F404919

General Info

Members Datasets Scaffolds Average Seq Length
319 169 638 278

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10018984|Ga0065704_100189842
Length 326
Sequence VNRTFSAGAFRVVQLLRPYPRLPAELRLFGANEVVRFHDSHDEGSWIKLAGVKILTIISDAQAQPRAKRRVLVPTMGALHKAHGELIRVARXAAGKDGEVAVSIFVNPLQFEPGSDYERYPRPEKADEEFCRTAGVDILFRPSAEEVYPNDRSTFVEEISLSSALEGKSRPGHFRGVCTVVAKLFNVLAPYAAVFGEKDFQQLAVIRRMVRDLNFNIDIIAVPTVREEDGLACSSRNQYLNSEERKQATVLYKALRTAANASKQSAGEIVAFVRKLINEAPLARIDYVEVVDAGSLQPVEIVGPNTVLLVAVFLGKTRLIDNIRLG

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.39
Rhizosphere 95.3
Stem 0
Stem Tuber 0
Unclassified 10.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10018984 3300005289 Bacteria 2031
2 MBSR1b_contig_5790175 2162886012 Unclassified 1208
3 JGI25406J46586_10000011 3300003203 Bacteria 104720
4 Ga0065704_10007570 3300005289 Bacteria 5798
5 Ga0065704_10013407 3300005289 Bacteria 2510
6 Ga0065712_10198329 3300005290 Bacteria 1118
7 Ga0065715_10006005 3300005293 Bacteria 2983
8 Ga0065715_10016848 3300005293 Bacteria 2975
9 Ga0065707_10172514 3300005295 Bacteria 1474
10 Ga0070683_100045170 3300005329 Bacteria 4066
11 Ga0070683_100221526 3300005329 Unclassified 1798
12 Ga0070670_100002974 3300005331 Bacteria 14037
13 Ga0070670_100004321 3300005331 Bacteria 11891
14 Ga0070670_100297884 3300005331 Bacteria 1410
15 Ga0068869_100365435 3300005334 Unclassified 1179
16 Ga0070666_10003595 3300005335 Bacteria 9396
17 Ga0068868_100030023 3300005338 Bacteria 4167
18 Ga0068868_100262518 3300005338 Bacteria 1457
19 Ga0070660_100244320 3300005339 Bacteria 1463
20 Ga0070689_100021161 3300005340 Bacteria 4835
21 Ga0070689_100025313 3300005340 Bacteria 4457
22 Ga0070689_100057624 3300005340 Bacteria 3016
23 Ga0070689_100128343 3300005340 Bacteria 2032
24 Ga0070689_100275632 3300005340 Unclassified 1394
25 Ga0070661_100249437 3300005344 Bacteria 1369
26 Ga0070668_100003937 3300005347 Bacteria 10978
27 Ga0070668_100049369 3300005347 Bacteria 3238
28 Ga0070668_100083923 3300005347 Unclassified 2501
29 Ga0070668_100124085 3300005347 Bacteria 2067
30 Ga0070669_100005067 3300005353 Bacteria 9522
31 Ga0070669_100163252 3300005353 Bacteria 1733
32 Ga0070675_100005092 3300005354 Bacteria 10024
33 Ga0070675_100022050 3300005354 Bacteria 5089
34 Ga0070675_100050483 3300005354 Bacteria 3416
35 Ga0070675_100121316 3300005354 Bacteria 2221
36 Ga0070671_100001955 3300005355 Bacteria 15797
37 Ga0070671_100004727 3300005355 Bacteria 10814
38 Ga0070671_100015944 3300005355 Bacteria 6072
39 Ga0070671_100190533 3300005355 Bacteria 1738
40 Ga0070671_100279110 3300005355 Unclassified 1421
41 Ga0070674_100005861 3300005356 Bacteria 7145
42 Ga0070673_100006850 3300005364 Bacteria 7453
43 Ga0070673_100059545 3300005364 Bacteria 3024
44 Ga0070673_100096332 3300005364 Bacteria 2428
45 Ga0070688_100001222 3300005365 Bacteria 12803
46 Ga0070688_100030546 3300005365 Bacteria 3235
47 Ga0070659_100015243 3300005366 Bacteria 5753
48 Ga0070667_100008771 3300005367 Bacteria 8380
49 Ga0070667_100107398 3300005367 Bacteria 2417
50 Ga0070709_10034470 3300005434 Bacteria 3069
51 Ga0070714_100024233 3300005435 Bacteria 4992
52 Ga0070714_100090380 3300005435 Bacteria 2681
53 Ga0070711_100029607 3300005439 Bacteria 3615
