F404774

General Info

Members Datasets Scaffolds Average Seq Length
318 244 636 167

Family's Representative Sequence

Representative Sequence 3300046809|Ga0495600_0608118|Ga0495600_0608118_14_514
Length 166
Sequence MRQQTPERPYNVLFLCTGNSARSILAEAILNKVGAGKFKAFSAGSHPAGKVNPQALALLARSGFGTDGYRSKSWDEFAGGPELDFVFTVCDNAANEVCPAWPGQPMTAHWGVPDPAAVTGTPDEIARVFREAFTLLQRRIELFANLPVASLDRLSLKARLDDIGRT

Samples

Sample ID Description Type Environment
1 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
145 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
182 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 2508501050 Microvirga lupini Lut6 Isolate Nodule
236 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
237 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
238 2738543024 Aminobacter sp. AP02 Isolate Unclassified
239 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
240 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
241 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
242 2941479691
243 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
244 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.54
Metatranscriptomes 0
Isolates 3.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 1.89
Rhizoplane 0.63
Rhizosphere 91.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495600_0608118 3300046809 Bacteria 664
2 MRS1b_contig_7348067 2162886011 Bacteria 1316
3 MBSR1b_contig_10541589 2162886012 Bacteria 2341
4 JGI24741J21665_1000956 3300001915 Bacteria 8693
5 JGI24740J21852_10012366 3300001979 Bacteria 3219
6 JGI24739J22299_10002425 3300001989 Bacteria 7194
7 Ga0065712_10154926 3300005290 Bacteria 1338
8 Ga0065715_10110543 3300005293 Bacteria 2616
9 Ga0070658_10007080 3300005327 Bacteria 9052
10 Ga0070683_100031567 3300005329 Bacteria 4818
11 Ga0070690_100048663 3300005330 Bacteria 2700
12 Ga0070670_100083030 3300005331 Bacteria 2753
13 Ga0070670_100114895 3300005331 Bacteria 2320
14 Ga0070677_10003179 3300005333 Bacteria 5284
15 Ga0068869_100163537 3300005334 Bacteria 1734
16 Ga0070680_100021313 3300005336 Bacteria 5149
17 Ga0070682_100258429 3300005337 Bacteria 1259
18 Ga0068868_100070089 3300005338 Bacteria 2795
19 Ga0070660_100030312 3300005339 Bacteria 4058
20 Ga0070687_100143856 3300005343 Bacteria 1392
21 Ga0070661_100011049 3300005344 Bacteria 6290
22 Ga0070668_100963038 3300005347 Bacteria 765
23 Ga0070669_100057598 3300005353 Bacteria 2851
24 Ga0070675_100057646 3300005354 Bacteria 3203
25 Ga0070675_100087178 3300005354 Bacteria 2610
26 Ga0070671_100035404 3300005355 Bacteria 4136
27 Ga0070674_100028865 3300005356 Bacteria 3646
28 Ga0070673_100087292 3300005364 Bacteria 2542
29 Ga0070688_100122656 3300005365 Bacteria 1743
30 Ga0070667_100014227 3300005367 Bacteria 6573
31 Ga0070709_10000705 3300005434 Bacteria 18959
32 Ga0070714_100071216 3300005435 Bacteria 3005
33 Ga0070713_100000016 3300005436 Bacteria 121229
34 Ga0070710_10032500 3300005437 Bacteria 2827
35 Ga0070710_10659836 3300005437 Bacteria 734
36 Ga0070701_10028205 3300005438 Bacteria 2759
37 Ga0070711_100052559 3300005439 Bacteria 2804
38 Ga0070705_100013255 3300005440 Bacteria 4212
