F404742

General Info

Members Datasets Scaffolds Average Seq Length
318 176 636 332

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0001939|Ga0451576_0001939_5731_6798
Length 355
Sequence MPEDDPRLEVVLMNVPLTMPGGATPAASPITSQVDALRAEAAIEPDAPSTAEPKKETQIIAIYGKGGIGKSFTLANLSYMMAQQGKRVLLIGCDPKSDTTSLLFGGRSCPTIIETSSRKKAAGEPVAIGDVCFKRDGVFAMELGGPEVGRGCGGRGIIHGFELLEKLGFHQWDFDYVLLDFLGDVVCGGFGLPIARDMCQKVIVVGSNDLQSLYVANNVCSAVDYFRKLGGNVGVAGMVVNKDDGTGEAAAFAKAAGIPILSAIPADDDIRRKSASYEIIGRPGTQWAPMFEELALQVALAPPVRPTPLTHDALLGLFKGEAVGRGVKLDPATMEDMCATALITKPSLEVVYEGA

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
16 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
20 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
21 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
22 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
23 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
24 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
25 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
26 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
27 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
28 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
29 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
30 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
46 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
47 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
48 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
49 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
50 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
51 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
52 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
55 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
56 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
57 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
58 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
59 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
60 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
61 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
66 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
67 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
70 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
71 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
72 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
75 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
76 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
77 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
79 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
84 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
85 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
88 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
94 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
102 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
103 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
104 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
105 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
106 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
109 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
110 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
115 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
116 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
125 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
129 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
130 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
131 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
132 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
133 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
134 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
135 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
136 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
137 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
138 2512875024
139 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