54 Ga0070705_100050727 3300005440 Bacteria 2415
55 Ga0070700_100009167 3300005441 Bacteria 5425
56 Ga0070708_100062550 3300005445 Bacteria 3329
57 Ga0070708_100200345 3300005445 Bacteria 1869
58 Ga0070708_100295770 3300005445 Unclassified 1524
59 Ga0070708_100427266 3300005445 Unclassified 1249
60 Ga0070678_100042746 3300005456 Bacteria 3223
61 Ga0070662_100055922 3300005457 Bacteria 2864
62 Ga0070681_10191528 3300005458 Unclassified 1965
63 Ga0068867_100012503 3300005459 Bacteria 6008
64 Ga0070685_10038117 3300005466 Bacteria 2725
65 Ga0070685_10116547 3300005466 Unclassified 1653
66 Ga0070706_100021907 3300005467 Bacteria 5884
67 Ga0070706_100159905 3300005467 Bacteria 2103
68 Ga0070706_100180536 3300005467 Bacteria 1971
69 Ga0070707_100003793 3300005468 Bacteria 14261
70 Ga0070707_100004249 3300005468 Bacteria 13408
71 Ga0070707_100007148 3300005468 Bacteria 10351
72 Ga0070707_100016418 3300005468 Bacteria 6947
73 Ga0070707_100045351 3300005468 Bacteria 4208
74 Ga0070707_100094497 3300005468 Unclassified 2895
75 Ga0070707_100100754 3300005468 Bacteria 2799
76 Ga0070707_100148131 3300005468 Bacteria 2285
77 Ga0070707_100281887 3300005468 Unclassified 1615
78 Ga0070707_100321430 3300005468 Unclassified 1504
79 Ga0070698_100001128 3300005471 Bacteria 29519
80 Ga0070698_100001373 3300005471 Bacteria 27059
81 Ga0070698_100011615 3300005471 Bacteria 9346
82 Ga0070699_100206072 3300005518 Bacteria 1750
83 Ga0070684_100002862 3300005535 Bacteria 12828
84 Ga0070684_100032701 3300005535 Bacteria 4435
85 Ga0070697_100001619 3300005536 Bacteria 17147
86 Ga0070697_100015068 3300005536 Bacteria 6067
87 Ga0070697_100039162 3300005536 Bacteria 3832
88 Ga0070697_100050812 3300005536 Bacteria 3366
89 Ga0070697_100069402 3300005536 Unclassified 2886
90 Ga0070697_100147003 3300005536 Bacteria 1985
91 Ga0070697_100362212 3300005536 Bacteria 1254
92 Ga0070672_100001979 3300005543 Bacteria 12832
93 Ga0070672_100034804 3300005543 Bacteria 3824
94 Ga0070686_100243416 3300005544 Bacteria 1311
95 Ga0070695_100102395 3300005545 Bacteria 1931
96 Ga0070665_100014469 3300005548 Bacteria 7914
97 Ga0070665_100035693 3300005548 Bacteria 5000
98 Ga0070665_100057955 3300005548 Bacteria 3883
99 Ga0070665_100064210 3300005548 Bacteria 3681
100 Ga0070665_100069823 3300005548 Bacteria 3521
101 Ga0070665_100077272 3300005548 Bacteria 3335
102 Ga0070704_100005915 3300005549 Bacteria 7167
103 Ga0070704_100309629 3300005549 Bacteria 1319
104 Ga0068857_100365966 3300005577 Bacteria 1337
105 Ga0070702_100256651 3300005615 Bacteria 1188
106 Ga0068859_100042020 3300005617 Bacteria 4592
107 Ga0068864_100027757 3300005618 Bacteria 4783
108 Ga0068864_100243141 3300005618 Bacteria 1668
109 Ga0068864_100834513 3300005618 Bacteria 907
110 Ga0068866_10040651 3300005718 Bacteria 2303
111 Ga0068861_100050105 3300005719 Bacteria 3165
112 Ga0068863_100047273 3300005841 Bacteria 4082
113 Ga0068863_100128053 3300005841 Bacteria 2423
114 Ga0068858_100023372 3300005842 Bacteria 5759
115 Ga0068858_100402372 3300005842 Bacteria 1315
116 Ga0068860_100187210 3300005843 Bacteria 2002
117 Ga0068860_100219885 3300005843 Bacteria 1844
118 Ga0081455_10001571 3300005937 Bacteria 28055
119 Ga0081455_10005689 3300005937 Bacteria 13602
