0098645 3300048907 Bacteria 2797
284 Ga0496105_0099082 3300048908 Bacteria 2407
285 Ga0496111_1336096 3300048914 Unclassified 504
286 Ga0496112_0860559 3300048915 Bacteria 830
287 Ga0496112_1222402 3300048915 Bacteria 668
288 Ga0496114_0104342 3300048917 Bacteria 2424
289 Ga0496114_1207884 3300048917 Bacteria 642
290 Ga0501296_080370 3300049519 Bacteria 516
291 Ga0501303_044462 3300049526 Bacteria 566
292 Ga0501040_1430918 3300049576 Bacteria 502
293 Ga0501042_0681385 3300049578 Bacteria 747
294 Ga0501048_0258574 3300049582 Bacteria 1237
295 Ga0501071_1491065 3300049587 Bacteria 522
296 Ga0501267_020247 3300049764 Bacteria 730
297 nmdc:mga0k408_127952_c1 3300050493 Bacteria 1507
298 nmdc:mga06z11_232086_c1 3300050494 Bacteria 1081
299 nmdc:mga07m45_150999_c1 3300050496 Bacteria 1347
300 nmdc:mga05p37_14470_c1 3300050507 Bacteria 9472
301 nmdc:mga05p37_196191_c1 3300050507 Bacteria 2448
302 nmdc:mga05p37_322762_c1 3300050507 Bacteria 1827
303 nmdc:mga05p37_448810_c1 3300050507 Bacteria 1493
304 nmdc:mga05p37_59260_c1 3300050507 Bacteria 4715
305 nmdc:mga09592_1027318_c1 3300050508 Unclassified 688
306 nmdc:mga09592_152793_c1 3300050508 Bacteria 1992
307 nmdc:mga09592_825086_c1 3300050508 Bacteria 783
308 nmdc:mga06r32_117838_c2 3300050510 Bacteria 2123
309 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
310 nmdc:mga08y16_809347_c1 3300050511 Unclassified 929
311 nmdc:mga0n895_241378_c1 3300050512 Bacteria 1834
312 nmdc:mga0n895_624444_c1 3300050512 Bacteria 1078
313 nmdc:mga0rr50_1186438_c1 3300050513 Bacteria 649
314 nmdc:mga0rr50_1514595_c1 3300050513 Bacteria 567
315 nmdc:mga0rr50_66654_c1 3300050513 Bacteria 2732
316 nmdc:mga08x19_973623_c1 3300050514 Bacteria 603
317 nmdc:mga0a205_113958_c1 3300050515 Bacteria 2602
318 nmdc:mga0a205_76470_c1 3300050515 Bacteria 3235
319 Ga0495595_0716699 3300053084 Unclassified 513
320 Ga0070701_10257971
321 SwRhRL2b_contig_3643838
322 Ga0065704_10079105
323 Ga0065715_10095942
324 Ga0065707_10196681
325 Ga0070690_101163197
326 Ga0070677_10358356
327 Ga0068869_100492446
328 Ga0068869_101255285
329 Ga0070666_10113048
330 Ga0070666_10259991
331 Ga0070666_10480882
332 Ga0070682_102004777
333 Ga0068868_100004525
334 Ga0068868_100224175
335 Ga0070689_101550908
336 Ga0070691_10093704
337 Ga0070692_10121178
338 Ga0070692_10385063
339 Ga0070668_101656417
340 Ga0070675_100000134
341 Ga0070675_100973727
342 Ga0070671_100923962
343 Ga0070674_100405602
344 Ga0070674_100792521
345 Ga0070673_100146184
346 Ga0070673_101122726
347 Ga0070701_10010453
348 Ga0070701_10317659
349 Ga0070701_10845842
350 Ga0070705_100184935
351 Ga0070705_100213785
352 Ga0070705_100431380
353 Ga0070700_100999103
354 Ga0070694_100077643
355 Ga0070694_100221731
356 Ga0070694_100303416
357 Ga0070662_100541187
358 Ga0068867_100011213
359 Ga0068867_100043869
360 Ga0068867_101470481
361 Ga0068867_101712210
362 Ga0070685_10268316
363 Ga0070707_100228463
364 Ga0070707_101048963
365 Ga0070698_100756531
366 Ga0070699_101805071
367 Ga0070697_100010261
368 Ga0070697_101098990
369 Ga0070697_101343185
370 Ga0070697_102105904
371 Ga0070686_100179605
372 Ga0070686_101928267
373 Ga0070695_100484180
374 Ga0070695_101060446
