F404688

General Info

Members Datasets Scaffolds Average Seq Length
318 200 636 278

Family's Representative Sequence

Representative Sequence 3300035083|Ga0373926_0001113|Ga0373926_0001113_6735_7652
Length 305
Sequence LNDSSHEKAFSAMTAEPLARSAATSRPADGEAATLITVAPTGAESEKSAVPALPATLEELVTTAKECREAGASVIHVHIRDEQTRPTLDISKLADTVRALREATDLIVQLSTGGAVTDSFDRRLAVLDAGPDGCSLTCGTVNFGDDVFMNPWPFMCELYVRTQQLGVVPEFELFDMGHVAALHKLLDKFGAPHGGHVHCDLVMGVPGGMPGNAATLVQAVAALPEGATWSATGVGRTSLPVIFAALAAGGHLRVGMEDTITFSRGRPVVSNAELVARAATLAELVQRPAMEPDQARAMLGIAARR

Samples

Sample ID Description Type Environment
1 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
73 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
76 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
77 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
78 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
89 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
90 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
91 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
92 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
94 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
95 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
100 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
101 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
108 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
183 2558860280 Kutzneria sp. 744 Isolate Unclassified
184 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
185 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
186 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
187 2643221711 Terrabacter sp. Root85 Isolate Unclassified
188 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
189 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
190 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
191 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
192 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
193 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
194 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
195 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
196 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
197 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
198 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
199 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
200 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.4
Metatranscriptomes 0.94
Isolates 5.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.47
Rhizosphere 80.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373926_0001113 3300035083 Bacteria 7957
2 JGI24739J22299_10024357 3300001989 Bacteria 2134
3 JGI25406J46586_10000512 3300003203 Bacteria 18127
4 Ga0070683_100216035 3300005329 Bacteria 1822
5 Ga0070680_100064030 3300005336 Bacteria 3013
6 Ga0070660_100386256 3300005339 Bacteria 1156
7 Ga0070661_100090168 3300005344 Bacteria 2270
8 Ga0070668_100001053 3300005347 Bacteria 19375
9 Ga0070659_100509389 3300005366 Bacteria 1026
10 Ga0070667_100027485 3300005367 Bacteria 4734
11 Ga0070709_10042810 3300005434 Bacteria 2798