39 Ga0070663_100005330 3300005455 Bacteria 7630
40 Ga0070678_100061546 3300005456 Bacteria 2767
41 Ga0070662_100038505 3300005457 Bacteria 3396
42 Ga0070681_10320581 3300005458 Bacteria 1459
43 Ga0068867_100021952 3300005459 Bacteria 4559
44 Ga0070685_10526401 3300005466 Bacteria 840
45 Ga0070679_100032691 3300005530 Bacteria 5148
46 Ga0070679_100201409 3300005530 Bacteria 1957
47 Ga0068853_100043393 3300005539 Bacteria 3846
48 Ga0070672_100088134 3300005543 Bacteria 2498
49 Ga0070686_100048333 3300005544 Bacteria 2695
50 Ga0070695_100177419 3300005545 Bacteria 1507
51 Ga0070693_100634311 3300005547 Bacteria 775
52 Ga0068855_100031277 3300005563 Bacteria 6357
53 Ga0070664_100051756 3300005564 Bacteria 3477
54 Ga0068857_100018052 3300005577 Bacteria 6189
55 Ga0068854_100406125 3300005578 Bacteria 1128
56 Ga0068856_100029189 3300005614 Bacteria 5387
57 Ga0068856_100760779 3300005614 Bacteria 989
58 Ga0070702_100044788 3300005615 Bacteria 2500
59 Ga0068852_100448171 3300005616 Bacteria 1277
60 Ga0068859_100017723 3300005617 Bacteria 7159
61 Ga0068859_100251450 3300005617 Bacteria 1858
62 Ga0068864_100089041 3300005618 Bacteria 2719
63 Ga0068866_10018407 3300005718 Bacteria 3158
64 Ga0068863_100034554 3300005841 Bacteria 4815
65 Ga0068858_100603016 3300005842 Bacteria 1065
66 Ga0068860_100032657 3300005843 Bacteria 5000
67 Ga0068860_100077831 3300005843 Bacteria 3154
68 Ga0068862_100089099 3300005844 Bacteria 2685
69 Ga0068862_100271064 3300005844 Bacteria 1552
70 Ga0068862_100609829 3300005844 Bacteria 1049
71 Ga0068862_100806470 3300005844 Bacteria 917
72 Ga0081455_10130315 3300005937 Bacteria 1967
73 Ga0070712_100000347 3300006175 Bacteria 26219
74 Ga0097621_100058118 3300006237 Bacteria 3164
75 Ga0068871_100072281 3300006358 Bacteria 2840
76 Ga0075434_100261958 3300006871 Bacteria 1748
77 Ga0068865_100052508 3300006881 Bacteria 2825
78 Ga0068865_100344151 3300006881 Bacteria 1206
79 Ga0075436_100001679 3300006914 Bacteria 15136
80 Ga0097620_100017723 3300006931 Bacteria 7159
81 Ga0097620_100251464 3300006931 Bacteria 1858
82 Ga0105240_10044898 3300009093 Bacteria 5610
83 Ga0111539_10764868 3300009094 Bacteria 1124
84 Ga0105243_10026912 3300009148 Bacteria 4405
85 Ga0105241_10620880 3300009174 Bacteria 978
86 Ga0105242_10037074 3300009176 Bacteria 3915
87 Ga0105242_10113602 3300009176 Bacteria 2313
88 Ga0105248_10033162 3300009177 Bacteria 5769
89 Ga0105248_10060338 3300009177 Bacteria 4257
90 Ga0105248_10375947 3300009177 Bacteria 1599
91 Ga0105249_10250944 3300009553 Bacteria 1754
92 Ga0157373_10072003 3300013100 Bacteria 2440
93 Ga0157371_10062082 3300013102 Bacteria 2649
94 Ga0157370_10692498 3300013104 Bacteria 930
95 Ga0157374_10232720 3300013296 Bacteria 1810
96 Ga0157378_10027068 3300013297 Bacteria 5058
97 Ga0163162_10125365 3300013306 Bacteria 2674
98 Ga0163162_10422400 3300013306 Bacteria 1465
99 Ga0157372_10168279 3300013307 Bacteria 2535
100 Ga0157375_10056317 3300013308 Bacteria 3881
101 Ga0163163_10089708 3300014325 Bacteria 3087
102 Ga0163163_10416647 3300014325 Bacteria 1402
103 Ga0157380_10085620 3300014326 Bacteria 2587
