F404765

General Info

Members Datasets Scaffolds Average Seq Length
318 198 636 133

Family's Representative Sequence

Representative Sequence 3300046529|Ga0495652_0202376|Ga0495652_0202376_902_1297
Length 124
Sequence VKNKTIKSEAEWRAELSPEQYHVLREKGTERPFTGEYDHVFEPGQYHCAGCGAELFRSEAKYDSSAPASGDAVEEETDASYGMVRTEVMCAACGGHLGHVFPDGPGPTGQRYCINSASIKLEEE

Samples

Sample ID Description Type Environment
1 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
57 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
58 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
114 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
115 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
116 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
117 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
120 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
121 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
122 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
123 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
124 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
125 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
126 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
130 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
131 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
138 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
142 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
143 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
144 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
145 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
198 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.2
Nodule 0
Rhizoplane 3.46
Rhizosphere 91.19
Stem 0
Stem Tuber 0
Unclassified 0.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495652_0202376 3300046529 Bacteria 1506
2 JGI25406J46586_10033907 3300003203 Bacteria 1879
3 JGI25407J50210_10000782 3300003373 Bacteria 6722
4 JGI25407J50210_10002794 3300003373 Bacteria 4150
5 JGI25407J50210_10009576 3300003373 Bacteria 2456
6 JGI25407J50210_10034708 3300003373 Bacteria 1300
7 JGI25407J50210_10066479 3300003373 Bacteria 902
8 JGI25407J50210_10081253 3300003373 Bacteria 805
9 JGI25407J50210_10111155 3300003373 Bacteria 676
10 Ga0070683_100281607 3300005329 Bacteria 1581
11 Ga0070683_101129253 3300005329 Bacteria 753
12 Ga0070683_101200076 3300005329 Bacteria 729
13 Ga0068869_101371496 3300005334 Bacteria 625
14 Ga0070680_100491163 3300005336 Bacteria 1050
15 Ga0070682_101703789 3300005337 Bacteria 548
16 Ga0070661_100364697 3300005344 Bacteria 1136
17 Ga0070692_10591908 3300005345 Bacteria 733
18 Ga0070668_100002340 3300005347 Bacteria 13926
19 Ga0070668_101796628 3300005347 Bacteria 564
20 Ga0070675_101774424 3300005354 Bacteria 569
21 Ga0070674_100322555 3300005356 Bacteria 1239
22 Ga0070714_100170640 3300005435 Bacteria 1974
23 Ga0070714_100347238 3300005435 Bacteria 1393
24 Ga0070713_100562114 3300005436 Bacteria 1081
25 Ga0070710_10234910 3300005437 Bacteria 1172
26 Ga0070700_100115820 3300005441 Bacteria 1789
27 Ga0070678_101421756 3300005456 Bacteria 648
28 Ga0070662_100016796 3300005457 Bacteria 4920
29 Ga0070662_101597230 3300005457 Bacteria 563
30 Ga0070681_10585159 3300005458 Bacteria 1030