140 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
141 2643221585 Pelomonas sp. Root662 Isolate Unclassified
142 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
143 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
144 2643221656 Pelomonas sp. Root405 Isolate Unclassified
145 2643221660 Methylibium sp. Root1272 Isolate Unclassified
146 2643221719 Rhizobium sp. Root274 Isolate Unclassified
147 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
148 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
149 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
150 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
151 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
152 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
153 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
154 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
155 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
156 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
157 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
158 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
159 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
160 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
161 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
162 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
163 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
164 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
165 2902330777 Methylobacterium sp. 2A Isolate Unclassified
166 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
167 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
168 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
169 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
170 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
171 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
172 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
173 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
174 641522639 Methylobacterium sp. 4-46 Isolate Nodule
175 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
176 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 83.02
Metatranscriptomes 4.72
Isolates 12.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.03
Nodule 1.26
Rhizoplane 2.2
Rhizosphere 74.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0001939 3300045051 Bacteria 33033
2 JGI25153J46596_10003845 3300003215 Bacteria 8263
3 Ga0065165_1000694 3300005262 Bacteria 48071
4 Ga0065165_1017009 3300005262 Bacteria 2697
5 Ga0070658_10004801 3300005327 Bacteria 11004
6 Ga0070661_100074994 3300005344 Bacteria 2492
7 Ga0070668_100010185 3300005347 Bacteria 6972
8 Ga0070668_100113923 3300005347 Bacteria 2155
9 Ga0070671_100147561 3300005355 Bacteria 1986
10 Ga0070673_100029728 3300005364 Bacteria 4078
11 Ga0070663_100017968 3300005455 Bacteria 4626
12 Ga0070678_100120552 3300005456 Bacteria 2067
13 Ga0070672_100116952 3300005543 Bacteria 2179
14 Ga0070672_100119415 3300005543 Bacteria 2157
15 Ga0070672_100339306 3300005543 Bacteria 1279
16 Ga0070665_100009298 3300005548 Bacteria 9946
17 Ga0070665_100009524 3300005548 Bacteria 9825
18 Ga0070665_100101808 3300005548 Bacteria 2876
19 Ga0070665_100194921 3300005548 Bacteria 2027
20 Ga0068859_100100434 3300005617 Bacteria 2949
21 Ga0068860_100010873 3300005843 Bacteria 8977
22 Ga0068862_100008472 3300005844 Bacteria 8505
23 Ga0081540_1017144 3300005983 Bacteria 4496
24 Ga0081540_1021320 3300005983 Bacteria 3864
25 Ga0097620_100100435 3300006931 Bacteria 2949
26 Ga0105240_10014435 3300009093 Bacteria 10786
27 Ga0105248_10353306 3300009177 Bacteria 1655
28 Ga0105248_10452580 3300009177 Bacteria 1447
29 Ga0157371_10199829 3300013102 Bacteria 1433
30 Ga0157378_10040660 3300013297 Bacteria 4124
31 Ga0157375_10264974 3300013308 Bacteria 1880
32 Ga0163163_10078455 3300014325 Bacteria 3299
33 Ga0157376_10080820 3300014969 Bacteria 2789
34 Ga0163161_10059682 3300017792 Bacteria 2774
35 Ga0213876_10012490 3300021384 Bacteria 4521
36 Ga0213876_10103811 3300021384 Bacteria 1507