12 Ga0070709_10211283 3300005434 Bacteria 1379
13 Ga0070710_10058637 3300005437 Bacteria 2184
14 Ga0070711_100079505 3300005439 Bacteria 2332
15 Ga0070678_100196984 3300005456 Bacteria 1660
16 Ga0070678_100436953 3300005456 Bacteria 1144
17 Ga0070681_10197359 3300005458 Bacteria 1931
18 Ga0070707_100085697 3300005468 Bacteria 3045
19 Ga0070679_100019854 3300005530 Bacteria 6543
20 Ga0070679_100130297 3300005530 Bacteria 2496
21 Ga0068853_100010451 3300005539 Bacteria 7514
22 Ga0068857_100098089 3300005577 Bacteria 2628
23 Ga0068857_100137328 3300005577 Bacteria 2208
24 Ga0068856_100349155 3300005614 Bacteria 1498
25 Ga0070702_100020173 3300005615 Bacteria 3487
26 Ga0068852_100209298 3300005616 Bacteria 1849
27 Ga0068864_100140645 3300005618 Bacteria 2177
28 Ga0068863_100538828 3300005841 Bacteria 1152
29 Ga0081455_10000575 3300005937 Bacteria 47885
30 Ga0081539_10000474 3300005985 Bacteria 85045
31 Ga0081539_10002821 3300005985 Bacteria 23217
32 Ga0070717_10058198 3300006028 Bacteria 3196
33 Ga0070717_10299070 3300006028 Bacteria 1430
34 Ga0070717_10338853 3300006028 Bacteria 1342
35 Ga0070715_10000317 3300006163 Bacteria 11892
36 Ga0070716_100061172 3300006173 Bacteria 2178
37 Ga0075428_100143424 3300006844 Bacteria 2596
38 Ga0075430_100001089 3300006846 Bacteria 21567
39 Ga0105245_10009113 3300009098 Bacteria 8652
40 Ga0105245_10694474 3300009098 Bacteria 1050
41 Ga0114129_10226870 3300009147 Bacteria 2517
42 Ga0105243_10075341 3300009148 Bacteria 2739
43 Ga0105243_10116651 3300009148 Bacteria 2243
44 Ga0105243_10232197 3300009148 Bacteria 1637
45 Ga0105243_10503313 3300009148 Bacteria 1148
46 Ga0105242_10090798 3300009176 Bacteria 2570
47 Ga0105238_10133794 3300009551 Bacteria 2457
48 Ga0105249_10116199 3300009553 Bacteria 2536
49 Ga0105249_10336965 3300009553 Bacteria 1524
50 Ga0105239_10721625 3300010375 Bacteria 1140
51 Ga0157347_1005359 3300012502 Bacteria 1223
52 Ga0157369_10614001 3300013105 Bacteria 1122
53 Ga0157369_10732361 3300013105 Bacteria 1018
54 Ga0163162_10039975 3300013306 Bacteria 4688
55 Ga0163162_10226968 3300013306 Bacteria 1997
56 Ga0163162_10360402 3300013306 Bacteria 1587
57 Ga0157375_10641001 3300013308 Bacteria 1219
58 Ga0163163_10075958 3300014325 Bacteria 3354
59 Ga0163163_10105857 3300014325 Bacteria 2838
60 Ga0157380_10084594 3300014326 Bacteria 2601
61 Ga0157380_10229588 3300014326 Bacteria 1666
62 Ga0157380_10782238 3300014326 Bacteria 969
63 Ga0157377_10173374 3300014745 Bacteria 1351
64 Ga0206356_10089022 3300020070 Bacteria 947
65 Ga0206354_11348840 3300020081 Bacteria 2584
66 Ga0206353_10421402 3300020082 Bacteria 1925
67 Ga0207692_10008975 3300025898 Bacteria 4161
68 Ga0207692_10011038 3300025898 Bacteria 3825
69 Ga0207643_10238415 3300025908 Bacteria 1117
70 Ga0207707_10250838 3300025912 Bacteria 1537
71 Ga0207693_10003796 3300025915 Bacteria 12867
72 Ga0207693_10012840 3300025915 Bacteria 6757
73 Ga0207663_10280651 3300025916 Bacteria 1237
74 Ga0207657_10189762 3300025919 Bacteria 1658
75 Ga0207652_10227692 3300025921 Bacteria 1680
76 Ga0207646_10053362 3300025922 Bacteria 3616