31 Ga0070706_100665773 3300005467 Bacteria 966
32 Ga0070707_102293733 3300005468 Bacteria 507
33 Ga0070698_100087114 3300005471 Bacteria 3109
34 Ga0070698_100489790 3300005471 Bacteria 1167
35 Ga0070698_101674306 3300005471 Bacteria 588
36 Ga0070699_100252873 3300005518 Bacteria 1575
37 Ga0070699_100845567 3300005518 Bacteria 838
38 Ga0070679_100051628 3300005530 Bacteria 4096
39 Ga0070684_101702759 3300005535 Bacteria 595
40 Ga0070696_100000149 3300005546 Bacteria 38952
41 Ga0070696_100200351 3300005546 Bacteria 1490
42 Ga0070696_100589658 3300005546 Bacteria 895
43 Ga0070665_100002447 3300005548 Bacteria 20469
44 Ga0070704_100565878 3300005549 Bacteria 995
45 Ga0068854_100900402 3300005578 Bacteria 778
46 Ga0068856_100858590 3300005614 Bacteria 927
47 Ga0068861_100930068 3300005719 Bacteria 825
48 Ga0068861_101629236 3300005719 Bacteria 636
49 Ga0068870_10354827 3300005840 Bacteria 942
50 Ga0068870_10551695 3300005840 Bacteria 776
51 Ga0081455_10025509 3300005937 Bacteria 5454
52 Ga0081538_10000084 3300005981 Bacteria 90336
53 Ga0081538_10000123 3300005981 Bacteria 78578
54 Ga0081538_10000335 3300005981 Bacteria 53362
55 Ga0081538_10001769 3300005981 Bacteria 21862
56 Ga0081538_10004630 3300005981 Bacteria 12627
57 Ga0081538_10005956 3300005981 Bacteria 10850
58 Ga0081538_10010870 3300005981 Bacteria 7424
59 Ga0081538_10018050 3300005981 Bacteria 5322
60 Ga0081538_10038419 3300005981 Bacteria 3089
61 Ga0081539_10000117 3300005985 Bacteria 185868
62 Ga0081539_10008845 3300005985 Bacteria 8612
63 Ga0081539_10020111 3300005985 Bacteria 4532
64 Ga0070717_10408319 3300006028 Bacteria 1221
65 Ga0070717_10623268 3300006028 Bacteria 979
66 Ga0075365_10278520 3300006038 Bacteria 1177
67 Ga0075365_10725545 3300006038 Bacteria 702
68 Ga0075363_100655395 3300006048 Bacteria 632
69 Ga0075364_10373290 3300006051 Bacteria 973
70 Ga0075432_10381887 3300006058 Bacteria 604
71 Ga0070712_100325439 3300006175 Bacteria 1251
72 Ga0075428_100019524 3300006844 Bacteria 7500
73 Ga0075428_100212624 3300006844 Bacteria 2090
74 Ga0075428_100530575 3300006844 Bacteria 1259
75 Ga0075430_100000877 3300006846 Bacteria 23612
76 Ga0075430_100004923 3300006846 Bacteria 11230
77 Ga0075431_100013484 3300006847 Bacteria 8254
78 Ga0075431_100014032 3300006847 Bacteria 8095
79 Ga0075431_100135287 3300006847 Bacteria 2541
80 Ga0075429_100149685 3300006880 Bacteria 2043
81 Ga0105250_10463204 3300009092 Bacteria 571
82 Ga0111539_10049810 3300009094 Bacteria 4992
83 Ga0111539_10276448 3300009094 Bacteria 1954
84 Ga0111539_10280595 3300009094 Bacteria 1938
85 Ga0111539_11268463 3300009094 Bacteria 855
86 Ga0111539_11472738 3300009094 Bacteria 790
87 Ga0105245_10039949 3300009098 Bacteria 4177
88 Ga0105245_12327981 3300009098 Bacteria 589
89 Ga0105243_10224747 3300009148 Bacteria 1661
90 Ga0105243_12392517 3300009148 Bacteria 566
91 Ga0105242_11149675 3300009176 Bacteria 793
92 Ga0105242_11968552 3300009176 Bacteria 626
93 Ga0105248_11435916 3300009177 Bacteria 781
94 Ga0105237_12340538 3300009545 Bacteria 544
95 Ga0105238_10334721 3300009551 Bacteria 1501
96 Ga0105238_10646684 3300009551 Bacteria 1067
97 Ga0105249_10013598 3300009553 Bacteria 7188
98 Ga0105249_10773172 3300009553 Bacteria 1023
99 Ga0105239_10153302 3300010375 Bacteria 2572