104 Ga0157379_10061848 3300014968 Bacteria 3349
105 Ga0157379_10076480 3300014968 Bacteria 2998
106 Ga0157379_10091067 3300014968 Bacteria 2736
107 Ga0157376_10074328 3300014969 Bacteria 2897
108 Ga0163161_10046854 3300017792 Bacteria 3120
109 Ga0213874_10003885 3300021377 Bacteria 3360
110 Ga0213876_10078618 3300021384 Bacteria 1743
111 Ga0207682_10005849 3300025893 Bacteria 4985
112 Ga0207692_10025153 3300025898 Bacteria 2777
113 Ga0207642_10013686 3300025899 Bacteria 2968
114 Ga0207688_10246890 3300025901 Bacteria 1080
115 Ga0207680_10044631 3300025903 Bacteria 2608
116 Ga0207699_10034822 3300025906 Bacteria 2860
117 Ga0207645_10008822 3300025907 Bacteria 7006
118 Ga0207643_10006632 3300025908 Bacteria 6207
119 Ga0207654_10205967 3300025911 Bacteria 1298
120 Ga0207707_10067045 3300025912 Bacteria 3126
121 Ga0207695_10088772 3300025913 Bacteria 3110
122 Ga0207693_10000876 3300025915 Bacteria 26927
123 Ga0207663_10053035 3300025916 Bacteria 2532
124 Ga0207660_10004209 3300025917 Bacteria 9367
125 Ga0207662_10155348 3300025918 Bacteria 1458
126 Ga0207657_10002437 3300025919 Bacteria 20086
127 Ga0207652_10004131 3300025921 Bacteria 11848
128 Ga0207652_10124721 3300025921 Bacteria 2293
129 Ga0207681_10061985 3300025923 Bacteria 2573
130 Ga0207650_10066301 3300025925 Bacteria 2707
131 Ga0207650_10112973 3300025925 Bacteria 2105
132 Ga0207659_10082946 3300025926 Bacteria 2375
133 Ga0207700_10000005 3300025928 Bacteria 394836
134 Ga0207664_10185146 3300025929 Bacteria 1790
135 Ga0207644_10016917 3300025931 Bacteria 4913
136 Ga0207690_10003199 3300025932 Bacteria 9832
137 Ga0207706_10005585 3300025933 Bacteria 11719
138 Ga0207686_10020363 3300025934 Bacteria 3789
139 Ga0207686_10032388 3300025934 Bacteria 3111
140 Ga0207670_10017239 3300025936 Bacteria 4363
141 Ga0207669_10010601 3300025937 Bacteria 4442
142 Ga0207704_10043330 3300025938 Bacteria 2656
143 Ga0207665_10042485 3300025939 Bacteria 3038
144 Ga0207691_10076105 3300025940 Bacteria 3025
145 Ga0207711_10155363 3300025941 Bacteria 2067
146 Ga0207689_10256171 3300025942 Bacteria 1447
147 Ga0207661_10763503 3300025944 Bacteria 890
148 Ga0207667_10061797 3300025949 Bacteria 3918
149 Ga0207651_10058750 3300025960 Bacteria 2659
150 Ga0207712_10167031 3300025961 Bacteria 1716
151 Ga0207668_10380975 3300025972 Bacteria 1187
152 Ga0207640_10006227 3300025981 Bacteria 6538
153 Ga0207658_10019121 3300025986 Bacteria 4737
154 Ga0207677_10147780 3300026023 Bacteria 1808
155 Ga0207703_10298016 3300026035 Bacteria 1470
156 Ga0207678_10012675 3300026067 Bacteria 7408
157 Ga0207702_10000102 3300026078 Bacteria 99313
158 Ga0207641_10087817 3300026088 Bacteria 2713
159 Ga0207641_10550623 3300026088 Bacteria 1125
160 Ga0207648_10043127 3300026089 Bacteria 3961
161 Ga0207676_10055676 3300026095 Bacteria 3106
162 Ga0207674_10019349 3300026116 Bacteria 7376
163 Ga0207683_10003667 3300026121 Bacteria 13353
164 Ga0268266_10062297 3300028379 Bacteria 3219
165 Ga0268265_10054503 3300028380 Bacteria 3035
166 Ga0268265_10499394 3300028380 Bacteria 1146
167 Ga0268265_10774602 3300028380 Bacteria 933
168 Ga0268264_10025117 3300028381 Bacteria 4867