120 Ga0081455_10023672 3300005937 Bacteria 5709
121 Ga0081455_10032340 3300005937 Bacteria 4715
122 Ga0081455_10073341 3300005937 Bacteria 2830
123 Ga0081455_10146194 3300005937 Bacteria 1828
124 Ga0081455_10177242 3300005937 Bacteria 1617
125 Ga0081540_1000010 3300005983 Bacteria 193206
126 Ga0081539_10000139 3300005985 Bacteria 170623
127 Ga0081539_10006493 3300005985 Bacteria 11185
128 Ga0081539_10010457 3300005985 Bacteria 7532
129 Ga0070717_10000276 3300006028 Bacteria 35106
130 Ga0070717_10007406 3300006028 Bacteria 8149
131 Ga0070717_10077605 3300006028 Bacteria 2782
132 Ga0070717_10237335 3300006028 Bacteria 1607
133 Ga0070716_100134505 3300006173 Bacteria 1568
134 Ga0070712_100012393 3300006175 Bacteria 5418
135 Ga0070712_100049994 3300006175 Bacteria 2906
136 Ga0070712_100111619 3300006175 Bacteria 2041
137 Ga0070712_100144942 3300006175 Unclassified 1816
138 Ga0068871_100241955 3300006358 Bacteria 1569
139 Ga0075428_100224914 3300006844 Unclassified 2026
140 Ga0068865_100093397 3300006881 Bacteria 2188
141 Ga0075436_100014379 3300006914 Bacteria 5418
142 Ga0097620_100042023 3300006931 Bacteria 4592
143 Ga0099794_10121844 3300007265 Bacteria 1312
144 Ga0111539_10548305 3300009094 Bacteria 1347
145 Ga0105247_10055938 3300009101 Bacteria 2435
146 Ga0105247_10125624 3300009101 Bacteria 1667
147 Ga0114129_10011423 3300009147 Bacteria 12650
148 Ga0105243_10112625 3300009148 Bacteria 2280
149 Ga0105243_10224235 3300009148 Bacteria 1663
150 Ga0105243_10236363 3300009148 Bacteria 1624
151 Ga0105241_10274075 3300009174 Unclassified 1439
152 Ga0105237_10054851 3300009545 Bacteria 3993
153 Ga0105249_10046126 3300009553 Bacteria 3966
154 Ga0105239_10068404 3300010375 Bacteria 3903
155 Ga0105239_10119233 3300010375 Bacteria 2928
156 Ga0157373_10027851 3300013100 Unclassified 4076
157 Ga0157374_10002060 3300013296 Bacteria 16898
158 Ga0157374_10064099 3300013296 Bacteria 3447
159 Ga0157374_10076073 3300013296 Bacteria 3173
160 Ga0157374_10093932 3300013296 Bacteria 2865
161 Ga0157374_10095321 3300013296 Unclassified 2845
162 Ga0157374_10298416 3300013296 Bacteria 1594
163 Ga0157374_10299049 3300013296 Bacteria 1592
164 Ga0157374_10365433 3300013296 Bacteria 1436
165 Ga0157378_10147618 3300013297 Bacteria 2189
166 Ga0157378_10280772 3300013297 Bacteria 1605
167 Ga0157378_10417190 3300013297 Unclassified 1326
168 Ga0163162_10026953 3300013306 Bacteria 5683
169 Ga0163162_10059993 3300013306 Bacteria 3837
170 Ga0163162_10275494 3300013306 Bacteria 1814
171 Ga0157372_10039512 3300013307 Bacteria 5208
172 Ga0157372_10227538 3300013307 Bacteria 2162
173 Ga0157372_10319310 3300013307 Bacteria 1808
174 Ga0157375_10002351 3300013308 Bacteria 16339
175 Ga0157375_10067237 3300013308 Bacteria 3581
176 Ga0157375_10193914 3300013308 Bacteria 2186
177 Ga0157375_10300230 3300013308 Bacteria 1769
178 Ga0163163_10120564 3300014325 Bacteria 2657
179 Ga0157377_10028639 3300014745 Bacteria 2999
180 Ga0157379_10021454 3300014968 Bacteria 5717
181 Ga0157379_10287922 3300014968 Bacteria 1496
182 Ga0157376_10069233 3300014969 Bacteria 2991
183 Ga0157376_10220919 3300014969 Bacteria 1755
184 Ga0157376_10236272 3300014969 Bacteria 1700
185 Ga0163161_10180175 3300017792 Bacteria 1620
186 Ga0207673_1000142 3300025290 Bacteria 6920