100 Ga0105239_11128310 3300010375 Bacteria 903
101 Ga0157318_1025554 3300012482 Bacteria 553
102 Ga0157341_1029940 3300012494 Bacteria 584
103 Ga0157324_1008107 3300012506 Bacteria 836
104 Ga0157370_11934190 3300013104 Bacteria 529
105 Ga0163162_10612021 3300013306 Bacteria 1215
106 Ga0163162_11436898 3300013306 Bacteria 785
107 Ga0157372_10293606 3300013307 Bacteria 1890
108 Ga0157380_11565521 3300014326 Bacteria 714
109 Ga0213876_10207595 3300021384 Bacteria 1041
110 Ga0207692_10417490 3300025898 Bacteria 839
111 Ga0207692_10519396 3300025898 Bacteria 758
112 Ga0207642_10886189 3300025899 Bacteria 571
113 Ga0207688_10102027 3300025901 Bacteria 1658
114 Ga0207643_10142745 3300025908 Bacteria 1431
115 Ga0207705_10389788 3300025909 Bacteria 1077
116 Ga0207707_10214878 3300025912 Bacteria 1674
117 Ga0207707_10505752 3300025912 Bacteria 1030
118 Ga0207693_10493176 3300025915 Bacteria 956
119 Ga0207660_10901654 3300025917 Bacteria 721
120 Ga0207649_10557103 3300025920 Bacteria 878
121 Ga0207652_10089424 3300025921 Bacteria 2704
122 Ga0207681_11178508 3300025923 Bacteria 644
123 Ga0207694_10512014 3300025924 Bacteria 1005
124 Ga0207694_10659601 3300025924 Bacteria 882
125 Ga0207687_10070642 3300025927 Bacteria 2493
126 Ga0207687_10073604 3300025927 Bacteria 2446
127 Ga0207664_11178514 3300025929 Bacteria 684
128 Ga0207690_11791021 3300025932 Bacteria 513
129 Ga0207706_10023902 3300025933 Bacteria 5483
130 Ga0207670_11405202 3300025936 Bacteria 593
131 Ga0207704_10716494 3300025938 Bacteria 830
132 Ga0207711_11533615 3300025941 Bacteria 609
133 Ga0207661_10729280 3300025944 Bacteria 912
134 Ga0207661_10957781 3300025944 Bacteria 788
135 Ga0207712_10014784 3300025961 Bacteria 5026
136 Ga0207668_10047363 3300025972 Bacteria 2943
137 Ga0207668_10507046 3300025972 Bacteria 1039
138 Ga0207677_10696948 3300026023 Bacteria 901
139 Ga0207639_11875095 3300026041 Bacteria 560
140 Ga0207678_10718076 3300026067 Bacteria 880
141 Ga0207708_10168319 3300026075 Bacteria 1734
142 Ga0207702_10803907 3300026078 Bacteria 929
143 Ga0207648_11042045 3300026089 Bacteria 767
144 Ga0207675_101050338 3300026118 Bacteria 834
145 Ga0207683_10822630 3300026121 Bacteria 862
146 Ga0207683_11007739 3300026121 Bacteria 773
147 Ga0207428_10003392 3300027907 Bacteria 15488
148 Ga0268266_10057873 3300028379 Bacteria 3336
149 Ga0268265_11877646 3300028380 Bacteria 606
150 Ga0268264_11370906 3300028381 Bacteria 718
151 Ga0307413_11463797 3300031824 Bacteria 603
152 Ga0307406_10034162 3300031901 Bacteria 3118
153 Ga0307406_10035900 3300031901 Bacteria 3051
154 Ga0307406_10917519 3300031901 Bacteria 747
155 Ga0307407_10511463 3300031903 Bacteria 882
156 Ga0307412_10613755 3300031911 Bacteria 923
157 Ga0307409_100087415 3300031995 Bacteria 2540
158 Ga0307409_100159819 3300031995 Bacteria 1969
159 Ga0307409_100341785 3300031995 Bacteria 1409
160 Ga0307409_100754786 3300031995 Bacteria 977
161 Ga0307409_101313430 3300031995 Bacteria 749
162 Ga0307416_100100132 3300032002 Bacteria 2519
163 Ga0307416_100731352 3300032002 Bacteria 1081
164 Ga0307416_102620680 3300032002 Bacteria 602
165 Ga0307414_10951254 3300032004 Bacteria 789
166 Ga0307415_101484602 3300032126 Bacteria 648
167 Ga0307415_101625639 3300032126 Bacteria 621
168 Ga0373945_0123915 3300035116 Bacteria 1030