375 Ga0070696_100505675
376 Ga0070665_100107360
377 Ga0070704_100006526
378 Ga0070704_100039721
379 Ga0070704_100398581
380 Ga0068855_101087014
381 Ga0070664_100779426
382 Ga0068854_101308331
383 Ga0070702_100232843
384 Ga0068859_100009273
385 Ga0068859_101927073
386 Ga0068864_100161524
387 Ga0068864_102262177
388 Ga0068866_10006112
389 Ga0068861_100689448
390 Ga0068861_100794321
391 Ga0068861_100797770
392 Ga0068870_10414672
393 Ga0068863_100268559
394 Ga0068863_100422655
395 Ga0068858_100162233
396 Ga0068860_102001394
397 Ga0068860_102109490
398 Ga0068862_100457065
399 Ga0068862_100952283
400 Ga0068862_101671685
401 Ga0075368_10305323
402 Ga0075367_10429937
403 Ga0075366_10102923
404 Ga0097621_100003857
405 Ga0097621_101340743
406 Ga0075370_10198581
407 Ga0068871_100013311
408 Ga0068871_100064895
409 Ga0075428_100000010
410 Ga0075428_100002943
411 Ga0075430_100948777
412 Ga0075431_100015591
413 Ga0075431_100173975
414 Ga0075433_10232268
415 Ga0075434_100002119
416 Ga0075434_102024828
417 Ga0075429_100026022
418 Ga0075429_100144463
419 Ga0068865_100053500
420 Ga0068865_100081009
421 Ga0097620_100009273
422 Ga0097620_101090918
423 Ga0097620_101927101
424 Ga0075435_100168417
425 Ga0075435_100946594
426 Ga0105240_12384017
427 Ga0111539_10000001
428 Ga0111539_10157323
429 Ga0111539_10279564
430 Ga0105245_10025960
431 Ga0105245_10207431
432 Ga0105245_12858022
433 Ga0114129_10008349
434 Ga0114129_10065142
435 Ga0114129_10227695
436 Ga0114129_11450434
437 Ga0105243_11346761
438 Ga0105243_11849183
439 Ga0105242_10004931
440 Ga0105242_10041499
441 Ga0105242_10860147
442 Ga0105242_11158518
443 Ga0105248_10046215
444 Ga0105248_10194924
445 Ga0105248_10478153
446 Ga0105249_11218859
447 Ga0105249_11851010
448 Ga0105246_10364339
449 Ga0105246_10681256
450 Ga0157374_12158399
451 Ga0157378_10373659
452 Ga0157378_10824203
453 Ga0163162_10050659
454 Ga0163162_11030784
455 Ga0157375_10192343
456 Ga0157375_12264422
457 Ga0163163_10154317
458 Ga0163163_10844663
459 Ga0157380_10033152
460 Ga0157380_10267640
461 Ga0157380_11076731
462 Ga0157380_11488331
463 Ga0157380_11965117
464 Ga0157377_10013098
465 Ga0157377_10695198
466 Ga0157377_11003921
467 Ga0157379_11039393
468 Ga0157376_10262686
469 Ga0163161_10836549
470 Ga0206353_10496583
471 Ga0207697_10383000
472 Ga0207653_10066464
473 Ga0207642_10040926
474 Ga0207680_10096993
475 Ga0207680_10220145
476 Ga0207680_11086445
477 Ga0207645_10795545
478 Ga0207643_10410490
479 Ga0207643_10466876
480 Ga0207654_10231689
481 Ga0207662_10105714
482 Ga0207646_10449420
483 Ga0207646_11000765
484 Ga0207681_10386202
485 Ga0207694_11342969
486 Ga0207659_10000363
487 Ga0207659_10721430
488 Ga0207659_11435832
489 Ga0207687_10002164
490 Ga0207644_10578845
491 Ga0207706_10850664
492 Ga0207686_10003880
493 Ga0207686_10005853
494 Ga0207686_10348285
495 Ga0207709_10272981
496 Ga0207709_10633227
497 Ga0207669_10189565
498 Ga0207669_10738651
499 Ga0207704_10022610
500 Ga0207704_10071398
501 Ga0207704_11720666
502 Ga0207665_10525284
503 Ga0207691_10783207
504 Ga0207711_10112363
505 Ga0207711_10275854
506 Ga0207711_10621824
507 Ga0207711_11107363
508 Ga0207689_10483531
509 Ga0207689_10615928