37 Ga0213875_10027274 3300021388 Bacteria 2717
38 Ga0213875_10052707 3300021388 Bacteria 1905
39 Ga0209758_1000557 3300025297 Bacteria 58827
40 Ga0207426_1000712 3300025302 Bacteria 38841
41 Ga0207426_1032806 3300025302 Bacteria 1680
42 Ga0207705_10004127 3300025909 Bacteria 11009
43 Ga0207695_10037138 3300025913 Bacteria 5257
44 Ga0207644_10097788 3300025931 Bacteria 2199
45 Ga0207691_10103088 3300025940 Bacteria 2544
46 Ga0207691_10129552 3300025940 Bacteria 2229
47 Ga0207691_10219753 3300025940 Bacteria 1648
48 Ga0207651_10080390 3300025960 Bacteria 2346
49 Ga0207668_10058581 3300025972 Bacteria 2693
50 Ga0207668_10191266 3300025972 Bacteria 1622
51 Ga0207678_10018086 3300026067 Bacteria 6190
52 Ga0207648_10570494 3300026089 Bacteria 1041
53 Ga0207683_10020440 3300026121 Bacteria 5662
54 Ga0207698_10070529 3300026142 Bacteria 2769
55 Ga0209968_1000461 3300027526 Bacteria 6514
56 Ga0209966_1000177 3300027695 Bacteria 26013
57 Ga0268266_10000539 3300028379 Bacteria 52742
58 Ga0268266_10245951 3300028379 Bacteria 1653
59 Ga0268265_10009128 3300028380 Bacteria 6703
60 Ga0268264_10094250 3300028381 Bacteria 2588
61 Ga0268264_10495344 3300028381 Bacteria 1191
62 Ga0265337_1001678 3300028556 Bacteria 10741
63 Ga0265326_10001124 3300028558 Bacteria 9529
64 Ga0265319_1005338 3300028563 Bacteria 6166
65 Ga0265334_10000294 3300028573 Bacteria 27911
66 Ga0265334_10009511 3300028573 Bacteria 4110
67 Ga0265334_10009913 3300028573 Bacteria 4028
68 Ga0265318_10000555 3300028577 Bacteria 26355
69 Ga0265318_10026798 3300028577 Bacteria 2268
70 Ga0265323_10002000 3300028653 Bacteria 9613
71 Ga0265322_10026736 3300028654 Bacteria 1649
72 Ga0265336_10000795 3300028666 Bacteria 16703
73 Ga0265338_10000081 3300028800 Bacteria 176402
74 Ga0265338_10014634 3300028800 Bacteria 8704
75 Ga0265338_10040078 3300028800 Bacteria 4405
76 Ga0265324_10008656 3300029957 Bacteria 4025
77 Ga0265330_10000756 3300031235 Bacteria 20349
78 Ga0265332_10002442 3300031238 Bacteria 9475
79 Ga0265332_10023231 3300031238 Bacteria 2735
80 Ga0265332_10038796 3300031238 Bacteria 2064
81 Ga0265332_10082757 3300031238 Bacteria 1361
82 Ga0265328_10000030 3300031239 Bacteria 109595
83 Ga0265328_10002622 3300031239 Bacteria 8031
84 Ga0265328_10010427 3300031239 Bacteria 3741
85 Ga0265325_10003894 3300031241 Bacteria 9577
86 Ga0265325_10008633 3300031241 Bacteria 6002
87 Ga0265329_10021691 3300031242 Bacteria 2155
88 Ga0265340_10000960 3300031247 Bacteria 16413
89 Ga0265339_10003866 3300031249 Bacteria 10396
90 Ga0265339_10004934 3300031249 Bacteria 8990
91 Ga0265339_10011380 3300031249 Bacteria 5480
92 Ga0265331_10001233 3300031250 Bacteria 19228
93 Ga0265331_10003057 3300031250 Bacteria 10981
94 Ga0265331_10004445 3300031250 Bacteria 8758
95 Ga0265327_10000613 3300031251 Bacteria 58852
96 Ga0265327_10004695 3300031251 Bacteria 11950
97 Ga0265327_10015229 3300031251 Bacteria 4979
98 Ga0265327_10022021 3300031251 Bacteria 3827
99 Ga0265327_10049806 3300031251 Bacteria 2195
100 Ga0265327_10125849 3300031251 Bacteria 1210
101 Ga0265316_10005010 3300031344 Bacteria 13004
102 Ga0265316_10026734 3300031344 Bacteria 4794
103 Ga0265316_10029344 3300031344 Bacteria 4525
104 Ga0265313_10006752 3300031595 Bacteria 8025
105 Ga0265313_10021682 3300031595 Bacteria 3506
106 Ga0316575_10009671 3300031665 Bacteria 3533
107 Ga0316579_10009191 3300031691 Bacteria 4149
108 Ga0316579_10010117 3300031691 Bacteria 3980
109 Ga0265314_10001747 3300031711 Bacteria 23530
110 Ga0265314_10003681 3300031711 Bacteria 14706
111 Ga0265342_10000087 3300031712 Bacteria 100045
112 Ga0265342_10001283 3300031712 Bacteria 23626
113 Ga0316576_10000316 3300031727 Bacteria 21453
114 Ga0316576_10001567 3300031727 Bacteria 12417
115 Ga0316576_10010539 3300031727 Bacteria 6011
116 Ga0316576_10013015 3300031727 Bacteria 5512
117 Ga0316576_10026364 3300031727 Bacteria 4078
118 Ga0316576_10039783 3300031727 Bacteria 3376
119 Ga0316576_10050863 3300031727 Bacteria 3014
120 Ga0316576_10079914 3300031727 Bacteria 2424
121 Ga0316576_10080263 3300031727 Bacteria 2419