169 Ga0395899_0773367 3300037312 Bacteria 596
170 Ga0395898_1055552 3300037466 Bacteria 747
171 Ga0395898_1360739 3300037466 Bacteria 638
172 Ga0395901_0256813 3300038443 Bacteria 1820
173 Ga0395901_0982133 3300038443 Bacteria 821
174 Ga0436365_0328984 3300039437 Bacteria 4400
175 Ga0436365_1885909 3300039437 Bacteria 775
176 Ga0436360_0732970 3300039438 Bacteria 936
177 Ga0436363_0293739 3300039450 Bacteria 677
178 Ga0436363_0307383 3300039450 Bacteria 1149
179 Ga0436363_0535576 3300039450 Bacteria 5287
180 Ga0436363_0893836 3300039450 Unclassified 947
181 Ga0436363_0999041 3300039450 Unclassified 581
182 Ga0436362_0479611 3300039453 Bacteria 2538
183 Ga0439461_0121590 3300041410 Bacteria 653
184 Ga0439465_0070238 3300041413 Bacteria 1173
185 Ga0451789_1035997 3300041443 Bacteria 524
186 Ga0451839_0970328 3300041496 Bacteria 578
187 Ga0451853_3605442 3300041512 Bacteria 750
188 Ga0439445_0092340 3300042004 Bacteria 853
189 Ga0439450_200864 3300042008 Bacteria 533
190 Ga0439452_077420 3300042010 Bacteria 727
191 Ga0450910_006666 3300042147 Bacteria 1600
192 Ga0439446_0002216 3300042156 Bacteria 4637
193 Ga0439446_0027219 3300042156 Bacteria 1640
194 Ga0439434_0039660 3300042435 Bacteria 1445
195 Ga0450918_011184 3300042531 Bacteria 1565
196 Ga0495584_0100889 3300046491 Bacteria 1459
197 Ga0495585_0437037 3300046492 Bacteria 627
198 Ga0495596_0071496 3300046500 Bacteria 1347
199 Ga0495596_0258031 3300046500 Bacteria 676
200 Ga0495620_0070891 3300046515 Bacteria 1427
201 Ga0495631_0269828 3300046518 Bacteria 725
202 Ga0495644_0056937 3300046523 Bacteria 1469
203 Ga0495648_0211125 3300046524 Bacteria 964
204 Ga0495586_0751851 3300046535 Bacteria 563
205 Ga0495656_0101408 3300046615 Bacteria 1332
206 Ga0495668_0388913 3300046616 Bacteria 766
207 Ga0495634_0365581 3300046642 Bacteria 862
208 Ga0495611_0280457 3300046648 Bacteria 770
209 Ga0495611_0462274 3300046648 Bacteria 578
210 Ga0495659_0026084 3300046664 Bacteria 2005
211 Ga0495658_0661868 3300046683 Bacteria 669
212 Ga0495670_0170249 3300046691 Bacteria 1147
213 Ga0495671_0089210 3300046692 Bacteria 1510
214 Ga0495671_0489000 3300046692 Bacteria 587
215 Ga0495649_0360461 3300046694 Bacteria 734
216 Ga0495589_0075227 3300046794 Bacteria 1647
217 Ga0495660_0246863 3300046810 Bacteria 830
218 Ga0495636_0092425 3300047318 Bacteria 1315
219 Ga0496101_1585155 3300048904 Bacteria 509
220 Ga0496102_0358588 3300048905 Bacteria 1373
221 Ga0496103_0324161 3300048906 Bacteria 991
222 Ga0496103_0473795 3300048906 Bacteria 802
223 Ga0496104_1227633 3300048907 Bacteria 653
224 Ga0496105_0049645 3300048908 Bacteria 3465
225 Ga0496106_0451146 3300048909 Bacteria 1033
226 Ga0496106_1088814 3300048909 Bacteria 626
227 Ga0496108_0376766 3300048911 Bacteria 1239
228 Ga0496115_0248540 3300048918 Bacteria 1465
229 Ga0501291_017583 3300049514 Bacteria 1103
230 Ga0501031_0019374 3300049568 Bacteria 4433
231 Ga0501032_0679019 3300049569 Bacteria 653
232 Ga0501032_0945260 3300049569 Bacteria 542
233 Ga0501033_0087721 3300049570 Bacteria 2277
234 Ga0501036_0123194 3300049572 Bacteria 2189
235 Ga0501036_0171319 3300049572 Bacteria 1829
236 Ga0501036_1083803 3300049572 Bacteria 655
237 Ga0501037_0911899 3300049573 Bacteria 576
238 Ga0501038_0009200 3300049574 Bacteria 9061