169 Ga0268264_10046427 3300028381 Bacteria 3607
170 Ga0268264_10989227 3300028381 Bacteria 847
171 Ga0265330_10044015 3300031235 Bacteria 1973
172 Ga0265332_10089841 3300031238 Bacteria 1299
173 Ga0265340_10017752 3300031247 Bacteria 3681
174 Ga0265340_10063132 3300031247 Bacteria 1768
175 Ga0265327_10011821 3300031251 Bacteria 5966
176 Ga0265316_10033625 3300031344 Bacteria 4173
177 Ga0265316_10437030 3300031344 Bacteria 940
178 Ga0307408_100058588 3300031548 Bacteria 2800
179 Ga0307408_100081578 3300031548 Bacteria 2418
180 Ga0265314_10000546 3300031711 Bacteria 48217
181 Ga0307516_10136639 3300031730 Bacteria 2225
182 Ga0307516_10291568 3300031730 Bacteria 1310
183 Ga0307405_10002056 3300031731 Bacteria 8749
184 Ga0307405_10007953 3300031731 Bacteria 5344
185 Ga0307413_10052167 3300031824 Bacteria 2468
186 Ga0307410_10041309 3300031852 Bacteria 3040
187 Ga0307410_10108304 3300031852 Bacteria 2006
188 Ga0307410_10932415 3300031852 Bacteria 745
189 Ga0307406_10000566 3300031901 Bacteria 21309
190 Ga0307406_10099238 3300031901 Bacteria 1979
191 Ga0307407_10009087 3300031903 Bacteria 4609
192 Ga0307412_10026572 3300031911 Bacteria 3599
193 Ga0307412_10177866 3300031911 Bacteria 1597
194 Ga0307409_100003788 3300031995 Bacteria 8326
195 Ga0307409_100330983 3300031995 Bacteria 1429
196 Ga0307416_100001154 3300032002 Bacteria 14190
197 Ga0307414_10000897 3300032004 Bacteria 15247
198 Ga0307414_11137255 3300032004 Bacteria 722
199 Ga0307411_10000460 3300032005 Bacteria 14059
200 Ga0307411_10095838 3300032005 Bacteria 2084
201 Ga0307415_100025716 3300032126 Bacteria 3700
202 Ga0307415_100142722 3300032126 Bacteria 1831
203 Ga0373953_0085250 3300035117 Bacteria 1318
204 Ga0373943_0051976 3300035170 Bacteria 2019
205 Ga0373943_0553517 3300035170 Bacteria 675
206 Ga0373955_0338939 3300035172 Bacteria 910
207 Ga0373924_0057522 3300035410 Bacteria 1622
208 Ga0373931_0031539 3300035691 Bacteria 2736
209 Ga0373935_0020915 3300035692 Bacteria 4003
210 Ga0373927_0160828 3300035695 Bacteria 1471
211 Ga0373933_0305705 3300035724 Bacteria 1030
212 Ga0373947_0342715 3300035725 Bacteria 1002
213 Ga0373937_0028589 3300036401 Bacteria 5046
214 Ga0373937_0049235 3300036401 Bacteria 3859
215 Ga0373937_0304853 3300036401 Bacteria 1506
216 Ga0373937_1328997 3300036401 Bacteria 667
217 Ga0373925_0031264 3300037068 Bacteria 3911
218 Ga0373925_0046879 3300037068 Bacteria 3215
219 Ga0373925_0365351 3300037068 Bacteria 1174
220 Ga0373925_0479936 3300037068 Bacteria 1020
221 Ga0373925_0587589 3300037068 Bacteria 917
222 Ga0373925_0769712 3300037068 Bacteria 794
223 Ga0395899_0512569 3300037312 Bacteria 776
224 Ga0395900_0005886 3300037418 Bacteria 12806
225 Ga0395898_0017284 3300037466 Bacteria 7367
226 Ga0395905_0019996 3300037471 Bacteria 6344
227 Ga0395905_0038659 3300037471 Bacteria 4476
228 Ga0395901_0047231 3300038443 Bacteria 4470
229 Ga0436365_0103003 3300039437 Bacteria 2757
230 Ga0436363_0098309 3300039450 Bacteria 27510
231 Ga0436362_1278724 3300039453 Bacteria 1303
232 Ga0450890_020234 3300042127 Bacteria 900
233 Ga0451576_0596211 3300045051 Bacteria 1161
234 Ga0495603_0205413 3300046455 Bacteria 1138
