F404856

General Info

Members Datasets Scaffolds Average Seq Length
318 230 637 375

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2510917021|2511127420
Length 416
Sequence HEGHIMKLNPGLMALSVGAFGIGVTEFAPMGLLPVIASDLAVSIPTAGLLISAYALGVVIGAPLMTLTTGRISRRTLLIALAGIFTLGNLLAAVSGSYGMLLVARVITSFNHGAFFGVGSVVAASLVPAGRRAGAVATMFMGLTIANVVGVPLATWAGAHLGWRASFWGISGLGVFTMIFLRLALPLLPATSDGDAIAELRVLGRGRVLGALALTVVGSSAMFTVFTYIAPILRGATHASLGFVTAMLVLYGLGLTVGNWLGGRFADRSVDRTLTVTLASLSVILLLFSLMMEQTAAAPPLIFLWGIASFALVPPLQVRVMTAAADAPHLASAVNIGAFNLGNAIGAALGGAVIAFGFGFAAIALAGAATAFVGLIAVLIAGRYPNDSGAQPPQTIPLSPECSKCSRKSETPRSLH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
111 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
112 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
113 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
114 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
115 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
116 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
117 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
118 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
126 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
127 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
128 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
132 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
133 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
136 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
137 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
138 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
139 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
144 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
145 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
146 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
147 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
148 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
149 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
167 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
168 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
171 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
178 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
179 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
180 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
181 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
182 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
183 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
184 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
185 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
186 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
187 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
189 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
190 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
191 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
192 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
193 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
194 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
195 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
196 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
197 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
198 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
199 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
200 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
201 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
202 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
203 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