239 Ga0501038_0323615 3300049574 Bacteria 1206
240 Ga0501038_0499731 3300049574 Bacteria 930
241 Ga0501039_0005730 3300049575 Bacteria 9410
242 Ga0501039_0602163 3300049575 Bacteria 861
243 Ga0501040_0006996 3300049576 Bacteria 7309
244 Ga0501040_0019095 3300049576 Bacteria 4557
245 Ga0501041_0029307 3300049577 Bacteria 3320
246 Ga0501041_0047582 3300049577 Bacteria 2611
247 Ga0501041_0211640 3300049577 Bacteria 1216
248 Ga0501041_0403622 3300049577 Bacteria 866
249 Ga0501042_0056965 3300049578 Bacteria 2789
250 Ga0501042_0438012 3300049578 Bacteria 948
251 Ga0501042_0629526 3300049578 Bacteria 780
252 Ga0501042_0828547 3300049578 Bacteria 673
253 Ga0501043_0491792 3300049579 Bacteria 917
254 Ga0501046_0920547 3300049580 Bacteria 609
255 Ga0501048_0004468 3300049582 Bacteria 10646
256 Ga0501048_0045690 3300049582 Bacteria 3128
257 Ga0501048_0695498 3300049582 Bacteria 730
258 Ga0501067_0116428 3300049583 Bacteria 1486
259 Ga0501068_0232098 3300049584 Bacteria 1173
260 Ga0501070_0360088 3300049586 Bacteria 1180
261 Ga0501071_0009390 3300049587 Bacteria 6513
262 Ga0501071_0099262 3300049587 Bacteria 2145
263 Ga0501071_0743312 3300049587 Bacteria 756
264 Ga0501072_0019463 3300049588 Bacteria 5248
265 Ga0501072_0070137 3300049588 Bacteria 2767
266 Ga0501072_0122814 3300049588 Bacteria 2069
267 Ga0501072_0137645 3300049588 Bacteria 1947
268 Ga0501074_0174027 3300049590 Bacteria 1536
269 Ga0501074_0180977 3300049590 Bacteria 1504
270 Ga0501075_0003368 3300049591 Bacteria 10688
271 Ga0501076_0022998 3300049592 Bacteria 4797
272 Ga0501076_0125332 3300049592 Bacteria 2081
273 Ga0501076_0273576 3300049592 Bacteria 1383
274 Ga0501077_0146037 3300049593 Bacteria 1500
275 Ga0501249_140158 3300049679 Bacteria 602
276 Ga0501079_0005376 3300049741 Bacteria 9536
277 Ga0501079_0261573 3300049741 Bacteria 1352
278 Ga0501079_0378648 3300049741 Bacteria 1110
279 Ga0501080_0063641 3300049742 Bacteria 3433
280 Ga0501081_0017774 3300049743 Bacteria 4712
281 Ga0501081_0029838 3300049743 Bacteria 3687
282 Ga0501081_0207348 3300049743 Bacteria 1423
283 Ga0501081_0618491 3300049743 Bacteria 811
284 Ga0501083_0789976 3300049744 Bacteria 618
285 Ga0501035_0045660 3300049822 Bacteria 3941
286 Ga0501045_0010123 3300049824 Bacteria 6598
287 Ga0501045_0078357 3300049824 Bacteria 2436
288 Ga0501045_0295039 3300049824 Bacteria 1206
289 Ga0501045_0530146 3300049824 Bacteria 874
290 nmdc:mga03683_628333_c1 3300050489 Bacteria 527
291 nmdc:mga03n38_571582_c1 3300050490 Bacteria 641
292 nmdc:mga00v17_244187_c1 3300050491 Bacteria 1164
293 nmdc:mga05p37_222497_c1 3300050507 Bacteria 2277
294 nmdc:mga05p37_58152_c1 3300050507 Bacteria 4762
295 nmdc:mga09592_82497_c1 3300050508 Bacteria 2740
296 nmdc:mga0qj67_3935_c1 3300050509 Bacteria 10747
297 nmdc:mga0qj67_646_c1 3300050509 Bacteria 24005
298 nmdc:mga06r32_21080_c1 3300050510 Bacteria 6013
299 nmdc:mga06r32_5839_c1 3300050510 Bacteria 6485
300 nmdc:mga06r32_989844_c1 3300050510 Bacteria 794
301 nmdc:mga08y16_1885335_c1 3300050511 Bacteria 549
302 nmdc:mga08y16_67403_c1 3300050511 Bacteria 3733
303 Ga0501084_0008026 3300054114 Bacteria 8693
304 Ga0501084_0084770 3300054114 Bacteria 2660
305 Ga0501084_0393339 3300054114 Bacteria 1171
306 Ga0501084_1549678 3300054114 Bacteria 554