122 Ga0316576_10090092 3300031727 Bacteria 2284
123 Ga0316576_10092659 3300031727 Bacteria 2251
124 Ga0316576_10177770 3300031727 Bacteria 1605
125 Ga0316578_10000010 3300031728 Bacteria 44911
126 Ga0316578_10000103 3300031728 Bacteria 20042
127 Ga0316578_10011729 3300031728 Bacteria 4600
128 Ga0316578_10014860 3300031728 Bacteria 4173
129 Ga0316578_10046974 3300031728 Bacteria 2518
130 Ga0316578_10048542 3300031728 Bacteria 2479
131 Ga0316578_10050991 3300031728 Bacteria 2422
132 Ga0316578_10092523 3300031728 Bacteria 1807
133 Ga0316578_10104919 3300031728 Bacteria 1696
134 Ga0316578_10113538 3300031728 Bacteria 1627
135 Ga0316577_10000190 3300031733 Bacteria 20350
136 Ga0316577_10000493 3300031733 Bacteria 15617
137 Ga0316577_10014209 3300031733 Bacteria 4369
138 Ga0316577_10020541 3300031733 Bacteria 3659
139 Ga0316577_10032468 3300031733 Bacteria 2918
140 Ga0316577_10034469 3300031733 Bacteria 2828
141 Ga0316577_10087044 3300031733 Bacteria 1748
142 Ga0307409_100419879 3300031995 Bacteria 1283
143 Ga0316583_10004092 3300032133 Bacteria 5183
144 Ga0316585_10000054 3300032137 Bacteria 18607
145 Ga0316585_10000307 3300032137 Bacteria 10900
146 Ga0316585_10003113 3300032137 Bacteria 4529
147 Ga0316580_10000006 3300032139 Bacteria 32316
148 Ga0316580_10000822 3300032139 Bacteria 7606
149 Ga0316580_10001161 3300032139 Bacteria 6679
150 Ga0316580_10013069 3300032139 Bacteria 2530
151 Ga0316580_10015686 3300032139 Bacteria 2319
152 Ga0316593_10026146 3300032168 Bacteria 1864
153 Ga0307510_10001789 3300033180 Bacteria 23995
154 Ga0316592_1002856 3300033524 Bacteria 3040
155 Ga0316592_1002975 3300033524 Bacteria 2995
156 Ga0316592_1003260 3300033524 Bacteria 2903
157 Ga0316592_1003837 3300033524 Bacteria 2755
158 Ga0316592_1004706 3300033524 Bacteria 2552
159 Ga0316592_1011126 3300033524 Bacteria 1824
160 Ga0316586_1000579 3300033527 Bacteria 3625
161 Ga0316586_1002102 3300033527 Bacteria 2436
162 Ga0316586_1002407 3300033527 Bacteria 2327
163 Ga0316588_1000008 3300033528 Bacteria 13213
164 Ga0316588_1001489 3300033528 Bacteria 3861
165 Ga0316588_1001891 3300033528 Bacteria 3555
166 Ga0316588_1004620 3300033528 Bacteria 2622
167 Ga0316596_1005039 3300033541 Bacteria 2997
168 Ga0373938_0010932 3300034957 Bacteria 1679
169 Ga0373936_0074126 3300035113 Bacteria 1408
170 Ga0316574_0000389 3300035398 Bacteria 17144
171 Ga0316574_0009524 3300035398 Bacteria 5443
172 Ga0316574_0109935 3300035398 Bacteria 1766
173 Ga0316574_0115944 3300035398 Bacteria 1718
174 Ga0316574_0136355 3300035398 Bacteria 1580
175 Ga0316574_0137306 3300035398 Bacteria 1574
176 Ga0316574_0137670 3300035398 Bacteria 1572
177 Ga0316574_0147872 3300035398 Bacteria 1514
178 Ga0373931_0067117 3300035691 Bacteria 1948
179 Ga0316582_0000068 3300036647 Bacteria 26166
180 Ga0316582_0001114 3300036647 Bacteria 11386
181 Ga0316582_0005663 3300036647 Bacteria 6468
182 Ga0316582_0080191 3300036647 Bacteria 2130
183 Ga0316582_0094020 3300036647 Bacteria 1977
184 Ga0316584_0001453 3300036712 Bacteria 14202
185 Ga0316584_0002294 3300036712 Bacteria 12038
186 Ga0316584_0003617 3300036712 Bacteria 10114
187 Ga0316584_0006115 3300036712 Bacteria 8138
188 Ga0316584_0012466 3300036712 Bacteria 5994
189 Ga0316584_0017491 3300036712 Bacteria 5156
190 Ga0316584_0039149 3300036712 Bacteria 3529
191 Ga0316584_0045194 3300036712 Bacteria 3287
192 Ga0316584_0070175 3300036712 Bacteria 2627
193 Ga0395898_0271904 3300037466 Bacteria 1616
194 Ga0436364_0147603 3300037853 Bacteria 8026
195 Ga0436364_0328296 3300037853 Bacteria 143298
196 Ga0436364_0409229 3300037853 Bacteria 1964
197 Ga0436364_0417144 3300037853 Bacteria 1142
198 Ga0436364_1158749 3300037853 Bacteria 2600
199 Ga0436364_1488922 3300037853 Bacteria 2213
200 Ga0436364_1495425 3300037853 Bacteria 1279
201 Ga0400483_093617 3300039062 Bacteria 11973
202 Ga0400483_108100 3300039062 Bacteria 1768
203 Ga0400483_236410 3300039062 Bacteria 5227
204 Ga0400483_279148 3300039062 Bacteria 2451
205 Ga0436365_0333724 3300039437 Bacteria 1606