235 Ga0495629_0185905 3300046459 Bacteria 1439
236 Ga0495629_0227048 3300046459 Bacteria 1287
237 Ga0495580_0137468 3300046472 Bacteria 1694
238 Ga0495580_0162179 3300046472 Bacteria 1547
239 Ga0495582_0064764 3300046473 Bacteria 2019
240 Ga0495582_0258936 3300046473 Bacteria 998
241 Ga0495606_0197791 3300046507 Bacteria 1148
242 Ga0495628_0119341 3300046516 Bacteria 2024
243 Ga0495630_0608910 3300046517 Bacteria 837
244 Ga0495630_0893952 3300046517 Bacteria 677
245 Ga0495652_0539387 3300046529 Bacteria 804
246 Ga0495586_0135241 3300046535 Bacteria 1381
247 Ga0495645_0114904 3300046543 Bacteria 1901
248 Ga0495635_0151325 3300046663 Bacteria 1580
249 Ga0495658_0087138 3300046683 Bacteria 1843
250 Ga0495613_0467683 3300046689 Bacteria 853
251 Ga0495676_0244522 3300047321 Bacteria 1227
252 Ga0495684_0060184 3300047471 Bacteria 2892
253 Ga0495684_0201454 3300047471 Bacteria 1467
254 Ga0495602_0426298 3300048088 Bacteria 941
255 Ga0496104_0081202 3300048907 Bacteria 3092
256 Ga0496105_0160079 3300048908 Bacteria 1848
257 Ga0496118_0016017 3300048921 Bacteria 6903
258 Ga0496119_0026512 3300048922 Bacteria 4016
259 Ga0496120_0009298 3300048923 Bacteria 6989
260 Ga0496121_0000159 3300048924 Bacteria 147049
261 Ga0496121_0110888 3300048924 Bacteria 2093
262 Ga0496123_0014881 3300048926 Bacteria 6419
263 Ga0496124_0432155 3300048927 Bacteria 903
264 Ga0496125_0000005 3300048928 Bacteria 827598
265 Ga0496126_0043808 3300048929 Bacteria 4126
266 Ga0501031_0042710 3300049568 Bacteria 2959
267 Ga0501032_0382224 3300049569 Bacteria 905
268 Ga0501033_0000921 3300049570 Bacteria 26896
269 Ga0501033_0155485 3300049570 Bacteria 1648
270 Ga0501034_0122322 3300049571 Bacteria 2588
271 Ga0501034_0483107 3300049571 Bacteria 1154
272 Ga0501036_0252927 3300049572 Bacteria 1476
273 Ga0501037_0021490 3300049573 Bacteria 4770
274 Ga0501037_0660285 3300049573 Bacteria 698
275 Ga0501047_0104752 3300049581 Bacteria 2709
276 Ga0501047_0144191 3300049581 Bacteria 2259
277 Ga0501047_0212877 3300049581 Bacteria 1791
278 Ga0501047_0306605 3300049581 Bacteria 1429
279 Ga0501048_1066692 3300049582 Bacteria 581
280 Ga0501069_0674177 3300049585 Bacteria 623
281 Ga0501070_0000018 3300049586 Bacteria 172755
282 Ga0501072_0188587 3300049588 Bacteria 1645
283 Ga0501075_0652574 3300049591 Bacteria 802
284 Ga0501076_0073243 3300049592 Bacteria 2743
285 Ga0501079_0068086 3300049741 Bacteria 2748
286 Ga0501080_0003220 3300049742 Bacteria 14405
287 Ga0501080_0004780 3300049742 Bacteria 12082
288 Ga0501080_0795470 3300049742 Bacteria 830
289 Ga0501035_0004935 3300049822 Bacteria 12655
290 Ga0501035_0012265 3300049822 Bacteria 7923
291 Ga0501035_0130917 3300049822 Bacteria 2187
292 Ga0501035_0300495 3300049822 Bacteria 1352
293 Ga0501035_0756410 3300049822 Bacteria 779
294 Ga0501044_0002058 3300049823 Bacteria 23194
295 Ga0501044_0003985 3300049823 Bacteria 16538
296 Ga0501044_0305435 3300049823 Bacteria 1519
297 Ga0501044_0310362 3300049823 Bacteria 1504
298 nmdc:mga08y16_504269_c1 3300050511 Bacteria 1229
299 nmdc:mga0n895_259445_c1 3300050512 Bacteria 1764
300 nmdc:mga0rr50_6201_c1 3300050513 Bacteria 7245