187 Ga0207697_10000265 3300025315 Bacteria 28907
188 Ga0207697_10001739 3300025315 Bacteria 11701
189 Ga0207697_10004781 3300025315 Bacteria 6407
190 Ga0207697_10024634 3300025315 Bacteria 2463
191 Ga0207692_10210061 3300025898 Bacteria 1149
192 Ga0207688_10002340 3300025901 Bacteria 10183
193 Ga0207647_10023875 3300025904 Bacteria 4039
194 Ga0207645_10001289 3300025907 Bacteria 20595
195 Ga0207645_10010756 3300025907 Bacteria 6273
196 Ga0207684_10000190 3300025910 Bacteria 97762
197 Ga0207684_10009847 3300025910 Bacteria 8434
198 Ga0207684_10021196 3300025910 Bacteria 5550
199 Ga0207684_10052019 3300025910 Unclassified 3475
200 Ga0207684_10136687 3300025910 Bacteria 2105
201 Ga0207684_10240390 3300025910 Unclassified 1562
202 Ga0207654_10349104 3300025911 Unclassified 1018
203 Ga0207693_10006001 3300025915 Bacteria 10070
204 Ga0207693_10016036 3300025915 Bacteria 5997
205 Ga0207693_10036759 3300025915 Bacteria 3861
206 Ga0207693_10071440 3300025915 Bacteria 2717
207 Ga0207693_10100220 3300025915 Bacteria 2271
208 Ga0207663_10058983 3300025916 Bacteria 2425
209 Ga0207663_10175177 3300025916 Bacteria 1527
210 Ga0207663_10369626 3300025916 Bacteria 1090
211 Ga0207660_10064737 3300025917 Bacteria 2639
212 Ga0207657_10034527 3300025919 Bacteria 4546
213 Ga0207646_10000248 3300025922 Bacteria 73450
214 Ga0207646_10001113 3300025922 Bacteria 34274
215 Ga0207646_10050642 3300025922 Bacteria 3716
216 Ga0207646_10062492 3300025922 Bacteria 3324
217 Ga0207646_10142581 3300025922 Bacteria 2158
218 Ga0207646_10209488 3300025922 Bacteria 1760
219 Ga0207646_10298217 3300025922 Bacteria 1456
220 Ga0207681_10038604 3300025923 Bacteria 3165
221 Ga0207650_10008642 3300025925 Bacteria 6954
222 Ga0207650_10142245 3300025925 Bacteria 1887
223 Ga0207659_10001211 3300025926 Bacteria 15415
224 Ga0207659_10146576 3300025926 Unclassified 1839
225 Ga0207700_10333303 3300025928 Bacteria 1317
226 Ga0207664_10097692 3300025929 Bacteria 2420
227 Ga0207644_10044876 3300025931 Unclassified 3142
228 Ga0207644_10466005 3300025931 Unclassified 1039
229 Ga0207690_10013404 3300025932 Bacteria 4925
230 Ga0207706_10041958 3300025933 Bacteria 4054
231 Ga0207706_10148300 3300025933 Bacteria 2064
232 Ga0207670_10005248 3300025936 Bacteria 7093
233 Ga0207670_10032886 3300025936 Unclassified 3338
234 Ga0207670_10305469 3300025936 Bacteria 1247
235 Ga0207670_10587000 3300025936 Bacteria 914
236 Ga0207704_10184806 3300025938 Unclassified 1510
237 Ga0207665_10015772 3300025939 Bacteria 4958
238 Ga0207665_10146199 3300025939 Unclassified 1689
239 Ga0207691_10000956 3300025940 Bacteria 28622
240 Ga0207689_10092684 3300025942 Bacteria 2482
241 Ga0207661_10018060 3300025944 Bacteria 5236
242 Ga0207661_10018305 3300025944 Bacteria 5204
243 Ga0207661_10047349 3300025944 Bacteria 3413
244 Ga0207679_10019705 3300025945 Bacteria 4539
245 Ga0207679_10503009 3300025945 Bacteria 1082
246 Ga0207651_10044991 3300025960 Bacteria 2958
247 Ga0207651_10190567 3300025960 Bacteria 1635
248 Ga0207658_10037339 3300025986 Bacteria 3490
249 Ga0207658_10178716 3300025986 Bacteria 1754
250 Ga0207703_10025843 3300026035 Bacteria 4621
251 Ga0207703_10142047 3300026035 Bacteria 2084
252 Ga0207678_10088193 3300026067 Bacteria 2652