206 Ga0436365_0484756 3300039437 Bacteria 1675
207 Ga0436365_1159328 3300039437 Bacteria 27033
208 Ga0436360_0444247 3300039438 Bacteria 1581
209 Ga0436360_0908374 3300039438 Bacteria 1844
210 Ga0436363_0551931 3300039450 Bacteria 1720
211 Ga0436363_1250543 3300039450 Bacteria 1452
212 Ga0436363_1273610 3300039450 Bacteria 3394
213 Ga0436362_0381195 3300039453 Bacteria 2863
214 Ga0451839_1593177 3300041496 Bacteria 1117
215 Ga0451577_0000001 3300042876 Bacteria 2461803
216 Ga0451577_0003136 3300042876 Bacteria 18631
217 Ga0451577_0004516 3300042876 Bacteria 14655
218 Ga0451577_0007153 3300042876 Bacteria 11006
219 Ga0451577_0012939 3300042876 Bacteria 7831
220 Ga0451577_0030027 3300042876 Bacteria 4911
221 Ga0451577_0152899 3300042876 Bacteria 2076
222 Ga0451577_0218814 3300042876 Bacteria 1721
223 Ga0451577_0336733 3300042876 Bacteria 1368
224 Ga0453684_0024534 3300044712 Bacteria 8809
225 Ga0453684_0175340 3300044712 Bacteria 2522
226 Ga0453684_0195732 3300044712 Bacteria 2361
227 Ga0453684_0234581 3300044712 Bacteria 2116
228 Ga0453684_0265001 3300044712 Bacteria 1966
229 Ga0453684_0297223 3300044712 Bacteria 1836
230 Ga0466968_0018238 3300044735 Bacteria 2813
231 Ga0451576_0000122 3300045051 Bacteria 197797
232 Ga0451576_0001928 3300045051 Bacteria 33191
233 Ga0451576_0010324 3300045051 Bacteria 10723
234 Ga0451576_0018143 3300045051 Bacteria 7720
235 Ga0451576_0564758 3300045051 Bacteria 1195
236 Ga0495651_0122880 3300046462 Bacteria 1905
237 Ga0495650_0011033 3300046471 Bacteria 4987
238 Ga0495607_0052768 3300046501 Bacteria 2353
239 Ga0495648_0101234 3300046524 Bacteria 1590
240 Ga0495640_0038225 3300046533 Bacteria 3377
241 Ga0495656_0107572 3300046615 Bacteria 1299
242 Ga0495600_0165197 3300046809 Bacteria 1430
243 Ga0495680_0169875 3300047322 Bacteria 1579
244 Ga0495686_0017248 3300047472 Bacteria 4868
245 Ga0495686_0100974 3300047472 Bacteria 1740
246 Ga0495686_0175600 3300047472 Bacteria 1244
247 Ga0495602_0066314 3300048088 Bacteria 3111
248 Ga0496107_0108721 3300048910 Bacteria 2036
249 Ga0496108_0211270 3300048911 Bacteria 1685
250 Ga0496108_0245799 3300048911 Bacteria 1556
251 Ga0496109_0081904 3300048912 Bacteria 2974
252 Ga0496109_0123148 3300048912 Bacteria 2416
253 Ga0496110_0361783 3300048913 Bacteria 1322
254 Ga0496112_0069002 3300048915 Bacteria 3492
255 Ga0496121_0013557 3300048924 Bacteria 8742
256 Ga0501300_006900 3300049523 Bacteria 1666
257 Ga0501033_0112413 3300049570 Bacteria 1981
258 Ga0501036_0243955 3300049572 Bacteria 1506
259 Ga0501038_0044626 3300049574 Bacteria 3849
260 Ga0501047_0040185 3300049581 Bacteria 4524
261 Ga0501070_0002177 3300049586 Bacteria 17230
262 Ga0501073_0290287 3300049589 Bacteria 1129
263 Ga0501080_0006685 3300049742 Bacteria 10379
264 Ga0501280_000622 3300049776 Bacteria 8092
265 Ga0501282_000464 3300049778 Bacteria 4835
266 Ga0501035_0000398 3300049822 Bacteria 49830
267 Ga0501044_0010584 3300049823 Bacteria 10006
268 Ga0501044_0027218 3300049823 Bacteria 6044
269 nmdc:mga0yw44_81483_c1 3300050492 Bacteria 2029
270 Ga0500635_0000034 3300053080 Bacteria 96919
271 Ga0495619_0193432 3300053085 Bacteria 1408
272 Ga0500641_0001247 3300053096 Bacteria 9047
273 Ga0500595_000084 3300053119 Bacteria 66292
274 Ga0500614_002078 3300053123 Bacteria 4573
275 Ga0500559_0000109 3300053136 Bacteria 65246
276 Ga0500559_0035777 3300053136 Bacteria 2146
277 Ga0500577_0000114 3300053142 Bacteria 19725
278 Ga0500589_001983 3300053147 Bacteria 6569
279 Ga0500622_0017772 3300053156 Bacteria 3782
280 2512963777 2512875024 Bacteria 7195110
281 2545674155 2545555834 Bacteria 8130841
282 2596373262 2595698237 Bacteria 6712432
283 2643937275 2643221585 Bacteria 5812563
284 2644299533 2643221653 Bacteria 4569637
285 2644301538 2643221654 Bacteria 5273570
286 2644318440 2643221656 Bacteria 5809961
287 2644338239 2643221660 Bacteria 4208257
288 2644657761 2643221719 Bacteria 4568197
289 2738708824 2738541275 Bacteria 4830863
290 2738744067 2738541281 Bacteria 5112672
291 2738847249 2738541301 Bacteria 4834102