307 Ga0590071_122147 3300059421 Bacteria 666
308 Ga0590074_017422 3300059423 Bacteria 1227
309 Ga0590075_024362 3300059424 Bacteria 1519
310 Ga0590075_087489 3300059424 Bacteria 808
311 Ga0501082_0062968 3300060353 Bacteria 3193
312 Ga0501082_0387297 3300060353 Bacteria 1220
313 Ga0501082_1714806 3300060353 Bacteria 548
314 Ga0530510_0006370 3300061734 Bacteria 8214
315 Ga0530510_0007224 3300061734 Bacteria 7727
316 Ga0530510_0254483 3300061734 Bacteria 1309
317 Ga0530510_1371350 3300061734 Bacteria 542
318 2911139653 2911138879 Bacteria 5811561
319 Ga0495652_0202376
320 JGI25406J46586_10033907
321 JGI25407J50210_10000782
322 JGI25407J50210_10002794
323 JGI25407J50210_10009576
324 JGI25407J50210_10034708
325 JGI25407J50210_10066479
326 JGI25407J50210_10081253
327 JGI25407J50210_10111155
328 Ga0070683_100281607
329 Ga0070683_101129253
330 Ga0070683_101200076
331 Ga0068869_101371496
332 Ga0070680_100491163
333 Ga0070682_101703789
334 Ga0070661_100364697
335 Ga0070692_10591908
336 Ga0070668_100002340
337 Ga0070668_101796628
338 Ga0070675_101774424
339 Ga0070674_100322555
340 Ga0070714_100170640
341 Ga0070714_100347238
342 Ga0070713_100562114
343 Ga0070710_10234910
344 Ga0070700_100115820
345 Ga0070678_101421756
346 Ga0070662_100016796
347 Ga0070662_101597230
348 Ga0070681_10585159
349 Ga0070706_100665773
350 Ga0070707_102293733
351 Ga0070698_100087114
352 Ga0070698_100489790
353 Ga0070698_101674306
354 Ga0070699_100252873
355 Ga0070699_100845567
356 Ga0070679_100051628
357 Ga0070684_101702759
358 Ga0070696_100000149
359 Ga0070696_100200351
360 Ga0070696_100589658
361 Ga0070665_100002447
362 Ga0070704_100565878
363 Ga0068854_100900402
364 Ga0068856_100858590
365 Ga0068861_100930068
366 Ga0068861_101629236
367 Ga0068870_10354827
368 Ga0068870_10551695
369 Ga0081455_10025509
370 Ga0081538_10000084
371 Ga0081538_10000123
372 Ga0081538_10000335
373 Ga0081538_10001769
374 Ga0081538_10004630
375 Ga0081538_10005956
376 Ga0081538_10010870
377 Ga0081538_10018050
378 Ga0081538_10038419
379 Ga0081539_10000117
380 Ga0081539_10008845
381 Ga0081539_10020111
382 Ga0070717_10408319
383 Ga0070717_10623268
384 Ga0075365_10278520
385 Ga0075365_10725545
386 Ga0075363_100655395
387 Ga0075364_10373290
388 Ga0075432_10381887
389 Ga0070712_100325439
390 Ga0075428_100019524
391 Ga0075428_100212624
392 Ga0075428_100530575
393 Ga0075430_100000877
394 Ga0075430_100004923
395 Ga0075431_100013484
396 Ga0075431_100014032
397 Ga0075431_100135287
398 Ga0075429_100149685
399 Ga0105250_10463204
400 Ga0111539_10049810
401 Ga0111539_10276448
402 Ga0111539_10280595
403 Ga0111539_11268463
404 Ga0111539_11472738
405 Ga0105245_10039949
406 Ga0105245_12327981
407 Ga0105243_10224747
408 Ga0105243_12392517
409 Ga0105242_11149675
410 Ga0105242_11968552
411 Ga0105248_11435916
412 Ga0105237_12340538
413 Ga0105238_10334721
414 Ga0105238_10646684
415 Ga0105249_10013598
416 Ga0105249_10773172
417 Ga0105239_10153302
418 Ga0105239_11128310
419 Ga0157318_1025554
420 Ga0157341_1029940
421 Ga0157324_1008107
422 Ga0157370_11934190
423 Ga0163162_10612021
424 Ga0163162_11436898
425 Ga0157372_10293606
426 Ga0157380_11565521
427 Ga0213876_10207595
428 Ga0207692_10417490
429 Ga0207692_10519396
430 Ga0207642_10886189
431 Ga0207688_10102027
432 Ga0207643_10142745
433 Ga0207705_10389788