204 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
205 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
206 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
207 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
208 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
209 2643221733 Bosea sp. Root381 Isolate Unclassified
210 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
211 2765235841 Pseudomonas putida AA7 Isolate Unclassified
212 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
213 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
214 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
215 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
216 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
217 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
218 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
219 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
220 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
221 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
222 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
223 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
224 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
225 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
226 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
227 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
228 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
229 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
230 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.48
Metatranscriptomes 0
Isolates 13.52

Biome Distribution

Category Percentage (%)
Aerial Root 1.26
Bulb 0
Endosphere 12.26
Nodule 0
Rhizoplane 9.43
Rhizosphere 59.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2289305 2162886007 Bacteria 11750
2 SwRhRL2b_contig_81309 2162886007 Bacteria 4518
3 JGI24741J21665_1001151 3300001915 Bacteria 7804
4 JGI24739J22299_10005317 3300001989 Bacteria 4904
5 JGI24737J22298_10001069 3300001990 Bacteria 9675
6 JGI24034J26672_10004621 3300002239 Bacteria 1956
7 JGI25150J39212_1000479 3300002774 Bacteria 16975
8 JGI25153J46596_10000011 3300003215 Bacteria 319992
9 JGI25153J46596_10000064 3300003215 Bacteria 125642
10 rootH1_10025344 3300003316 Bacteria 3030
11 rootH1_10025344 3300003323 Bacteria 5149
12 Ga0055525_1000216 3300003759 Bacteria 63005
13 Ga0055542_1000038 3300003762 Bacteria 224625
14 Ga0055529_1000002 3300003763 Bacteria 537914
15 Ga0055529_1000021 3300003763 Bacteria 321484
16 Ga0055526_1002619 3300003771 Bacteria 12029
17 Ga0055537_1003868 3300003773 Bacteria 4470
18 Ga0055530_10013056 3300003791 Bacteria 2856
19 Ga0055531_10009970 3300003794 Bacteria 4791
20 Ga0065165_1004128 3300005262 Bacteria 9333
21 Ga0065704_10070220 3300005289 Bacteria 67739
22 Ga0065704_10070766 3300005289 Bacteria 16445
23 Ga0065704_10077469 3300005289 Bacteria 4706
24 Ga0070658_10000246 3300005327 Bacteria 48141
25 Ga0070670_100060585 3300005331 Bacteria 3250
26 Ga0070666_10143752 3300005335 Bacteria 1662
27 Ga0070660_100002593 3300005339 Bacteria 12400
28 Ga0070661_100002119 3300005344 Bacteria 13675
29 Ga0070661_100039155 3300005344 Bacteria 3454
30 Ga0070668_100019483 3300005347 Bacteria 5107
31 Ga0070668_100033630 3300005347 Bacteria 3905
32 Ga0070669_100011369 3300005353 Bacteria 6319
33 Ga0070675_100230438 3300005354 Bacteria 1616
34 Ga0070671_100000882 3300005355 Bacteria 21942
35 Ga0070671_100023545 3300005355 Bacteria 5041
36 Ga0070671_100035868 3300005355 Bacteria 4110
37 Ga0070674_100000010 3300005356 Bacteria 137217
38 Ga0070674_100017865 3300005356 Bacteria 4471