77 Ga0207700_10004124 3300025928 Bacteria 8526
78 Ga0207664_10280403 3300025929 Bacteria 1462
79 Ga0207690_10316274 3300025932 Bacteria 1226
80 Ga0207709_10330821 3300025935 Bacteria 1143
81 Ga0207709_10354930 3300025935 Bacteria 1108
82 Ga0207665_10002307 3300025939 Bacteria 12880
83 Ga0207665_10099398 3300025939 Bacteria 2029
84 Ga0207711_10212921 3300025941 Bacteria 1766
85 Ga0207661_10463934 3300025944 Bacteria 1155
86 Ga0207661_10592362 3300025944 Bacteria 1017
87 Ga0207712_10051896 3300025961 Bacteria 2870
88 Ga0207658_10037274 3300025986 Bacteria 3492
89 Ga0207639_10174635 3300026041 Bacteria 1823
90 Ga0207641_10376969 3300026088 Bacteria 1358
91 Ga0207674_10023550 3300026116 Bacteria 6592
92 Ga0207674_10644314 3300026116 Bacteria 1023
93 Ga0207683_10080988 3300026121 Bacteria 2881
94 Ga0207698_10505341 3300026142 Bacteria 1177
95 Ga0207698_10645071 3300026142 Bacteria 1048
96 Ga0268266_10101296 3300028379 Bacteria 2539
97 Ga0307512_10035518 3300030522 Bacteria 4245
98 Ga0307513_10009652 3300031456 Bacteria 12188
99 Ga0307408_100167414 3300031548 Bacteria 1752
100 Ga0307408_100275097 3300031548 Bacteria 1400
101 Ga0307508_10080278 3300031616 Bacteria 2844
102 Ga0316575_10015219 3300031665 Bacteria 2897
103 Ga0316576_10053401 3300031727 Bacteria 2944
104 Ga0316576_10100568 3300031727 Bacteria 2160
105 Ga0316578_10018509 3300031728 Bacteria 3819
106 Ga0316578_10048902 3300031728 Bacteria 2470
107 Ga0307413_10030018 3300031824 Bacteria 3049
108 Ga0307413_10068896 3300031824 Bacteria 2218
109 Ga0307410_10019487 3300031852 Bacteria 4128
110 Ga0307406_10066156 3300031901 Bacteria 2351
111 Ga0307406_10071014 3300031901 Bacteria 2281
112 Ga0307407_10232906 3300031903 Bacteria 1252
113 Ga0307407_10448732 3300031903 Bacteria 936
114 Ga0307409_100015481 3300031995 Bacteria 5007
115 Ga0307409_100043542 3300031995 Bacteria 3372
116 Ga0307409_100078886 3300031995 Bacteria 2651
117 Ga0307409_100099889 3300031995 Bacteria 2404
118 Ga0307409_100158226 3300031995 Bacteria 1977
119 Ga0307416_100363279 3300032002 Bacteria 1471
120 Ga0307414_10307580 3300032004 Bacteria 1344
121 Ga0307411_10102492 3300032005 Bacteria 2028
122 Ga0307411_10279678 3300032005 Bacteria 1328
123 Ga0307415_100021042 3300032126 Bacteria 3999
124 Ga0307415_100023078 3300032126 Bacteria 3854
125 Ga0307415_100535965 3300032126 Bacteria 1030
126 Ga0316214_1002917 3300033545 Bacteria 2129
127 Ga0373926_0022544 3300035083 Bacteria 2184
128 Ga0373940_0004911 3300035088 Bacteria 2859
129 Ga0373944_0002603 3300035089 Bacteria 4595
130 Ga0373932_0043211 3300035112 Bacteria 1310
131 Ga0373936_0001607 3300035113 Bacteria 8251
132 Ga0373936_0031036 3300035113 Bacteria 2109
133 Ga0373945_0000023 3300035116 Bacteria 31398
134 Ga0373954_0062130 3300035118 Bacteria 1764
135 Ga0373956_0005414 3300035119 Bacteria 5110
136 Ga0373943_0001311 3300035170 Bacteria 11175
137 Ga0373946_0000155 3300035171 Bacteria 20705
138 Ga0373955_0046815 3300035172 Bacteria 2339
139 Ga0373942_0000020 3300035207 Bacteria 30859
140 Ga0373962_0000500 3300035242 Bacteria 8736
141 Ga0316574_0015307 3300035398 Bacteria 4447