253 Ga0207708_10051526 3300026075 Bacteria 3134
254 Ga0207702_10073053 3300026078 Bacteria 2957
255 Ga0207641_10085310 3300026088 Bacteria 2751
256 Ga0207648_10017694 3300026089 Bacteria 6475
257 Ga0207675_100059019 3300026118 Bacteria 3581
258 Ga0207683_10013423 3300026121 Bacteria 6987
259 Ga0207683_10014417 3300026121 Bacteria 6730
260 Ga0207683_10464105 3300026121 Unclassified 1168
261 Ga0209974_10059531 3300027876 Unclassified 1292
262 Ga0268266_10002434 3300028379 Bacteria 19993
263 Ga0268266_10025648 3300028379 Bacteria 5014
264 Ga0268266_10112030 3300028379 Bacteria 2418
265 Ga0268266_10188374 3300028379 Bacteria 1883
266 Ga0268264_10036918 3300028381 Bacteria 4027
267 Ga0307513_10012943 3300031456 Bacteria 10258
268 Ga0373953_0071193 3300035117 Bacteria 1435
269 Ga0373955_0163799 3300035172 Bacteria 1314
270 Ga0373935_0007074 3300035692 Bacteria 6699
271 Ga0373927_0064035 3300035695 Bacteria 2379
272 Ga0373947_0291417 3300035725 Unclassified 1087
273 Ga0373937_0180970 3300036401 Bacteria 1979
274 Ga0373937_0309800 3300036401 Bacteria 1493
275 Ga0373925_0047245 3300037068 Bacteria 3204
276 Ga0395900_0014915 3300037418 Bacteria 7918
277 Ga0395900_0034407 3300037418 Bacteria 5217
278 Ga0395898_0013310 3300037466 Bacteria 8472
279 Ga0395898_0054007 3300037466 Bacteria 3922
280 Ga0395905_0025942 3300037471 Bacteria 5525
281 Ga0395901_0005674 3300038443 Bacteria 12630
282 Ga0395901_0082460 3300038443 Bacteria 3360
283 Ga0466964_0017908 3300044706 Bacteria 2714
284 Ga0451576_0056661 3300045051 Bacteria 4098
285 Ga0495592_0003828 3300046454 Bacteria 10878
286 Ga0495651_0026684 3300046462 Bacteria 4498
287 Ga0495664_0151691 3300046477 Bacteria 1406
288 Ga0495628_0086704 3300046516 Bacteria 2427
289 Ga0495652_0294893 3300046529 Bacteria 1181
290 Ga0495587_0146298 3300046536 Bacteria 1347
291 Ga0495667_0032075 3300046559 Bacteria 3523
292 Ga0495656_0152558 3300046615 Bacteria 1117
293 Ga0495599_0034234 3300046678 Bacteria 3191
294 Ga0495646_0028343 3300046680 Bacteria 3507
295 Ga0495658_0054665 3300046683 Bacteria 2272
296 Ga0495624_0267375 3300046690 Bacteria 1033
297 Ga0495600_0263168 3300046809 Bacteria 1095
298 Ga0495674_0027737 3300047319 Bacteria 5171
299 Ga0495674_0120110 3300047319 Bacteria 2221
300 Ga0495675_0029307 3300047444 Bacteria 3510
301 Ga0495684_0043066 3300047471 Bacteria 3456
302 Ga0495602_0059061 3300048088 Bacteria 3351
303 Ga0496102_0093138 3300048905 Bacteria 2791
304 Ga0496103_0084712 3300048906 Bacteria 1997
305 Ga0496104_0145488 3300048907 Bacteria 2276
306 Ga0496104_0309364 3300048907 Unclassified 1493
307 Ga0496106_0093317 3300048909 Bacteria 2326
308 Ga0496108_0121773 3300048911 Bacteria 2238
309 Ga0496108_0318366 3300048911 Bacteria 1356
310 Ga0496109_0124946 3300048912 Bacteria 2398
311 Ga0496110_0075303 3300048913 Bacteria 2999
312 Ga0496110_0121349 3300048913 Bacteria 2355
313 Ga0496112_0070026 3300048915 Unclassified 3466
314 Ga0496112_0349054 3300048915 Bacteria 1422
315 Ga0496114_0244564 3300048917 Bacteria 1578
316 Ga0496115_0160963 3300048918 Bacteria 1855
317 nmdc:mga05p37_4212_c1 3300050507 Bacteria 16805
318 nmdc:mga08x19_17844_c1 3300050514 Bacteria 4345
319 nmdc:mga08x19_345691_c1 3300050514 Bacteria 1038
320 Ga0065704_10018984
321 MBSR1b_contig_5790175