301 nmdc:mga08x19_160_c1 3300050514 Bacteria 55694
302 Ga0495601_0111371 3300053077 Bacteria 1773
303 Ga0495595_0016142 3300053084 Bacteria 3190
304 Ga0495595_0199678 3300053084 Bacteria 995
305 Ga0495619_0086051 3300053085 Bacteria 2124
306 Ga0501082_0413368 3300060353 Bacteria 1178
307 Ga0501082_0552858 3300060353 Bacteria 1007
308 2508727769 2508501050 Bacteria 9633614
309 2513957708 2513237150 Bacteria 6553639
310 2514045563 2513237165 Bacteria 6771773
311 2739309822 2738543024 Bacteria 5603683
312 2776264237 2775506901 Bacteria 9631051
313 2817455797 2816332286 Bacteria 6853759
314 2894235897 2894232714 Bacteria 8834183
315 2894236407 2894232714 Bacteria 8834183
316 2941482967
317 2996310824 2996310559 Bacteria 6357320
318 644750042 644736347 Bacteria 6476522
319 Ga0495600_0608118
320 MRS1b_contig_7348067
321 MBSR1b_contig_10541589
322 JGI24741J21665_1000956
323 JGI24740J21852_10012366
324 JGI24739J22299_10002425
325 Ga0065712_10154926
326 Ga0065715_10110543
327 Ga0070658_10007080
328 Ga0070683_100031567
329 Ga0070690_100048663
330 Ga0070670_100083030
331 Ga0070670_100114895
332 Ga0070677_10003179
333 Ga0068869_100163537
334 Ga0070680_100021313
335 Ga0070682_100258429
336 Ga0068868_100070089
337 Ga0070660_100030312
338 Ga0070687_100143856
339 Ga0070661_100011049
340 Ga0070668_100963038
341 Ga0070669_100057598
342 Ga0070675_100057646
343 Ga0070675_100087178
344 Ga0070671_100035404
345 Ga0070674_100028865
346 Ga0070673_100087292
347 Ga0070688_100122656
348 Ga0070667_100014227
349 Ga0070709_10000705
350 Ga0070714_100071216
351 Ga0070713_100000016
352 Ga0070710_10032500
353 Ga0070710_10659836
354 Ga0070701_10028205
355 Ga0070711_100052559
356 Ga0070705_100013255
357 Ga0070663_100005330
358 Ga0070678_100061546
359 Ga0070662_100038505
360 Ga0070681_10320581
361 Ga0068867_100021952
362 Ga0070685_10526401
363 Ga0070679_100032691
364 Ga0070679_100201409
365 Ga0068853_100043393
366 Ga0070672_100088134
367 Ga0070686_100048333
368 Ga0070695_100177419
369 Ga0070693_100634311
370 Ga0068855_100031277
371 Ga0070664_100051756
372 Ga0068857_100018052
373 Ga0068854_100406125
374 Ga0068856_100029189
375 Ga0068856_100760779
376 Ga0070702_100044788
377 Ga0068852_100448171
378 Ga0068859_100017723
379 Ga0068859_100251450
380 Ga0068864_100089041
381 Ga0068866_10018407
382 Ga0068863_100034554
383 Ga0068858_100603016
384 Ga0068860_100032657
385 Ga0068860_100077831
386 Ga0068862_100089099
387 Ga0068862_100271064
388 Ga0068862_100609829
389 Ga0068862_100806470
390 Ga0081455_10130315
391 Ga0070712_100000347
392 Ga0097621_100058118
393 Ga0068871_100072281
394 Ga0075434_100261958
395 Ga0068865_100052508
396 Ga0068865_100344151
397 Ga0075436_100001679
398 Ga0097620_100017723
399 Ga0097620_100251464
400 Ga0105240_10044898
401 Ga0111539_10764868
402 Ga0105243_10026912
403 Ga0105241_10620880
404 Ga0105242_10037074
405 Ga0105242_10113602
406 Ga0105248_10033162
407 Ga0105248_10060338
408 Ga0105248_10375947
409 Ga0105249_10250944
410 Ga0157373_10072003
411 Ga0157371_10062082
412 Ga0157370_10692498
413 Ga0157374_10232720
414 Ga0157378_10027068
415 Ga0163162_10125365