142 Ga0316574_0037355 3300035398 Bacteria 2978
143 Ga0373935_0013091 3300035692 Bacteria 5000
144 Ga0373927_0095071 3300035695 Bacteria 1936
145 Ga0373933_0016368 3300035724 Bacteria 4145
146 Ga0373947_0004117 3300035725 Bacteria 8547
147 Ga0373937_0713860 3300036401 Bacteria 949
148 Ga0316582_0001548 3300036647 Bacteria 10193
149 Ga0316584_0023199 3300036712 Bacteria 4533
150 Ga0316584_0115322 3300036712 Bacteria 2009
151 Ga0373925_0021753 3300037068 Bacteria 4674
152 Ga0373925_0115936 3300037068 Bacteria 2074
153 Ga0395899_0076668 3300037312 Bacteria 2440
154 Ga0395899_0122471 3300037312 Bacteria 1862
155 Ga0395899_0326721 3300037312 Bacteria 1032
156 Ga0395900_0008227 3300037418 Bacteria 10742
157 Ga0395900_0085677 3300037418 Bacteria 3238
158 Ga0395900_0192808 3300037418 Bacteria 2066
159 Ga0395900_0341311 3300037418 Bacteria 1473
160 Ga0395898_0067672 3300037466 Bacteria 3457
161 Ga0395898_0073541 3300037466 Bacteria 3302
162 Ga0395898_0137235 3300037466 Bacteria 2342
163 Ga0436364_0466117 3300037853 Bacteria 6771
164 Ga0395901_0011481 3300038443 Bacteria 8976
165 Ga0395901_0026142 3300038443 Bacteria 5993
166 Ga0395901_0063756 3300038443 Bacteria 3836
167 Ga0395901_0150748 3300038443 Bacteria 2443
168 Ga0395901_0244911 3300038443 Bacteria 1869
169 Ga0395901_0281172 3300038443 Bacteria 1729
170 Ga0436365_0883668 3300039437 Bacteria 1408
171 Ga0466965_0044843 3300044683 Bacteria 2187
172 Ga0466965_0248736 3300044683 Bacteria 953
173 Ga0466966_0003086 3300044684 Bacteria 10978
174 Ga0466966_0090040 3300044684 Bacteria 1905
175 Ga0466966_0252421 3300044684 Bacteria 1062
176 Ga0466961_0004196 3300044693 Bacteria 9009
177 Ga0466961_0098607 3300044693 Bacteria 1842
178 Ga0466963_0041203 3300044694 Bacteria 3028
179 Ga0466963_0121752 3300044694 Bacteria 1796
180 Ga0466963_0172206 3300044694 Bacteria 1509
181 Ga0466971_0087075 3300044719 Bacteria 1428
182 Ga0466970_0028771 3300044765 Bacteria 2922
183 Ga0466957_0003979 3300044842 Bacteria 8170
184 Ga0466957_0061662 3300044842 Bacteria 2302
185 Ga0466960_0028231 3300044901 Bacteria 2567
186 Ga0466960_0089932 3300044901 Bacteria 1563
187 Ga0466960_0239159 3300044901 Bacteria 1005
188 Ga0466959_0102978 3300045049 Bacteria 2042
189 Ga0466959_0262310 3300045049 Bacteria 1189
190 Ga0466958_0025732 3300045836 Bacteria 3472
191 Ga0466958_0276459 3300045836 Bacteria 1076
192 Ga0466967_0009323 3300045976 Bacteria 7274
193 Ga0466967_0179484 3300045976 Bacteria 1996
194 Ga0466967_0286061 3300045976 Bacteria 1583
195 Ga0466967_0317194 3300045976 Bacteria 1503
196 Ga0466967_0342890 3300045976 Bacteria 1445
197 Ga0495641_0044353 3300046461 Bacteria 2052
198 Ga0495651_0120143 3300046462 Bacteria 1932
199 Ga0495653_0002706 3300046463 Bacteria 14128
200 Ga0495653_0194441 3300046463 Bacteria 1382
201 Ga0495664_0003244 3300046477 Bacteria 8841
202 Ga0495608_0008245 3300046511 Bacteria 7315
203 Ga0495608_0039622 3300046511 Bacteria 3157
204 Ga0495628_0282815 3300046516 Bacteria 1231
205 Ga0495640_0046499 3300046533 Bacteria 3007
206 Ga0495667_0008264 3300046559 Bacteria 7057
207 Ga0495667_0047355 3300046559 Bacteria 2841