39 Ga0070673_100048427 3300005364 Bacteria 3313
40 Ga0070667_100003962 3300005367 Bacteria 12566
41 Ga0070678_100000002 3300005456 Bacteria 83006
42 Ga0070678_100000116 3300005456 Bacteria 31444
43 Ga0070678_100230513 3300005456 Bacteria 1544
44 Ga0070662_100130374 3300005457 Bacteria 1938
45 Ga0070684_100058949 3300005535 Bacteria 3356
46 Ga0068853_100244531 3300005539 Bacteria 1645
47 Ga0070672_100026711 3300005543 Bacteria 4301
48 Ga0070672_100221232 3300005543 Bacteria 1588
49 Ga0070665_100000535 3300005548 Bacteria 53560
50 Ga0070665_100001418 3300005548 Bacteria 28122
51 Ga0070665_100014976 3300005548 Bacteria 7784
52 Ga0068855_100000062 3300005563 Bacteria 131470
53 Ga0070664_100025884 3300005564 Bacteria 4864
54 Ga0068854_100077747 3300005578 Bacteria 2443
55 Ga0068851_10034696 3300005834 Bacteria 2518
56 Ga0068858_100006420 3300005842 Bacteria 11453
57 Ga0068862_100019080 3300005844 Bacteria 5717
58 Ga0068862_100077175 3300005844 Bacteria 2884
59 Ga0075364_10014581 3300006051 Bacteria 4859
60 Ga0097621_100138474 3300006237 Bacteria 2078
61 Ga0068871_100018492 3300006358 Bacteria 5297
62 Ga0068865_100237253 3300006881 Bacteria 1433
63 Ga0097620_100124335 3300006931 Bacteria 2648
64 Ga0105243_10000113 3300009148 Bacteria 93087
65 Ga0105241_10002111 3300009174 Bacteria 15008
66 Ga0105248_10109726 3300009177 Bacteria 3111
67 Ga0105237_10046012 3300009545 Bacteria 4390
68 Ga0105237_10049463 3300009545 Bacteria 4225
69 Ga0105249_10038648 3300009553 Bacteria 4331
70 Ga0157371_10000114 3300013102 Bacteria 122406
71 Ga0157371_10126261 3300013102 Bacteria 1819
72 Ga0157369_10001166 3300013105 Bacteria 32796
73 Ga0157369_10066582 3300013105 Bacteria 3875
74 Ga0163162_10040677 3300013306 Bacteria 4650
75 Ga0163161_10045331 3300017792 Bacteria 3170
76 Ga0209674_102265 3300025226 Bacteria 4249
77 Ga0209563_100081 3300025230 Bacteria 199455
78 Ga0209148_1000008 3300025254 Bacteria 1504371
79 Ga0209565_1000166 3300025263 Bacteria 85898
80 Ga0209455_1000002 3300025272 Bacteria 1505459
81 Ga0209673_1017376 3300025273 Bacteria 2653
82 Ga0209676_1007765 3300025292 Bacteria 4942
83 Ga0209564_1001888 3300025295 Bacteria 18837
84 Ga0209758_1000007 3300025297 Bacteria 1270410
85 Ga0209050_1000001 3300025298 Bacteria 3563507
86 Ga0209050_1007489 3300025298 Bacteria 6107
87 Ga0209051_1000415 3300025303 Bacteria 58919
88 Ga0209257_1003186 3300025304 Bacteria 14579
89 Ga0207696_1000429 3300025711 Bacteria 38341
90 Ga0207688_10109496 3300025901 Bacteria 1602
91 Ga0207647_10046622 3300025904 Bacteria 2700
92 Ga0207705_10000705 3300025909 Bacteria 27607
93 Ga0207654_10003496 3300025911 Bacteria 7946
94 Ga0207695_10041434 3300025913 Bacteria 4929
95 Ga0207671_10009170 3300025914 Bacteria 8300
96 Ga0207671_10014804 3300025914 Bacteria 6145
97 Ga0207671_10062536 3300025914 Bacteria 2764
98 Ga0207657_10005590 3300025919 Bacteria 13127
99 Ga0207657_10020745 3300025919 Bacteria 6201
100 Ga0207657_10069268 3300025919 Bacteria 2994
101 Ga0207649_10000104 3300025920 Bacteria 69778
102 Ga0207681_10000676 3300025923 Bacteria 22402
103 Ga0207694_10014074 3300025924 Bacteria 6031
104 Ga0207659_10301414 3300025926 Bacteria 1316
105 Ga0207644_10000449 3300025931 Bacteria 26613
106 Ga0207644_10007240 3300025931 Bacteria 7221
107 Ga0207644_10017969 3300025931 Bacteria 4782
108 Ga0207644_10058882 3300025931 Bacteria 2777
109 Ga0207690_10001770 3300025932 Bacteria 13277
110 Ga0207706_10041729 3300025933 Bacteria 4067
111 Ga0207709_10000065 3300025935 Bacteria 189826
112 Ga0207669_10000013 3300025937 Bacteria 137417
113 Ga0207669_10000095 3300025937 Bacteria 44549
114 Ga0207704_10179940 3300025938 Bacteria 1527