292 2738862978 2738541304 Bacteria 4833665
293 2739295496 2738543022 Bacteria 4835059
294 2739353297 2738543032 Bacteria 5115625
295 2739357174 2738543033 Bacteria 4833336
296 2819244983 2818991272 Bacteria 4622173
297 2829748407 2829745981 Bacteria 5406054
298 2837681543 2837678835 Bacteria 5252418
299 2842336666 2842333319 Bacteria 8899485
300 2842700550 2842698319 Bacteria 5190321
301 2844315610 2844315083 Bacteria 8138177
302 2854685459 2854681122 Bacteria 4548679
303 2861693240 2861691609 Bacteria 5628931
304 2888389561 2888388044 Bacteria 7304136
305 2889307698 2889306138 Bacteria 6358934
306 2894773964 2894772417 Bacteria 5305674
307 2902333379 2902330777 Bacteria 6395352
308 2902407035 2902405164 Bacteria 6784948
309 2903732696 2903727486 Bacteria 8281579
310 2906605464 2906602504 Bacteria 8295279
311 2928102421 2928100450 Bacteria 4837635
312 2928127215 2928125067 Bacteria 5937560
313 2928961075 2928959182 Bacteria 4725774
314 2989780643 2989776772 Bacteria 4843317
315 3003666916 3003665799 Bacteria 7279786
316 641643868 641522639 Bacteria 7737025
317 8005250646 8005246636 Bacteria 4933972
318 8045864981 8045864390 Bacteria 5043873
319 Ga0451576_0001939
320 JGI25153J46596_10003845
321 Ga0065165_1000694
322 Ga0065165_1017009
323 Ga0070658_10004801
324 Ga0070661_100074994
325 Ga0070668_100010185
326 Ga0070668_100113923
327 Ga0070671_100147561
328 Ga0070673_100029728
329 Ga0070663_100017968
330 Ga0070678_100120552
331 Ga0070672_100116952
332 Ga0070672_100119415
333 Ga0070672_100339306
334 Ga0070665_100009298
335 Ga0070665_100009524
336 Ga0070665_100101808
337 Ga0070665_100194921
338 Ga0068859_100100434
339 Ga0068860_100010873
340 Ga0068862_100008472
341 Ga0081540_1017144
342 Ga0081540_1021320
343 Ga0097620_100100435
344 Ga0105240_10014435
345 Ga0105248_10353306
346 Ga0105248_10452580
347 Ga0157371_10199829
348 Ga0157378_10040660
349 Ga0157375_10264974
350 Ga0163163_10078455
351 Ga0157376_10080820
352 Ga0163161_10059682
353 Ga0213876_10012490
354 Ga0213876_10103811
355 Ga0213875_10027274
356 Ga0213875_10052707
357 Ga0209758_1000557
358 Ga0207426_1000712
359 Ga0207426_1032806
360 Ga0207705_10004127
361 Ga0207695_10037138
362 Ga0207644_10097788
363 Ga0207691_10103088
364 Ga0207691_10129552
365 Ga0207691_10219753
366 Ga0207651_10080390
367 Ga0207668_10058581
368 Ga0207668_10191266
369 Ga0207678_10018086
370 Ga0207648_10570494
371 Ga0207683_10020440
372 Ga0207698_10070529
373 Ga0209968_1000461
374 Ga0209966_1000177
375 Ga0268266_10000539
376 Ga0268266_10245951
377 Ga0268265_10009128
378 Ga0268264_10094250
379 Ga0268264_10495344
380 Ga0265337_1001678
381 Ga0265326_10001124
382 Ga0265319_1005338
383 Ga0265334_10000294
384 Ga0265334_10009511
385 Ga0265334_10009913
386 Ga0265318_10000555
387 Ga0265318_10026798
388 Ga0265323_10002000
389 Ga0265322_10026736
390 Ga0265336_10000795
391 Ga0265338_10000081
392 Ga0265338_10014634
393 Ga0265338_10040078
394 Ga0265324_10008656
395 Ga0265330_10000756
396 Ga0265332_10002442
397 Ga0265332_10023231
398 Ga0265332_10038796
399 Ga0265332_10082757
400 Ga0265328_10000030
401 Ga0265328_10002622
402 Ga0265328_10010427
403 Ga0265325_10003894
404 Ga0265325_10008633
405 Ga0265329_10021691
406 Ga0265340_10000960
407 Ga0265339_10003866
408 Ga0265339_10004934
409 Ga0265339_10011380
410 Ga0265331_10001233
411 Ga0265331_10003057
412 Ga0265331_10004445
413 Ga0265327_10000613
414 Ga0265327_10004695
415 Ga0265327_10015229
416 Ga0265327_10022021
417 Ga0265327_10049806
418 Ga0265327_10125849
419 Ga0265316_10005010
420 Ga0265316_10026734
421 Ga0265316_10029344
422 Ga0265313_10006752
423 Ga0265313_10021682
424 Ga0316575_10009671
425 Ga0316579_10009191
426 Ga0316579_10010117
427 Ga0265314_10001747
428 Ga0265314_10003681
429 Ga0265342_10000087
430 Ga0265342_10001283
431 Ga0316576_10000316
432 Ga0316576_10001567
433 Ga0316576_10010539
434 Ga0316576_10013015
435 Ga0316576_10026364
436 Ga0316576_10039783
437 Ga0316576_10050863
438 Ga0316576_10079914
439 Ga0316576_10080263
440 Ga0316576_10090092
441 Ga0316576_10092659
442 Ga0316576_10177770