416 Ga0163162_10422400
417 Ga0157372_10168279
418 Ga0157375_10056317
419 Ga0163163_10089708
420 Ga0163163_10416647
421 Ga0157380_10085620
422 Ga0157379_10061848
423 Ga0157379_10076480
424 Ga0157379_10091067
425 Ga0157376_10074328
426 Ga0163161_10046854
427 Ga0213874_10003885
428 Ga0213876_10078618
429 Ga0207682_10005849
430 Ga0207692_10025153
431 Ga0207642_10013686
432 Ga0207688_10246890
433 Ga0207680_10044631
434 Ga0207699_10034822
435 Ga0207645_10008822
436 Ga0207643_10006632
437 Ga0207654_10205967
438 Ga0207707_10067045
439 Ga0207695_10088772
440 Ga0207693_10000876
441 Ga0207663_10053035
442 Ga0207660_10004209
443 Ga0207662_10155348
444 Ga0207657_10002437
445 Ga0207652_10004131
446 Ga0207652_10124721
447 Ga0207681_10061985
448 Ga0207650_10066301
449 Ga0207650_10112973
450 Ga0207659_10082946
451 Ga0207700_10000005
452 Ga0207664_10185146
453 Ga0207644_10016917
454 Ga0207690_10003199
455 Ga0207706_10005585
456 Ga0207686_10020363
457 Ga0207686_10032388
458 Ga0207670_10017239
459 Ga0207669_10010601
460 Ga0207704_10043330
461 Ga0207665_10042485
462 Ga0207691_10076105
463 Ga0207711_10155363
464 Ga0207689_10256171
465 Ga0207661_10763503
466 Ga0207667_10061797
467 Ga0207651_10058750
468 Ga0207712_10167031
469 Ga0207668_10380975
470 Ga0207640_10006227
471 Ga0207658_10019121
472 Ga0207677_10147780
473 Ga0207703_10298016
474 Ga0207678_10012675
475 Ga0207702_10000102
476 Ga0207641_10087817
477 Ga0207641_10550623
478 Ga0207648_10043127
479 Ga0207676_10055676
480 Ga0207674_10019349
481 Ga0207683_10003667
482 Ga0268266_10062297
483 Ga0268265_10054503
484 Ga0268265_10499394
485 Ga0268265_10774602
486 Ga0268264_10025117
487 Ga0268264_10046427
488 Ga0268264_10989227
489 Ga0265330_10044015
490 Ga0265332_10089841
491 Ga0265340_10017752
492 Ga0265340_10063132
493 Ga0265327_10011821
494 Ga0265316_10033625
495 Ga0265316_10437030
496 Ga0307408_100058588
497 Ga0307408_100081578
498 Ga0265314_10000546
499 Ga0307516_10136639
500 Ga0307516_10291568
501 Ga0307405_10002056
502 Ga0307405_10007953
503 Ga0307413_10052167
504 Ga0307410_10041309
505 Ga0307410_10108304
506 Ga0307410_10932415
507 Ga0307406_10000566
508 Ga0307406_10099238
509 Ga0307407_10009087
510 Ga0307412_10026572
511 Ga0307412_10177866
512 Ga0307409_100003788
513 Ga0307409_100330983
514 Ga0307416_100001154
515 Ga0307414_10000897
516 Ga0307414_11137255
517 Ga0307411_10000460
518 Ga0307411_10095838
519 Ga0307415_100025716
520 Ga0307415_100142722
521 Ga0373953_0085250
522 Ga0373943_0051976
523 Ga0373943_0553517
524 Ga0373955_0338939
525 Ga0373924_0057522
526 Ga0373931_0031539
527 Ga0373935_0020915
528 Ga0373927_0160828
529 Ga0373933_0305705
530 Ga0373947_0342715
531 Ga0373937_0028589
532 Ga0373937_0049235
533 Ga0373937_0304853
534 Ga0373937_1328997
535 Ga0373925_0031264
536 Ga0373925_0046879
537 Ga0373925_0365351
538 Ga0373925_0479936
539 Ga0373925_0587589
540 Ga0373925_0769712
541 Ga0395899_0512569
542 Ga0395900_0005886
543 Ga0395898_0017284
544 Ga0395905_0019996
545 Ga0395905_0038659
546 Ga0395901_0047231
547 Ga0436365_0103003
548 Ga0436363_0098309
549 Ga0436362_1278724
550 Ga0450890_020234
551 Ga0451576_0596211
552 Ga0495603_0205413