208 Ga0495668_0076966 3300046616 Bacteria 1832
209 Ga0495635_0003587 3300046663 Bacteria 10740
210 Ga0495635_0005700 3300046663 Bacteria 8678
211 Ga0495657_0042058 3300046675 Bacteria 3122
212 Ga0495624_0001191 3300046690 Bacteria 20556
213 Ga0495604_0051690 3300047317 Bacteria 3184
214 Ga0495674_0000654 3300047319 Bacteria 32473
215 Ga0495676_0007138 3300047321 Bacteria 10251
216 Ga0495680_0008274 3300047322 Bacteria 9471
217 Ga0495684_0004087 3300047471 Bacteria 11395
218 Ga0495684_0026376 3300047471 Bacteria 4465
219 Ga0495684_0183009 3300047471 Bacteria 1552
220 Ga0495593_0062064 3300047673 Bacteria 1954
221 Ga0495593_0153388 3300047673 Bacteria 1165
222 Ga0496100_0156843 3300048903 Bacteria 1628
223 Ga0496101_0023377 3300048904 Bacteria 4269
224 Ga0496101_0027870 3300048904 Bacteria 3940
225 Ga0496101_0109097 3300048904 Bacteria 2082
226 Ga0496102_0006948 3300048905 Bacteria 9656
227 Ga0496102_0008402 3300048905 Bacteria 8845
228 Ga0496102_0238984 3300048905 Bacteria 1713
229 Ga0496102_0418456 3300048905 Bacteria 1259
230 Ga0496104_0002443 3300048907 Bacteria 15995
231 Ga0496104_0039628 3300048907 Bacteria 4412
232 Ga0496104_0045077 3300048907 Bacteria 4146
233 Ga0496104_0197106 3300048907 Bacteria 1926
234 Ga0496104_0197824 3300048907 Bacteria 1922
235 Ga0496104_0251992 3300048907 Bacteria 1678
236 Ga0496104_0344328 3300048907 Bacteria 1403
237 Ga0496105_0003130 3300048908 Bacteria 12180
238 Ga0496105_0108974 3300048908 Bacteria 2286
239 Ga0496105_0134960 3300048908 Bacteria 2033
240 Ga0496105_0175550 3300048908 Bacteria 1755
241 Ga0496105_0337234 3300048908 Bacteria 1206
242 Ga0496106_0159817 3300048909 Bacteria 1782
243 Ga0496107_0076217 3300048910 Bacteria 2442
244 Ga0496107_0107973 3300048910 Bacteria 2044
245 Ga0496107_0343764 3300048910 Bacteria 1110
246 Ga0496108_0003988 3300048911 Bacteria 11847
247 Ga0496108_0070251 3300048911 Bacteria 2955
248 Ga0496108_0304467 3300048911 Bacteria 1388
249 Ga0496109_0031216 3300048912 Bacteria 4780
250 Ga0496109_0106691 3300048912 Bacteria 2602
251 Ga0496109_0407039 3300048912 Bacteria 1285
252 Ga0496110_0022391 3300048913 Bacteria 5365
253 Ga0496111_0029184 3300048914 Bacteria 3916
254 Ga0496111_0089248 3300048914 Bacteria 2258
255 Ga0496111_0096602 3300048914 Bacteria 2168
256 Ga0496111_0236739 3300048914 Bacteria 1356
257 Ga0496112_0041908 3300048915 Bacteria 4480
258 Ga0496112_0087749 3300048915 Bacteria 3078
259 Ga0496113_0015754 3300048916 Bacteria 5207
260 Ga0496113_0197828 3300048916 Bacteria 1597
261 Ga0496114_0005036 3300048917 Bacteria 10307
262 Ga0496114_0011307 3300048917 Bacteria 7129
263 Ga0496114_0033602 3300048917 Bacteria 4227
264 Ga0496114_0037377 3300048917 Bacteria 4015
265 Ga0496114_0049932 3300048917 Bacteria 3481
266 Ga0496114_0080108 3300048917 Bacteria 2758
267 Ga0496114_0147357 3300048917 Bacteria 2041
268 Ga0501036_0014161 3300049572 Bacteria 6633
269 Ga0501036_0105083 3300049572 Bacteria 2388
270 Ga0501036_0418794 3300049572 Bacteria 1117
271 Ga0501038_0203426 3300049574 Bacteria 1588
272 Ga0501039_0011115 3300049575 Bacteria 6862