443 Ga0316578_10000010
444 Ga0316578_10000103
445 Ga0316578_10011729
446 Ga0316578_10014860
447 Ga0316578_10046974
448 Ga0316578_10048542
449 Ga0316578_10050991
450 Ga0316578_10092523
451 Ga0316578_10104919
452 Ga0316578_10113538
453 Ga0316577_10000190
454 Ga0316577_10000493
455 Ga0316577_10014209
456 Ga0316577_10020541
457 Ga0316577_10032468
458 Ga0316577_10034469
459 Ga0316577_10087044
460 Ga0307409_100419879
461 Ga0316583_10004092
462 Ga0316585_10000054
463 Ga0316585_10000307
464 Ga0316585_10003113
465 Ga0316580_10000006
466 Ga0316580_10000822
467 Ga0316580_10001161
468 Ga0316580_10013069
469 Ga0316580_10015686
470 Ga0316593_10026146
471 Ga0307510_10001789
472 Ga0316592_1002856
473 Ga0316592_1002975
474 Ga0316592_1003260
475 Ga0316592_1003837
476 Ga0316592_1004706
477 Ga0316592_1011126
478 Ga0316586_1000579
479 Ga0316586_1002102
480 Ga0316586_1002407
481 Ga0316588_1000008
482 Ga0316588_1001489
483 Ga0316588_1001891
484 Ga0316588_1004620
485 Ga0316596_1005039
486 Ga0373938_0010932
487 Ga0373936_0074126
488 Ga0316574_0000389
489 Ga0316574_0009524
490 Ga0316574_0109935
491 Ga0316574_0115944
492 Ga0316574_0136355
493 Ga0316574_0137306
494 Ga0316574_0137670
495 Ga0316574_0147872
496 Ga0373931_0067117
497 Ga0316582_0000068
498 Ga0316582_0001114
499 Ga0316582_0005663
500 Ga0316582_0080191
501 Ga0316582_0094020
502 Ga0316584_0001453
503 Ga0316584_0002294
504 Ga0316584_0003617
505 Ga0316584_0006115
506 Ga0316584_0012466
507 Ga0316584_0017491
508 Ga0316584_0039149
509 Ga0316584_0045194
510 Ga0316584_0070175
511 Ga0395898_0271904
512 Ga0436364_0147603
513 Ga0436364_0328296
514 Ga0436364_0409229
515 Ga0436364_0417144
516 Ga0436364_1158749
517 Ga0436364_1488922
518 Ga0436364_1495425
519 Ga0400483_093617
520 Ga0400483_108100
521 Ga0400483_236410
522 Ga0400483_279148
523 Ga0436365_0333724
524 Ga0436365_0484756
525 Ga0436365_1159328
526 Ga0436360_0444247
527 Ga0436360_0908374
528 Ga0436363_0551931
529 Ga0436363_1250543
530 Ga0436363_1273610
531 Ga0436362_0381195
532 Ga0451839_1593177
533 Ga0451577_0000001
534 Ga0451577_0003136
535 Ga0451577_0004516
536 Ga0451577_0007153
537 Ga0451577_0012939
538 Ga0451577_0030027
539 Ga0451577_0152899
540 Ga0451577_0218814
541 Ga0451577_0336733
542 Ga0453684_0024534
543 Ga0453684_0175340
544 Ga0453684_0195732
545 Ga0453684_0234581
546 Ga0453684_0265001
547 Ga0453684_0297223
548 Ga0466968_0018238
549 Ga0451576_0000122
550 Ga0451576_0001928
551 Ga0451576_0010324
552 Ga0451576_0018143
553 Ga0451576_0564758
554 Ga0495651_0122880
555 Ga0495650_0011033
556 Ga0495607_0052768
557 Ga0495648_0101234
558 Ga0495640_0038225
559 Ga0495656_0107572
560 Ga0495600_0165197
561 Ga0495680_0169875
562 Ga0495686_0017248
563 Ga0495686_0100974
564 Ga0495686_0175600
565 Ga0495602_0066314
566 Ga0496107_0108721
567 Ga0496108_0211270
568 Ga0496108_0245799
569 Ga0496109_0081904
570 Ga0496109_0123148
571 Ga0496110_0361783
572 Ga0496112_0069002
573 Ga0496121_0013557
574 Ga0501300_006900
575 Ga0501033_0112413
576 Ga0501036_0243955
577 Ga0501038_0044626
578 Ga0501047_0040185
579 Ga0501070_0002177
580 Ga0501073_0290287
581 Ga0501080_0006685
582 Ga0501280_000622
583 Ga0501282_000464
584 Ga0501035_0000398
585 Ga0501044_0010584
586 Ga0501044_0027218
587 nmdc:mga0yw44_81483_c1
588 Ga0500635_0000034
589 Ga0495619_0193432
590 Ga0500641_0001247
591 Ga0500595_000084
592 Ga0500614_002078
593 Ga0500559_0000109
594 Ga0500559_0035777
595 Ga0500577_0000114
596 Ga0500589_001983
597 Ga0500622_0017772
598 2512963777
599 2545674155
600 2596373262
601 2643937275
602 2644299533
603 2644301538
604 2644318440
605 2644338239
606 2644657761
607 2738708824
608 2738744067
609 2738847249
610 2738862978
611 2739295496
612 2739353297
613 2739357174
614 2819244983
615 2829748407
616 2837681543
617 2842336666
618 2842700550
619 2844315610
620 2854685459
621 2861693240
622 2888389561
623 2889307698
624 2894773964
625 2902333379
626 2902407035
627 2903732696
628 2906605464
629 2928102421
630 2928127215
631 2928961075
632 2989780643
633 3003666916
634 641643868
635 8005250646
636 8045864981