322 JGI25406J46586_10000011
323 Ga0065704_10007570
324 Ga0065704_10013407
325 Ga0065712_10198329
326 Ga0065715_10006005
327 Ga0065715_10016848
328 Ga0065707_10172514
329 Ga0070683_100045170
330 Ga0070683_100221526
331 Ga0070670_100002974
332 Ga0070670_100004321
333 Ga0070670_100297884
334 Ga0068869_100365435
335 Ga0070666_10003595
336 Ga0068868_100030023
337 Ga0068868_100262518
338 Ga0070660_100244320
339 Ga0070689_100021161
340 Ga0070689_100025313
341 Ga0070689_100057624
342 Ga0070689_100128343
343 Ga0070689_100275632
344 Ga0070661_100249437
345 Ga0070668_100003937
346 Ga0070668_100049369
347 Ga0070668_100083923
348 Ga0070668_100124085
349 Ga0070669_100005067
350 Ga0070669_100163252
351 Ga0070675_100005092
352 Ga0070675_100022050
353 Ga0070675_100050483
354 Ga0070675_100121316
355 Ga0070671_100001955
356 Ga0070671_100004727
357 Ga0070671_100015944
358 Ga0070671_100190533
359 Ga0070671_100279110
360 Ga0070674_100005861
361 Ga0070673_100006850
362 Ga0070673_100059545
363 Ga0070673_100096332
364 Ga0070688_100001222
365 Ga0070688_100030546
366 Ga0070659_100015243
367 Ga0070667_100008771
368 Ga0070667_100107398
369 Ga0070709_10034470
370 Ga0070714_100024233
371 Ga0070714_100090380
372 Ga0070711_100029607
373 Ga0070705_100050727
374 Ga0070700_100009167
375 Ga0070708_100062550
376 Ga0070708_100200345
377 Ga0070708_100295770
378 Ga0070708_100427266
379 Ga0070678_100042746
380 Ga0070662_100055922
381 Ga0070681_10191528
382 Ga0068867_100012503
383 Ga0070685_10038117
384 Ga0070685_10116547
385 Ga0070706_100021907
386 Ga0070706_100159905
387 Ga0070706_100180536
388 Ga0070707_100003793
389 Ga0070707_100004249
390 Ga0070707_100007148
391 Ga0070707_100016418
392 Ga0070707_100045351
393 Ga0070707_100094497
394 Ga0070707_100100754
395 Ga0070707_100148131
396 Ga0070707_100281887
397 Ga0070707_100321430
398 Ga0070698_100001128
399 Ga0070698_100001373
400 Ga0070698_100011615
401 Ga0070699_100206072
402 Ga0070684_100002862
403 Ga0070684_100032701
404 Ga0070697_100001619
405 Ga0070697_100015068
406 Ga0070697_100039162
407 Ga0070697_100050812
408 Ga0070697_100069402
409 Ga0070697_100147003
410 Ga0070697_100362212
411 Ga0070672_100001979
412 Ga0070672_100034804
413 Ga0070686_100243416
414 Ga0070695_100102395
415 Ga0070665_100014469
416 Ga0070665_100035693
417 Ga0070665_100057955
418 Ga0070665_100064210
419 Ga0070665_100069823
420 Ga0070665_100077272
421 Ga0070704_100005915
422 Ga0070704_100309629
423 Ga0068857_100365966
424 Ga0070702_100256651
425 Ga0068859_100042020
426 Ga0068864_100027757
427 Ga0068864_100243141
428 Ga0068864_100834513
429 Ga0068866_10040651
430 Ga0068861_100050105
431 Ga0068863_100047273
432 Ga0068863_100128053
433 Ga0068858_100023372
434 Ga0068858_100402372
435 Ga0068860_100187210
436 Ga0068860_100219885
437 Ga0081455_10001571
438 Ga0081455_10005689
439 Ga0081455_10023672
440 Ga0081455_10032340
441 Ga0081455_10073341
442 Ga0081455_10146194
443 Ga0081455_10177242
444 Ga0081540_1000010
445 Ga0081539_10000139
446 Ga0081539_10006493
447 Ga0081539_10010457
448 Ga0070717_10000276
449 Ga0070717_10007406
450 Ga0070717_10077605
451 Ga0070717_10237335
452 Ga0070716_100134505
453 Ga0070712_100012393
454 Ga0070712_100049994
455 Ga0070712_100111619
456 Ga0070712_100144942
457 Ga0068871_100241955