115 Ga0207691_10037993 3300025940 Bacteria 4456
116 Ga0207711_10009198 3300025941 Bacteria 8253
117 Ga0207667_10000001 3300025949 Bacteria 1178522
118 Ga0207667_10000071 3300025949 Bacteria 178355
119 Ga0207651_10057919 3300025960 Bacteria 2675
120 Ga0207712_10047010 3300025961 Bacteria 2995
121 Ga0207668_10004767 3300025972 Bacteria 7980
122 Ga0207668_10010089 3300025972 Bacteria 5691
123 Ga0207668_10017289 3300025972 Bacteria 4514
124 Ga0207640_10000431 3300025981 Bacteria 25680
125 Ga0207640_10013918 3300025981 Bacteria 4619
126 Ga0207640_10042672 3300025981 Bacteria 2894
127 Ga0207658_10036274 3300025986 Bacteria 3534
128 Ga0207658_10038111 3300025986 Bacteria 3460
129 Ga0207639_10007780 3300026041 Bacteria 7320
130 Ga0207678_10001847 3300026067 Bacteria 19416
131 Ga0207702_10004016 3300026078 Bacteria 13221
132 Ga0207641_10392874 3300026088 Bacteria 1330
133 Ga0207674_10013366 3300026116 Bacteria 9114
134 Ga0207683_10000174 3300026121 Bacteria 55257
135 Ga0207683_10000484 3300026121 Bacteria 36703
136 Ga0207683_10094743 3300026121 Bacteria 2661
137 Ga0207698_10002883 3300026142 Bacteria 10288
138 Ga0268266_10000002 3300028379 Bacteria 3059047
139 Ga0268266_10012261 3300028379 Bacteria 7416
140 Ga0268265_10017572 3300028380 Bacteria 4939
141 Ga0268264_10039813 3300028381 Bacteria 3883
142 Ga0307406_10198664 3300031901 Bacteria 1474
143 Ga0307412_10000896 3300031911 Bacteria 17152
144 Ga0307414_10005402 3300032004 Bacteria 7035
145 Ga0307414_10010251 3300032004 Bacteria 5428
146 Ga0307510_10006416 3300033180 Bacteria 14025
147 Ga0395899_0001695 3300037312 Bacteria 18386
148 Ga0395905_0271820 3300037471 Bacteria 1581
149 Ga0439438_001158 3300041405 Bacteria 11695
150 Ga0439461_0006069 3300041410 Bacteria 2091
151 Ga0439465_0002518 3300041413 Bacteria 5983
152 Ga0439445_0000735 3300042004 Bacteria 6855
153 Ga0439448_0027341 3300042005 Bacteria 1797
154 Ga0439455_0009131 3300042012 Bacteria 2143
155 Ga0439458_0000373 3300042157 Bacteria 11307
156 Ga0466969_0004327 3300044656 Bacteria 7557
157 Ga0466965_0014361 3300044683 Bacteria 3746
158 Ga0466961_0013050 3300044693 Bacteria 5315
159 Ga0466961_0020330 3300044693 Bacteria 4270
160 Ga0466971_0010413 3300044719 Bacteria 4063
161 Ga0466959_0004404 3300045049 Bacteria 9425
162 Ga0466959_0037553 3300045049 Bacteria 3579
163 Ga0495638_0000123 3300046460 Bacteria 125420
164 Ga0495638_0010628 3300046460 Bacteria 6375
165 Ga0495605_0004629 3300046474 Bacteria 8045
166 Ga0495584_0033676 3300046491 Bacteria 2593
167 Ga0495585_0009030 3300046492 Bacteria 6005
168 Ga0495596_0000066 3300046500 Bacteria 77044
169 Ga0495607_0071979 3300046501 Bacteria 1926
170 Ga0495583_0000675 3300046506 Bacteria 44447
171 Ga0495583_0003922 3300046506 Bacteria 11004
172 Ga0495583_0066707 3300046506 Bacteria 1591
173 Ga0495606_0000231 3300046507 Bacteria 98418
174 Ga0495606_0019706 3300046507 Bacteria 5005
175 Ga0495606_0066957 3300046507 Bacteria 2276
176 Ga0495610_0000117 3300046512 Bacteria 90466
177 Ga0495610_0002224 3300046512 Bacteria 16409
178 Ga0495631_0025465 3300046518 Bacteria 2724
179 Ga0495632_0013419 3300046519 Bacteria 4676
180 Ga0495637_0013044 3300046520 Bacteria 3957
181 Ga0495643_0000093 3300046522 Bacteria 152412
182 Ga0495643_0000262 3300046522 Bacteria 76727
183 Ga0495643_0000390 3300046522 Bacteria 57871
184 Ga0495643_0028440 3300046522 Bacteria 3134
185 Ga0495648_0000050 3300046524 Bacteria 163843
186 Ga0495648_0000277 3300046524 Bacteria 57893
187 Ga0495648_0114214 3300046524 Bacteria 1463
188 Ga0495663_0001386 3300046525 Bacteria 7643
189 Ga0495609_0004050 3300046538 Bacteria 8174