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00142

Fer4_NifH

4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family

58

323

0.97

PF02374

ArsA_ATPase

Anion-transporting ATPase

57

103

0.94

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

59

280

0.92

PF13614

AAA_31

AAA domain

57

126

0.89

PF10609

ParA

NUBPL iron-transfer P-loop NTPase

55

299

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
1cp2-assembly1.cif.gz_B nitrogenase iron protein from clostridium pasteurianum 0.8948 33 293
1g20-assembly1.cif.gz_F mgatp-bound and nucleotide-free structures of a nitrogenase protein complex between leu127del-fe protein and the mofe protein 0.8885 33 293
6n4l-assembly1.cif.gz_A dithionite-reduced adp-bound form of the nitrogenase fe-protein from a. vinelandii 0.8833 33 293
1g20-assembly1.cif.gz_G mgatp-bound and nucleotide-free structures of a nitrogenase protein complex between leu127del-fe protein and the mofe protein 0.8831 33 293
1g21-assembly1.cif.gz_F mgatp-bound and nucleotide-free structures of a nitrogenase protein complex between leu127del-fe protein and the mofe protein 0.8824 33 293
ID Description Score Start End Superfamily
3endA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8733 33 293 3.40.50.300
6q93B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8733 33 293 3.40.50.300
3endA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.849 33 293 3.40.50.300
6q93B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8317 33 293 3.40.50.300
1hyqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7768 33 274 3.40.50.300
ID Description Score Start End GO Terms
AF-C4P245-F1-model_v4 Bacteriochlorophyllide reductase-like protein 0.9412 42 162 GO:0005524
GO:0016491
GO:0046872
GO:0051536
AF-A0A0N9P9H8-F1-model_v4 Chlorophyllide reductase X subunit 0.9391 61 251 GO:0005524
GO:0015979
GO:0016628
GO:0030494
GO:0046872
GO:0051539
AF-C4P245-F1-model_v4 Bacteriochlorophyllide reductase-like protein 0.9338 42 162 GO:0005524
GO:0016491
GO:0046872
GO:0051536
AF-A0A3D2N104-F1-model_v4 Chlorophyllide a reductase iron protein subunit X 0.9332 21 286 GO:0005524
GO:0015979
GO:0016628
GO:0030494
GO:0046872
GO:0051539
AF-A0A0N9P9H8-F1-model_v4 Chlorophyllide reductase X subunit 0.9298 61 251 GO:0005524
GO:0015979
GO:0016628
GO:0030494
GO:0046872
GO:0051539

Map