273 Ga0501039_0148903 3300049575 Bacteria 1839
274 Ga0501040_0017639 3300049576 Bacteria 4738
275 Ga0501041_0037302 3300049577 Bacteria 2945
276 Ga0501042_0052716 3300049578 Bacteria 2902
277 Ga0501043_0184292 3300049579 Bacteria 1626
278 Ga0501046_0055311 3300049580 Bacteria 3120
279 Ga0501046_0236309 3300049580 Bacteria 1349
280 Ga0501047_0102277 3300049581 Bacteria 2744
281 Ga0501048_0014629 3300049582 Bacteria 5807
282 Ga0501048_0067287 3300049582 Bacteria 2532
283 Ga0501071_0076829 3300049587 Bacteria 2439
284 Ga0501072_0036101 3300049588 Bacteria 3874
285 Ga0501074_0095566 3300049590 Bacteria 2128
286 Ga0501075_0202097 3300049591 Bacteria 1515
287 Ga0501077_0031466 3300049593 Bacteria 3376
288 Ga0501045_0079193 3300049824 Bacteria 2423
289 Ga0501045_0086135 3300049824 Bacteria 2319
290 Ga0501045_0148553 3300049824 Bacteria 1743
291 nmdc:mga0qj67_328160_c1 3300050509 Bacteria 1238
292 nmdc:mga06r32_11567_c1 3300050510 Bacteria 5199
293 nmdc:mga0rr50_24796_c1 3300050513 Bacteria 4160
294 Ga0495619_0043627 3300053085 Bacteria 2941
295 Ga0495619_0204307 3300053085 Bacteria 1368
296 Ga0501084_0013964 3300054114 Bacteria 6648
297 Ga0501084_0015954 3300054114 Bacteria 6234
298 Ga0501082_0034119 3300060353 Bacteria 4389
299 Ga0466962_0111063 3300061719 Bacteria 1320
300 Ga0530510_0020042 3300061734 Bacteria 4754
301 2559428288 2558860280 Bacteria 11429938
302 2623497779 2622736605 Bacteria 4992138
303 2643852299 2643221567 Bacteria 4163945
304 2644136821 2643221624 Bacteria 4384879
305 2644607763 2643221711 Bacteria 4865335
306 2791916896 2791354901 Bacteria 8322202
307 2808871885 2808606365 Bacteria 4301966
308 2812373236 2811994882 Bacteria 4688362
309 2819426035 2818991318 Bacteria 5266538
310 2819665094 2818991458 Bacteria 4794049
311 2819692809 2818991462 Bacteria 4320267
312 2819727208 2818991469 Bacteria 4644110
313 2870727822 2870721527 Bacteria 9689237
314 2891327838 2891326441 Bacteria 6439512
315 2919448259 2919446982 Bacteria 3994487
316 3003004973 3002998708 Bacteria 11715108
317 8047716306 8047710418 Bacteria 11023148
318 8053952199 8053945823 Bacteria 8962862
319 Ga0373926_0001113
320 JGI24739J22299_10024357
321 JGI25406J46586_10000512
322 Ga0070683_100216035
323 Ga0070680_100064030
324 Ga0070660_100386256
325 Ga0070661_100090168
326 Ga0070668_100001053
327 Ga0070659_100509389
328 Ga0070667_100027485
329 Ga0070709_10042810
330 Ga0070709_10211283
331 Ga0070710_10058637
332 Ga0070711_100079505
333 Ga0070678_100196984
334 Ga0070678_100436953
335 Ga0070681_10197359
336 Ga0070707_100085697
337 Ga0070679_100019854
338 Ga0070679_100130297
339 Ga0068853_100010451
340 Ga0068857_100098089
341 Ga0068857_100137328
342 Ga0068856_100349155
343 Ga0070702_100020173
344 Ga0068852_100209298
345 Ga0068864_100140645
346 Ga0068863_100538828
347 Ga0081455_10000575
348 Ga0081539_10000474
349 Ga0081539_10002821
350 Ga0070717_10058198
351 Ga0070717_10299070
352 Ga0070717_10338853
353 Ga0070715_10000317
354 Ga0070716_100061172
355 Ga0075428_100143424
356 Ga0075430_100001089
357 Ga0105245_10009113
358 Ga0105245_10694474
359 Ga0114129_10226870
360 Ga0105243_10075341