458 Ga0075428_100224914
459 Ga0068865_100093397
460 Ga0075436_100014379
461 Ga0097620_100042023
462 Ga0099794_10121844
463 Ga0111539_10548305
464 Ga0105247_10055938
465 Ga0105247_10125624
466 Ga0114129_10011423
467 Ga0105243_10112625
468 Ga0105243_10224235
469 Ga0105243_10236363
470 Ga0105241_10274075
471 Ga0105237_10054851
472 Ga0105249_10046126
473 Ga0105239_10068404
474 Ga0105239_10119233
475 Ga0157373_10027851
476 Ga0157374_10002060
477 Ga0157374_10064099
478 Ga0157374_10076073
479 Ga0157374_10093932
480 Ga0157374_10095321
481 Ga0157374_10298416
482 Ga0157374_10299049
483 Ga0157374_10365433
484 Ga0157378_10147618
485 Ga0157378_10280772
486 Ga0157378_10417190
487 Ga0163162_10026953
488 Ga0163162_10059993
489 Ga0163162_10275494
490 Ga0157372_10039512
491 Ga0157372_10227538
492 Ga0157372_10319310
493 Ga0157375_10002351
494 Ga0157375_10067237
495 Ga0157375_10193914
496 Ga0157375_10300230
497 Ga0163163_10120564
498 Ga0157377_10028639
499 Ga0157379_10021454
500 Ga0157379_10287922
501 Ga0157376_10069233
502 Ga0157376_10220919
503 Ga0157376_10236272
504 Ga0163161_10180175
505 Ga0207673_1000142
506 Ga0207697_10000265
507 Ga0207697_10001739
508 Ga0207697_10004781
509 Ga0207697_10024634
510 Ga0207692_10210061
511 Ga0207688_10002340
512 Ga0207647_10023875
513 Ga0207645_10001289
514 Ga0207645_10010756
515 Ga0207684_10000190
516 Ga0207684_10009847
517 Ga0207684_10021196
518 Ga0207684_10052019
519 Ga0207684_10136687
520 Ga0207684_10240390
521 Ga0207654_10349104
522 Ga0207693_10006001
523 Ga0207693_10016036
524 Ga0207693_10036759
525 Ga0207693_10071440
526 Ga0207693_10100220
527 Ga0207663_10058983
528 Ga0207663_10175177
529 Ga0207663_10369626
530 Ga0207660_10064737
531 Ga0207657_10034527
532 Ga0207646_10000248
533 Ga0207646_10001113
534 Ga0207646_10050642
535 Ga0207646_10062492
536 Ga0207646_10142581
537 Ga0207646_10209488
538 Ga0207646_10298217
539 Ga0207681_10038604
540 Ga0207650_10008642
541 Ga0207650_10142245
542 Ga0207659_10001211
543 Ga0207659_10146576
544 Ga0207700_10333303
545 Ga0207664_10097692
546 Ga0207644_10044876
547 Ga0207644_10466005
548 Ga0207690_10013404
549 Ga0207706_10041958
550 Ga0207706_10148300
551 Ga0207670_10005248
552 Ga0207670_10032886
553 Ga0207670_10305469
554 Ga0207670_10587000
555 Ga0207704_10184806
556 Ga0207665_10015772
557 Ga0207665_10146199
558 Ga0207691_10000956
559 Ga0207689_10092684
560 Ga0207661_10018060
561 Ga0207661_10018305
562 Ga0207661_10047349
563 Ga0207679_10019705
564 Ga0207679_10503009
565 Ga0207651_10044991
566 Ga0207651_10190567
567 Ga0207658_10037339
568 Ga0207658_10178716
569 Ga0207703_10025843
570 Ga0207703_10142047
571 Ga0207678_10088193
572 Ga0207708_10051526
573 Ga0207702_10073053
574 Ga0207641_10085310
575 Ga0207648_10017694
576 Ga0207675_100059019
577 Ga0207683_10013423
578 Ga0207683_10014417
579 Ga0207683_10464105
580 Ga0209974_10059531
581 Ga0268266_10002434
582 Ga0268266_10025648
583 Ga0268266_10112030
584 Ga0268266_10188374
585 Ga0268264_10036918
586 Ga0307513_10012943
587 Ga0373953_0071193
588 Ga0373955_0163799
589 Ga0373935_0007074
590 Ga0373927_0064035
591 Ga0373947_0291417
592 Ga0373937_0180970
593 Ga0373937_0309800
594 Ga0373925_0047245
595 Ga0395900_0014915
596 Ga0395900_0034407
597 Ga0395898_0013310
598 Ga0395898_0054007