190 Ga0495622_0010635 3300046557 Bacteria 4245
191 Ga0495633_0000185 3300046558 Bacteria 81373
192 Ga0495668_0000033 3300046616 Bacteria 254277
193 Ga0495625_0026606 3300046660 Bacteria 4369
194 Ga0495669_0000123 3300046684 Bacteria 50122
195 Ga0495671_0000263 3300046692 Bacteria 44395
196 Ga0495671_0031773 3300046692 Bacteria 2698
197 Ga0495671_0033844 3300046692 Bacteria 2601
198 Ga0495649_0000137 3300046694 Bacteria 63846
199 Ga0495649_0036962 3300046694 Bacteria 2682
200 Ga0495660_0018321 3300046810 Bacteria 4025
201 Ga0495683_0015422 3300047323 Bacteria 3976
202 Ga0495687_000041 3300047443 Bacteria 229171
203 Ga0495687_000204 3300047443 Bacteria 84735
204 Ga0495673_0000460 3300047469 Bacteria 44395
205 Ga0495681_0005488 3300047470 Bacteria 8477
206 Ga0495681_0026645 3300047470 Bacteria 3004
207 Ga0495686_0000476 3300047472 Bacteria 59699
208 Ga0495626_0000852 3300048091 Bacteria 27166
209 Ga0496100_0023951 3300048903 Bacteria 3716
210 Ga0496100_0107071 3300048903 Bacteria 1936
211 Ga0496101_0009467 3300048904 Bacteria 6404
212 Ga0496102_0000051 3300048905 Bacteria 177975
213 Ga0496102_0099605 3300048905 Bacteria 2698
214 Ga0496103_0000045 3300048906 Bacteria 165828
215 Ga0496103_0007921 3300048906 Bacteria 6319
216 Ga0496104_0002862 3300048907 Bacteria 14870
217 Ga0496105_0000264 3300048908 Bacteria 34972
218 Ga0496107_0189867 3300048910 Bacteria 1526
219 Ga0496107_0295526 3300048910 Bacteria 1206
220 Ga0496110_0006663 3300048913 Bacteria 9176
221 Ga0496111_0026708 3300048914 Bacteria 4078
222 Ga0496113_0239207 3300048916 Bacteria 1448
223 Ga0496114_0019706 3300048917 Bacteria 5467
224 Ga0496115_0000026 3300048918 Bacteria 146141
225 Ga0496115_0000288 3300048918 Bacteria 43537
226 Ga0496116_0006758 3300048919 Bacteria 10323
227 Ga0496116_0011431 3300048919 Bacteria 7347
228 Ga0496117_0000046 3300048920 Bacteria 300879
229 Ga0496117_0006612 3300048920 Bacteria 11650
230 Ga0496117_0012010 3300048920 Bacteria 7694
231 Ga0496118_0000036 3300048921 Bacteria 318213
232 Ga0496118_0000901 3300048921 Bacteria 46540
233 Ga0496118_0058033 3300048921 Bacteria 2896
234 Ga0496119_0008925 3300048922 Bacteria 8712
235 Ga0496120_0032430 3300048923 Bacteria 3150
236 Ga0496120_0080516 3300048923 Bacteria 1765
237 Ga0496121_0001170 3300048924 Bacteria 46046
238 Ga0496121_0017934 3300048924 Bacteria 7180
239 Ga0496121_0049948 3300048924 Bacteria 3539
240 Ga0496121_0064525 3300048924 Bacteria 2986
241 Ga0496122_0025604 3300048925 Bacteria 5117
242 Ga0496122_0027856 3300048925 Bacteria 4816
243 Ga0496122_0055453 3300048925 Bacteria 2965
244 Ga0496123_0032714 3300048926 Bacteria 3757
245 Ga0496123_0038136 3300048926 Bacteria 3382
246 Ga0496123_0079301 3300048926 Bacteria 2007
247 Ga0496124_0000011 3300048927 Bacteria 524145
248 Ga0496124_0000054 3300048927 Bacteria 252172
249 Ga0496124_0002777 3300048927 Bacteria 22248
250 Ga0496124_0021035 3300048927 Bacteria 6016
251 Ga0496124_0032184 3300048927 Bacteria 4635
252 Ga0496124_0038933 3300048927 Bacteria 4124
253 Ga0496124_0114131 3300048927 Bacteria 2170
254 Ga0496124_0232739 3300048927 Bacteria 1376
255 Ga0496125_0000501 3300048928 Bacteria 68335
256 Ga0496125_0002202 3300048928 Bacteria 25998
257 Ga0496125_0044423 3300048928 Bacteria 3757
258 Ga0496126_0000128 3300048929 Bacteria 178066
259 Ga0496126_0005237 3300048929 Bacteria 14928
260 Ga0496126_0075420 3300048929 Bacteria 2993
261 Ga0496126_0161301 3300048929 Bacteria 1916
262 Ga0501249_000423 3300049679 Bacteria 10750
263 nmdc:mga00v17_141_c1 3300050491 Bacteria 41598
264 Ga0500610_0000198 3300053079 Bacteria 18330
265 Ga0500643_002858 3300053087 Bacteria 8604