434 Ga0207707_10214878
435 Ga0207707_10505752
436 Ga0207693_10493176
437 Ga0207660_10901654
438 Ga0207649_10557103
439 Ga0207652_10089424
440 Ga0207681_11178508
441 Ga0207694_10512014
442 Ga0207694_10659601
443 Ga0207687_10070642
444 Ga0207687_10073604
445 Ga0207664_11178514
446 Ga0207690_11791021
447 Ga0207706_10023902
448 Ga0207670_11405202
449 Ga0207704_10716494
450 Ga0207711_11533615
451 Ga0207661_10729280
452 Ga0207661_10957781
453 Ga0207712_10014784
454 Ga0207668_10047363
455 Ga0207668_10507046
456 Ga0207677_10696948
457 Ga0207639_11875095
458 Ga0207678_10718076
459 Ga0207708_10168319
460 Ga0207702_10803907
461 Ga0207648_11042045
462 Ga0207675_101050338
463 Ga0207683_10822630
464 Ga0207683_11007739
465 Ga0207428_10003392
466 Ga0268266_10057873
467 Ga0268265_11877646
468 Ga0268264_11370906
469 Ga0307413_11463797
470 Ga0307406_10034162
471 Ga0307406_10035900
472 Ga0307406_10917519
473 Ga0307407_10511463
474 Ga0307412_10613755
475 Ga0307409_100087415
476 Ga0307409_100159819
477 Ga0307409_100341785
478 Ga0307409_100754786
479 Ga0307409_101313430
480 Ga0307416_100100132
481 Ga0307416_100731352
482 Ga0307416_102620680
483 Ga0307414_10951254
484 Ga0307415_101484602
485 Ga0307415_101625639
486 Ga0373945_0123915
487 Ga0395899_0773367
488 Ga0395898_1055552
489 Ga0395898_1360739
490 Ga0395901_0256813
491 Ga0395901_0982133
492 Ga0436365_0328984
493 Ga0436365_1885909
494 Ga0436360_0732970
495 Ga0436363_0293739
496 Ga0436363_0307383
497 Ga0436363_0535576
498 Ga0436363_0893836
499 Ga0436363_0999041
500 Ga0436362_0479611
501 Ga0439461_0121590
502 Ga0439465_0070238
503 Ga0451789_1035997
504 Ga0451839_0970328
505 Ga0451853_3605442
506 Ga0439445_0092340
507 Ga0439450_200864
508 Ga0439452_077420
509 Ga0450910_006666
510 Ga0439446_0002216
511 Ga0439446_0027219
512 Ga0439434_0039660
513 Ga0450918_011184
514 Ga0495584_0100889
515 Ga0495585_0437037
516 Ga0495596_0071496
517 Ga0495596_0258031
518 Ga0495620_0070891
519 Ga0495631_0269828
520 Ga0495644_0056937
521 Ga0495648_0211125
522 Ga0495586_0751851
523 Ga0495656_0101408
524 Ga0495668_0388913
525 Ga0495634_0365581
526 Ga0495611_0280457
527 Ga0495611_0462274
528 Ga0495659_0026084
529 Ga0495658_0661868
530 Ga0495670_0170249
531 Ga0495671_0089210
532 Ga0495671_0489000
533 Ga0495649_0360461
534 Ga0495589_0075227
535 Ga0495660_0246863
536 Ga0495636_0092425
537 Ga0496101_1585155
538 Ga0496102_0358588
539 Ga0496103_0324161
540 Ga0496103_0473795
541 Ga0496104_1227633
542 Ga0496105_0049645
543 Ga0496106_0451146
544 Ga0496106_1088814
545 Ga0496108_0376766
546 Ga0496115_0248540
547 Ga0501291_017583
548 Ga0501031_0019374
549 Ga0501032_0679019
550 Ga0501032_0945260
551 Ga0501033_0087721
552 Ga0501036_0123194
553 Ga0501036_0171319
554 Ga0501036_1083803
555 Ga0501037_0911899
556 Ga0501038_0009200
557 Ga0501038_0323615
558 Ga0501038_0499731
559 Ga0501039_0005730
560 Ga0501039_0602163
561 Ga0501040_0006996
562 Ga0501040_0019095
563 Ga0501041_0029307
564 Ga0501041_0047582
565 Ga0501041_0211640
566 Ga0501041_0403622
567 Ga0501042_0056965
568 Ga0501042_0438012
569 Ga0501042_0629526
570 Ga0501042_0828547
571 Ga0501043_0491792
572 Ga0501046_0920547
573 Ga0501048_0004468
574 Ga0501048_0045690
575 Ga0501048_0695498
576 Ga0501067_0116428
577 Ga0501068_0232098
578 Ga0501070_0360088