599 Ga0395905_0025942
600 Ga0395901_0005674
601 Ga0395901_0082460
602 Ga0466964_0017908
603 Ga0451576_0056661
604 Ga0495592_0003828
605 Ga0495651_0026684
606 Ga0495664_0151691
607 Ga0495628_0086704
608 Ga0495652_0294893
609 Ga0495587_0146298
610 Ga0495667_0032075
611 Ga0495656_0152558
612 Ga0495599_0034234
613 Ga0495646_0028343
614 Ga0495658_0054665
615 Ga0495624_0267375
616 Ga0495600_0263168
617 Ga0495674_0027737
618 Ga0495674_0120110
619 Ga0495675_0029307
620 Ga0495684_0043066
621 Ga0495602_0059061
622 Ga0496102_0093138
623 Ga0496103_0084712
624 Ga0496104_0145488
625 Ga0496104_0309364
626 Ga0496106_0093317
627 Ga0496108_0121773
628 Ga0496108_0318366
629 Ga0496109_0124946
630 Ga0496110_0075303
631 Ga0496110_0121349
632 Ga0496112_0070026
633 Ga0496112_0349054
634 Ga0496114_0244564
635 Ga0496115_0160963
636 nmdc:mga05p37_4212_c1
637 nmdc:mga08x19_17844_c1
638 nmdc:mga08x19_345691_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02569

Pantoate_ligase

Pantoate-beta-alanine ligase

52

324

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ufv-assembly1.cif.gz_A crystal structure of pantothenate synthetase from thermus thermophilus hb8 0.9483 1 273
1v8f-assembly1.cif.gz_A crystal structure of pantoate-beta-alanine (pantothenate synthetase) from thermus thermophilus hb8 0.9462 1 273
3inn-assembly1.cif.gz_A crystal structure of pantoate-beta-alanine-ligase in complex with atp at low occupancy at 2.1 a resolution 0.9383 1 275
1ufv-assembly1.cif.gz_A crystal structure of pantothenate synthetase from thermus thermophilus hb8 0.9383 1 273
3mxt-assembly1.cif.gz_A crystal structure of pantoate-beta-alanine ligase from campylobacter jejuni 0.938 1 275
ID Description Score Start End Superfamily
af_B4F7V8_214_317_3.30.1300.10 Alpha Beta;2-Layer Sandwich;Pantoate--beta-alanine Ligase; Chain: A,domain 2;Pantoate-beta-alanine ligase, C-terminal domain 0.9615 178 274 3.30.1300.10
af_Q54I80_8_191_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9362 18 174 3.40.50.620
3uy4A02 Alpha Beta;2-Layer Sandwich;Pantoate--beta-alanine Ligase; Chain: A,domain 2;Pantoate-beta-alanine ligase, C-terminal domain 0.9301 176 272 3.30.1300.10
3innD02 Alpha Beta;2-Layer Sandwich;Pantoate--beta-alanine Ligase; Chain: A,domain 2;Pantoate-beta-alanine ligase, C-terminal domain 0.9291 176 272 3.30.1300.10
2x3fA02 Alpha Beta;2-Layer Sandwich;Pantoate--beta-alanine Ligase; Chain: A,domain 2;Pantoate-beta-alanine ligase, C-terminal domain 0.916 176 272 3.30.1300.10
ID Description Score Start End GO Terms
AF-A0A2V8R3P5-F1-model_v4 pantoate--beta-alanine ligase (AMP-forming) (EC 6.3.2.1) (Pantoate-activating enzyme) 0.9957 122 275 GO:0004592
GO:0005524
GO:0005829
GO:0015940
AF-A0A1Q7FPA9-F1-model_v4 Pantoate--beta-alanine ligase 0.9953 199 275 GO:0004592
GO:0005524
GO:0015940
AF-A0A2V8R3P5-F1-model_v4 pantoate--beta-alanine ligase (AMP-forming) (EC 6.3.2.1) (Pantoate-activating enzyme) 0.9893 122 275 GO:0004592
GO:0005524
GO:0005829
GO:0015940
AF-A0A7W1KIS9-F1-model_v4 pantoate--beta-alanine ligase (AMP-forming) (EC 6.3.2.1) (Pantoate-activating enzyme) 0.985 150 273 GO:0004592
GO:0005524
GO:0015940
AF-A0A7C1QIB0-F1-model_v4 Pantoate--beta-alanine ligase 0.9833 152 274 GO:0004592
GO:0005524
GO:0005829
GO:0015940

Map