266 Ga0500643_004821 3300053087 Bacteria 5960
267 Ga0500594_0003147 3300053118 Bacteria 3608
268 Ga0500595_000193 3300053119 Bacteria 41558
269 Ga0500618_006114 3300053125 Bacteria 3566
270 Ga0500642_0000222 3300053130 Bacteria 22594
271 Ga0500658_0001193 3300053134 Bacteria 10583
272 Ga0500559_0000060 3300053136 Bacteria 87673
273 Ga0500624_000115 3300053157 Bacteria 37706
274 Ga0500636_0009777 3300053177 Bacteria 5585
275 Ga0500645_000204 3300053730 Bacteria 45897
276 Ga0466962_0083859 3300061719 Bacteria 1525
277 2511127420 2510917021 Bacteria 5705459
278 2596371384 2595698237 Bacteria 6712432
279 2600201973 2599185354 Bacteria 4398675
280 2600226740 2599185359 Bacteria 4772316
281 2601623693 2600255283 Bacteria 6061572
282 2601643720 2600255287 Bacteria 5210468
283 2601663544 2600255291 Bacteria 5217298
284 2601696575 2600255298 Bacteria 5215185
285 2601701176 2600255299 Bacteria 5218662
286 2601721599 2600255303 Bacteria 5219315
287 2602009593 2600255389 Bacteria 5275336
288 2603660930 2602042052 Bacteria 5215873
289 2603666204 2602042053 Bacteria 5214361
290 2603877017 2602042111 Bacteria 5212080
291 2606070637 2603880184 Bacteria 5217896
292 2643727562 2643221541 Bacteria 5498788
293 2644041278 2643221606 Bacteria 5588032
294 2644128685 2643221622 Bacteria 4212502
295 2644353722 2643221663 Bacteria 3425771
296 2644394818 2643221671 Bacteria 5496681
297 2644730445 2643221733 Bacteria 5690728
298 2753767742 2751185897 Bacteria 5322941
299 2765583268 2765235841 Bacteria 6137024
300 2819715010 2818991466 Bacteria 4748179
301 2908669963 2908669403 Bacteria 5740494
302 2919128394 2919125081 Bacteria 5385106
303 2919504282 2919501602 Bacteria 5286340
304 2926065145 2926063275 Bacteria 5285848
305 2928028074 2928027323 Bacteria 4382488
306 2928126318 2928125067 Bacteria 5937560
307 2928529424 2928526807 Bacteria 4760224
308 2928968931 2928968154 Bacteria 4633371
309 2928969956 2928968154 Bacteria 4633371
310 2939611098 2939607340 Bacteria 4719256
311 2946788421 2946787523 Bacteria 4366789
312 2984507380 2984504281 Bacteria 5262371
313 2984567190 2984564862 Bacteria 4339992
314 2990267282 2990265787 Bacteria 3943888
315 2993694235 2993693658 Bacteria 4040749
316 3007319357 3007315729 Bacteria 5076637
317 8016730508 8016728285 Bacteria 5263933
318 8054931798 8054929484 Bacteria 5599761
319 8057101836 8057101203 Bacteria 5034064
320 SwRhRL2b_contig_2289305
321 SwRhRL2b_contig_81309
322 JGI24741J21665_1001151
323 JGI24739J22299_10005317
324 JGI24737J22298_10001069
325 JGI24034J26672_10004621
326 JGI25150J39212_1000479
327 JGI25153J46596_10000011
328 JGI25153J46596_10000064
329 rootH1_10025344
330 Ga0055525_1000216
331 Ga0055542_1000038
332 Ga0055529_1000002
333 Ga0055529_1000021
334 Ga0055526_1002619
335 Ga0055537_1003868
336 Ga0055530_10013056
337 Ga0055531_10009970
338 Ga0065165_1004128
339 Ga0065704_10070220
340 Ga0065704_10070766
341 Ga0065704_10077469
342 Ga0070658_10000246
343 Ga0070670_100060585
344 Ga0070666_10143752
345 Ga0070660_100002593
346 Ga0070661_100002119
347 Ga0070661_100039155
348 Ga0070668_100019483
349 Ga0070668_100033630
350 Ga0070669_100011369
351 Ga0070675_100230438
352 Ga0070671_100000882
353 Ga0070671_100023545
354 Ga0070671_100035868
355 Ga0070674_100000010
356 Ga0070674_100017865
357 Ga0070673_100048427
358 Ga0070667_100003962
359 Ga0070678_100000002
360 Ga0070678_100000116
361 Ga0070678_100230513
362 Ga0070662_100130374
363 Ga0070684_100058949
364 Ga0068853_100244531
365 Ga0070672_100026711
366 Ga0070672_100221232
367 Ga0070665_100000535
368 Ga0070665_100001418
369 Ga0070665_100014976
370 Ga0068855_100000062