553 Ga0495629_0185905
554 Ga0495629_0227048
555 Ga0495580_0137468
556 Ga0495580_0162179
557 Ga0495582_0064764
558 Ga0495582_0258936
559 Ga0495606_0197791
560 Ga0495628_0119341
561 Ga0495630_0608910
562 Ga0495630_0893952
563 Ga0495652_0539387
564 Ga0495586_0135241
565 Ga0495645_0114904
566 Ga0495635_0151325
567 Ga0495658_0087138
568 Ga0495613_0467683
569 Ga0495676_0244522
570 Ga0495684_0060184
571 Ga0495684_0201454
572 Ga0495602_0426298
573 Ga0496104_0081202
574 Ga0496105_0160079
575 Ga0496118_0016017
576 Ga0496119_0026512
577 Ga0496120_0009298
578 Ga0496121_0000159
579 Ga0496121_0110888
580 Ga0496123_0014881
581 Ga0496124_0432155
582 Ga0496125_0000005
583 Ga0496126_0043808
584 Ga0501031_0042710
585 Ga0501032_0382224
586 Ga0501033_0000921
587 Ga0501033_0155485
588 Ga0501034_0122322
589 Ga0501034_0483107
590 Ga0501036_0252927
591 Ga0501037_0021490
592 Ga0501037_0660285
593 Ga0501047_0104752
594 Ga0501047_0144191
595 Ga0501047_0212877
596 Ga0501047_0306605
597 Ga0501048_1066692
598 Ga0501069_0674177
599 Ga0501070_0000018
600 Ga0501072_0188587
601 Ga0501075_0652574
602 Ga0501076_0073243
603 Ga0501079_0068086
604 Ga0501080_0003220
605 Ga0501080_0004780
606 Ga0501080_0795470
607 Ga0501035_0004935
608 Ga0501035_0012265
609 Ga0501035_0130917
610 Ga0501035_0300495
611 Ga0501035_0756410
612 Ga0501044_0002058
613 Ga0501044_0003985
614 Ga0501044_0305435
615 Ga0501044_0310362
616 nmdc:mga08y16_504269_c1
617 nmdc:mga0n895_259445_c1
618 nmdc:mga0rr50_6201_c1
619 nmdc:mga08x19_160_c1
620 Ga0495601_0111371
621 Ga0495595_0016142
622 Ga0495595_0199678
623 Ga0495619_0086051
624 Ga0501082_0413368
625 Ga0501082_0552858
626 2508727769
627 2513957708
628 2514045563
629 2739309822
630 2776264237
631 2817455797
632 2894235897
633 2894236407
634 2941482967
635 2996310824
636 644750042

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

12

144

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9666 4 142
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9452 4 142
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9446 4 141
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9291 4 142
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9159 4 142
ID Description Score Start End Superfamily
2myuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8761 3 137 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8757 5 139 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.869 4 139 3.40.50.2300
af_I6X4W4_364_495_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8685 4 147 3.40.50.2300
af_I6X4W4_364_495_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8563 4 147 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7U7EJV0-F1-model_v4 Arsenate reductase (EC 1.20.4.4) 0.9889 2 162 GO:0016491
GO:0046685
AF-J0CJT5-F1-model_v4 Protein-tyrosine-phosphatase 0.9869 2 161 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A832R726-F1-model_v4 Arsenate reductase ArsC 0.9857 2 162 GO:0046685
AF-A0A3S0W2C0-F1-model_v4 ArsR family transcriptional regulator 0.9852 2 162 GO:0003700
GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A0P9BHB7-F1-model_v4 deleted 0.9852 2 162

Map