510 Ga0207689_10901875
511 Ga0207679_11086459
512 Ga0207651_10065838
513 Ga0207651_10436988
514 Ga0207651_11928161
515 Ga0207640_10006235
516 Ga0207677_10008065
517 Ga0207703_10134353
518 Ga0207639_10112996
519 Ga0207708_10125921
520 Ga0207708_10608453
521 Ga0207708_12004575
522 Ga0207641_10599384
523 Ga0207648_10019336
524 Ga0207648_10153883
525 Ga0207648_10791772
526 Ga0207676_10070358
527 Ga0207676_12181453
528 Ga0207675_100116226
529 Ga0207675_100817422
530 Ga0207675_101176070
531 Ga0207675_101683318
532 Ga0207698_11464468
533 Ga0207428_10000002
534 Ga0268266_10050523
535 Ga0268265_10537940
536 Ga0268265_10727696
537 Ga0268264_10758835
538 Ga0268264_11737767
539 Ga0307408_100048740
540 Ga0307408_100698755
541 Ga0307405_10007930
542 Ga0307405_10536604
543 Ga0307405_10730058
544 Ga0307413_10108727
545 Ga0307413_10330515
546 Ga0307410_10008420
547 Ga0307410_10020759
548 Ga0307407_10005274
549 Ga0307407_10297802
550 Ga0307407_10464411
551 Ga0307412_10024720
552 Ga0307412_10682499
553 Ga0307409_100010230
554 Ga0307409_100010298
555 Ga0307409_100919927
556 Ga0307409_101017702
557 Ga0307416_100008750
558 Ga0307416_100020061
559 Ga0307416_101126000
560 Ga0307414_10047085
561 Ga0307414_10053496
562 Ga0307411_10009954
563 Ga0307415_100002923
564 Ga0373930_0000336
565 Ga0373959_0022954
566 Ga0373938_0002646
567 Ga0373928_0026213
568 Ga0373929_0005425
569 Ga0373940_0007199
570 Ga0373949_0001196
571 Ga0373951_0008162
572 Ga0373952_0001330
573 Ga0373932_0000924
574 Ga0373939_0003777
575 Ga0373941_0020450
576 Ga0373945_0281354
577 Ga0373960_0004634
578 Ga0373961_0001582
579 Ga0373931_0001110
580 Ga0373931_0256511
581 Ga0395900_1765949
582 Ga0439436_0103001
583 Ga0439439_0273875
584 Ga0439441_086353
585 Ga0450920_076137
586 Ga0439435_0006162
587 Ga0451576_0131373
588 Ga0451576_0202681
589 Ga0495580_0298235
590 Ga0495584_0493555
591 Ga0495665_0562587
592 Ga0495598_0060200
593 Ga0495621_0001626
594 Ga0495621_0090218
595 Ga0495656_0444135
596 Ga0495659_0057750
597 Ga0495669_0042423
598 Ga0495669_0364737
599 Ga0495670_0309911
600 Ga0495677_0284239
601 Ga0496102_0338484
602 Ga0496104_0098645
603 Ga0496105_0099082
604 Ga0496111_1336096
605 Ga0496112_0860559
606 Ga0496112_1222402
607 Ga0496114_0104342
608 Ga0496114_1207884
609 Ga0501296_080370
610 Ga0501303_044462
611 Ga0501040_1430918
612 Ga0501042_0681385
613 Ga0501048_0258574
614 Ga0501071_1491065
615 Ga0501267_020247
616 nmdc:mga0k408_127952_c1
617 nmdc:mga06z11_232086_c1
618 nmdc:mga07m45_150999_c1
619 nmdc:mga05p37_14470_c1
620 nmdc:mga05p37_196191_c1
621 nmdc:mga05p37_322762_c1
622 nmdc:mga05p37_448810_c1
623 nmdc:mga05p37_59260_c1
624 nmdc:mga09592_1027318_c1
625 nmdc:mga09592_152793_c1
626 nmdc:mga09592_825086_c1
627 nmdc:mga06r32_117838_c2
628 nmdc:mga08y16_3_c1
629 nmdc:mga08y16_809347_c1
630 nmdc:mga0n895_241378_c1
631 nmdc:mga0n895_624444_c1
632 nmdc:mga0rr50_1186438_c1
633 nmdc:mga0rr50_1514595_c1
634 nmdc:mga0rr50_66654_c1
635 nmdc:mga08x19_973623_c1
636 nmdc:mga0a205_113958_c1
637 nmdc:mga0a205_76470_c1
638 Ga0495595_0716699

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09360

zf-CDGSH

Iron-binding zinc finger CDGSH type

10

59

0.85

Map