371 Ga0070664_100025884
372 Ga0068854_100077747
373 Ga0068851_10034696
374 Ga0068858_100006420
375 Ga0068862_100019080
376 Ga0068862_100077175
377 Ga0075364_10014581
378 Ga0097621_100138474
379 Ga0068871_100018492
380 Ga0068865_100237253
381 Ga0097620_100124335
382 Ga0105243_10000113
383 Ga0105241_10002111
384 Ga0105248_10109726
385 Ga0105237_10046012
386 Ga0105237_10049463
387 Ga0105249_10038648
388 Ga0157371_10000114
389 Ga0157371_10126261
390 Ga0157369_10001166
391 Ga0157369_10066582
392 Ga0163162_10040677
393 Ga0163161_10045331
394 Ga0209674_102265
395 Ga0209563_100081
396 Ga0209148_1000008
397 Ga0209565_1000166
398 Ga0209455_1000002
399 Ga0209673_1017376
400 Ga0209676_1007765
401 Ga0209564_1001888
402 Ga0209758_1000007
403 Ga0209050_1000001
404 Ga0209050_1007489
405 Ga0209051_1000415
406 Ga0209257_1003186
407 Ga0207696_1000429
408 Ga0207688_10109496
409 Ga0207647_10046622
410 Ga0207705_10000705
411 Ga0207654_10003496
412 Ga0207695_10041434
413 Ga0207671_10009170
414 Ga0207671_10014804
415 Ga0207671_10062536
416 Ga0207657_10005590
417 Ga0207657_10020745
418 Ga0207657_10069268
419 Ga0207649_10000104
420 Ga0207681_10000676
421 Ga0207694_10014074
422 Ga0207659_10301414
423 Ga0207644_10000449
424 Ga0207644_10007240
425 Ga0207644_10017969
426 Ga0207644_10058882
427 Ga0207690_10001770
428 Ga0207706_10041729
429 Ga0207709_10000065
430 Ga0207669_10000013
431 Ga0207669_10000095
432 Ga0207704_10179940
433 Ga0207691_10037993
434 Ga0207711_10009198
435 Ga0207667_10000001
436 Ga0207667_10000071
437 Ga0207651_10057919
438 Ga0207712_10047010
439 Ga0207668_10004767
440 Ga0207668_10010089
441 Ga0207668_10017289
442 Ga0207640_10000431
443 Ga0207640_10013918
444 Ga0207640_10042672
445 Ga0207658_10036274
446 Ga0207658_10038111
447 Ga0207639_10007780
448 Ga0207678_10001847
449 Ga0207702_10004016
450 Ga0207641_10392874
451 Ga0207674_10013366
452 Ga0207683_10000174
453 Ga0207683_10000484
454 Ga0207683_10094743
455 Ga0207698_10002883
456 Ga0268266_10000002
457 Ga0268266_10012261
458 Ga0268265_10017572
459 Ga0268264_10039813
460 Ga0307406_10198664
461 Ga0307412_10000896
462 Ga0307414_10005402
463 Ga0307414_10010251
464 Ga0307510_10006416
465 Ga0395899_0001695
466 Ga0395905_0271820
467 Ga0439438_001158
468 Ga0439461_0006069
469 Ga0439465_0002518
470 Ga0439445_0000735
471 Ga0439448_0027341
472 Ga0439455_0009131
473 Ga0439458_0000373
474 Ga0466969_0004327
475 Ga0466965_0014361
476 Ga0466961_0013050
477 Ga0466961_0020330
478 Ga0466971_0010413
479 Ga0466959_0004404
480 Ga0466959_0037553
481 Ga0495638_0000123
482 Ga0495638_0010628
483 Ga0495605_0004629
484 Ga0495584_0033676
485 Ga0495585_0009030
486 Ga0495596_0000066
487 Ga0495607_0071979
488 Ga0495583_0000675
489 Ga0495583_0003922
490 Ga0495583_0066707
491 Ga0495606_0000231
492 Ga0495606_0019706
493 Ga0495606_0066957
494 Ga0495610_0000117
495 Ga0495610_0002224
496 Ga0495631_0025465
497 Ga0495632_0013419
498 Ga0495637_0013044
499 Ga0495643_0000093
500 Ga0495643_0000262
501 Ga0495643_0000390
502 Ga0495643_0028440
503 Ga0495648_0000050
504 Ga0495648_0000277
505 Ga0495648_0114214
506 Ga0495663_0001386
507 Ga0495609_0004050
508 Ga0495622_0010635
509 Ga0495633_0000185
510 Ga0495668_0000033
511 Ga0495625_0026606
512 Ga0495669_0000123
513 Ga0495671_0000263
514 Ga0495671_0031773
515 Ga0495671_0033844
516 Ga0495649_0000137
517 Ga0495649_0036962
518 Ga0495660_0018321
519 Ga0495683_0015422
520 Ga0495687_000041
521 Ga0495687_000204
522 Ga0495673_0000460
523 Ga0495681_0005488
524 Ga0495681_0026645
525 Ga0495686_0000476
526 Ga0495626_0000852
527 Ga0496100_0023951
528 Ga0496100_0107071
529 Ga0496101_0009467
530 Ga0496102_0000051