579 Ga0501071_0009390
580 Ga0501071_0099262
581 Ga0501071_0743312
582 Ga0501072_0019463
583 Ga0501072_0070137
584 Ga0501072_0122814
585 Ga0501072_0137645
586 Ga0501074_0174027
587 Ga0501074_0180977
588 Ga0501075_0003368
589 Ga0501076_0022998
590 Ga0501076_0125332
591 Ga0501076_0273576
592 Ga0501077_0146037
593 Ga0501249_140158
594 Ga0501079_0005376
595 Ga0501079_0261573
596 Ga0501079_0378648
597 Ga0501080_0063641
598 Ga0501081_0017774
599 Ga0501081_0029838
600 Ga0501081_0207348
601 Ga0501081_0618491
602 Ga0501083_0789976
603 Ga0501035_0045660
604 Ga0501045_0010123
605 Ga0501045_0078357
606 Ga0501045_0295039
607 Ga0501045_0530146
608 nmdc:mga03683_628333_c1
609 nmdc:mga03n38_571582_c1
610 nmdc:mga00v17_244187_c1
611 nmdc:mga05p37_222497_c1
612 nmdc:mga05p37_58152_c1
613 nmdc:mga09592_82497_c1
614 nmdc:mga0qj67_3935_c1
615 nmdc:mga0qj67_646_c1
616 nmdc:mga06r32_21080_c1
617 nmdc:mga06r32_5839_c1
618 nmdc:mga06r32_989844_c1
619 nmdc:mga08y16_1885335_c1
620 nmdc:mga08y16_67403_c1
621 Ga0501084_0008026
622 Ga0501084_0084770
623 Ga0501084_0393339
624 Ga0501084_1549678
625 Ga0590071_122147
626 Ga0590074_017422
627 Ga0590075_024362
628 Ga0590075_087489
629 Ga0501082_0062968
630 Ga0501082_0387297
631 Ga0501082_1714806
632 Ga0530510_0006370
633 Ga0530510_0007224
634 Ga0530510_0254483
635 Ga0530510_1371350
636 2911139653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01641

SelR

SelR domain

11

123

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hch-assembly1.cif.gz_A structure of the c-terminal domain (msrb) of neisseria meningitidis pilb (complex with substrate) 0.972 7 131
3e0o-assembly2.cif.gz_A crystal structure of msrb 0.9647 11 131
3cxk-assembly1.cif.gz_A 1.7 a crystal structure of methionine-r-sulfoxide reductase from burkholderia pseudomallei: crystallization in a microfluidic crystal card. 0.9646 5 133
6q9v-assembly1.cif.gz_A msrb3 0.962 5 133
3hch-assembly2.cif.gz_B structure of the c-terminal domain (msrb) of neisseria meningitidis pilb (complex with substrate) 0.9604 7 131
ID Description Score Start End Superfamily
af_Q8BU85_97_242_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9759 5 132 2.170.150.20
3cezB00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9704 5 132 2.170.150.20
af_I6YA00_1_135_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9669 5 133 2.170.150.20
3cezB00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9486 5 132 2.170.150.20
af_P34436_5_152_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9484 5 133 2.170.150.20
ID Description Score Start End GO Terms
AF-A0A7X3V535-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.9943 13 133 GO:0005737
GO:0006979
GO:0008270
GO:0030091
GO:0033743
AF-A0A6J4RUV9-F1-model_v4 peptide-methionine (R)-S-oxide reductase (EC 1.8.4.12) 0.9936 6 133 GO:0005737
GO:0006979
GO:0030091
GO:0033743
AF-A0A7Y8SR08-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.993 8 131 GO:0005737
GO:0006979
GO:0008270
GO:0030091
GO:0033743
AF-A0A2W5XE92-F1-model_v4 peptide-methionine (R)-S-oxide reductase (EC 1.8.4.12) 0.993 6 131 GO:0003676
GO:0004523
GO:0005737
GO:0006979
GO:0030091
GO:0033743
AF-A0A2Z5E7V2-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.9928 5 133 GO:0005737
GO:0006979
GO:0008270
GO:0030091
GO:0033743

Map