531 Ga0496102_0099605
532 Ga0496103_0000045
533 Ga0496103_0007921
534 Ga0496104_0002862
535 Ga0496105_0000264
536 Ga0496107_0189867
537 Ga0496107_0295526
538 Ga0496110_0006663
539 Ga0496111_0026708
540 Ga0496113_0239207
541 Ga0496114_0019706
542 Ga0496115_0000026
543 Ga0496115_0000288
544 Ga0496116_0006758
545 Ga0496116_0011431
546 Ga0496117_0000046
547 Ga0496117_0006612
548 Ga0496117_0012010
549 Ga0496118_0000036
550 Ga0496118_0000901
551 Ga0496118_0058033
552 Ga0496119_0008925
553 Ga0496120_0032430
554 Ga0496120_0080516
555 Ga0496121_0001170
556 Ga0496121_0017934
557 Ga0496121_0049948
558 Ga0496121_0064525
559 Ga0496122_0025604
560 Ga0496122_0027856
561 Ga0496122_0055453
562 Ga0496123_0032714
563 Ga0496123_0038136
564 Ga0496123_0079301
565 Ga0496124_0000011
566 Ga0496124_0000054
567 Ga0496124_0002777
568 Ga0496124_0021035
569 Ga0496124_0032184
570 Ga0496124_0038933
571 Ga0496124_0114131
572 Ga0496124_0232739
573 Ga0496125_0000501
574 Ga0496125_0002202
575 Ga0496125_0044423
576 Ga0496126_0000128
577 Ga0496126_0005237
578 Ga0496126_0075420
579 Ga0496126_0161301
580 Ga0501249_000423
581 nmdc:mga00v17_141_c1
582 Ga0500610_0000198
583 Ga0500643_002858
584 Ga0500643_004821
585 Ga0500594_0003147
586 Ga0500595_000193
587 Ga0500618_006114
588 Ga0500642_0000222
589 Ga0500658_0001193
590 Ga0500559_0000060
591 Ga0500624_000115
592 Ga0500636_0009777
593 Ga0500645_000204
594 Ga0466962_0083859
595 2511127420
596 2596371384
597 2600201973
598 2600226740
599 2601623693
600 2601643720
601 2601663544
602 2601696575
603 2601701176
604 2601721599
605 2602009593
606 2603660930
607 2603666204
608 2603877017
609 2606070637
610 2643727562
611 2644041278
612 2644128685
613 2644353722
614 2644394818
615 2644730445
616 2753767742
617 2765583268
618 2819715010
619 2908669963
620 2919128394
621 2919504282
622 2926065145
623 2928028074
624 2928126318
625 2928529424
626 2928968931
627 2928969956
628 2939611098
629 2946788421
630 2984507380
631 2984567190
632 2990267282
633 2993694235
634 3007319357
635 8016730508
636 8054931798
637 8057101836

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

15

338

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8616 8 341
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.8457 9 348
6kki-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation 0.841 8 355
8pnl-assembly1.cif.gz_A outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.8336 8 341
6zgs-assembly1.cif.gz_A crystal structure of a mfs transporter with bound 3-phenylpropanoic acid at 2.39 angstroem resolution 0.8258 8 352
ID Description Score Start End Superfamily
af_P77389_5_379_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9682 9 346 1.20.1250.20
af_P9WJX7_21_217_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9648 9 189 1.20.1250.20
af_P41036_15_224_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9297 8 186 1.20.1250.20
af_P0AA76_9_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9244 10 185 1.20.1250.20
af_P36554_12_217_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9227 11 185 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1I5Y5K8-F1-model_v4 MFS transporter, DHA1 family, inner membrane transport protein 0.9795 6 347 GO:0005886
GO:0022857
AF-A0A7X5UUT6-F1-model_v4 DHA1 family inner membrane transport protein 0.9741 6 347 GO:0005886
GO:0022857
AF-A0A370FHG4-F1-model_v4 DHA1 family inner membrane transport protein 0.9733 8 347 GO:0005886
GO:0022857
AF-A0A5C8GA86-F1-model_v4 MFS transporter 0.9723 9 347 GO:0005886
GO:0022857
AF-A0A370G320-F1-model_v4 DHA1 family inner membrane transport protein 0.9697 41 342 GO:0005886
GO:0022857

Map