361 Ga0105243_10116651
362 Ga0105243_10232197
363 Ga0105243_10503313
364 Ga0105242_10090798
365 Ga0105238_10133794
366 Ga0105249_10116199
367 Ga0105249_10336965
368 Ga0105239_10721625
369 Ga0157347_1005359
370 Ga0157369_10614001
371 Ga0157369_10732361
372 Ga0163162_10039975
373 Ga0163162_10226968
374 Ga0163162_10360402
375 Ga0157375_10641001
376 Ga0163163_10075958
377 Ga0163163_10105857
378 Ga0157380_10084594
379 Ga0157380_10229588
380 Ga0157380_10782238
381 Ga0157377_10173374
382 Ga0206356_10089022
383 Ga0206354_11348840
384 Ga0206353_10421402
385 Ga0207692_10008975
386 Ga0207692_10011038
387 Ga0207643_10238415
388 Ga0207707_10250838
389 Ga0207693_10003796
390 Ga0207693_10012840
391 Ga0207663_10280651
392 Ga0207657_10189762
393 Ga0207652_10227692
394 Ga0207646_10053362
395 Ga0207700_10004124
396 Ga0207664_10280403
397 Ga0207690_10316274
398 Ga0207709_10330821
399 Ga0207709_10354930
400 Ga0207665_10002307
401 Ga0207665_10099398
402 Ga0207711_10212921
403 Ga0207661_10463934
404 Ga0207661_10592362
405 Ga0207712_10051896
406 Ga0207658_10037274
407 Ga0207639_10174635
408 Ga0207641_10376969
409 Ga0207674_10023550
410 Ga0207674_10644314
411 Ga0207683_10080988
412 Ga0207698_10505341
413 Ga0207698_10645071
414 Ga0268266_10101296
415 Ga0307512_10035518
416 Ga0307513_10009652
417 Ga0307408_100167414
418 Ga0307408_100275097
419 Ga0307508_10080278
420 Ga0316575_10015219
421 Ga0316576_10053401
422 Ga0316576_10100568
423 Ga0316578_10018509
424 Ga0316578_10048902
425 Ga0307413_10030018
426 Ga0307413_10068896
427 Ga0307410_10019487
428 Ga0307406_10066156
429 Ga0307406_10071014
430 Ga0307407_10232906
431 Ga0307407_10448732
432 Ga0307409_100015481
433 Ga0307409_100043542
434 Ga0307409_100078886
435 Ga0307409_100099889
436 Ga0307409_100158226
437 Ga0307416_100363279
438 Ga0307414_10307580
439 Ga0307411_10102492
440 Ga0307411_10279678
441 Ga0307415_100021042
442 Ga0307415_100023078
443 Ga0307415_100535965
444 Ga0316214_1002917
445 Ga0373926_0022544
446 Ga0373940_0004911
447 Ga0373944_0002603
448 Ga0373932_0043211
449 Ga0373936_0001607
450 Ga0373936_0031036
451 Ga0373945_0000023
452 Ga0373954_0062130
453 Ga0373956_0005414
454 Ga0373943_0001311
455 Ga0373946_0000155
456 Ga0373955_0046815
457 Ga0373942_0000020
458 Ga0373962_0000500
459 Ga0316574_0015307
460 Ga0316574_0037355
461 Ga0373935_0013091
462 Ga0373927_0095071
463 Ga0373933_0016368
464 Ga0373947_0004117
465 Ga0373937_0713860
466 Ga0316582_0001548
467 Ga0316584_0023199
468 Ga0316584_0115322
469 Ga0373925_0021753
470 Ga0373925_0115936
471 Ga0395899_0076668
472 Ga0395899_0122471
473 Ga0395899_0326721
474 Ga0395900_0008227
475 Ga0395900_0085677
476 Ga0395900_0192808
477 Ga0395900_0341311
478 Ga0395898_0067672
479 Ga0395898_0073541
480 Ga0395898_0137235
481 Ga0436364_0466117
482 Ga0395901_0011481
483 Ga0395901_0026142
484 Ga0395901_0063756
485 Ga0395901_0150748
486 Ga0395901_0244911
487 Ga0395901_0281172
488 Ga0436365_0883668
489 Ga0466965_0044843
490 Ga0466965_0248736
491 Ga0466966_0003086
492 Ga0466966_0090040
493 Ga0466966_0252421
494 Ga0466961_0004196
495 Ga0466961_0098607
496 Ga0466963_0041203
497 Ga0466963_0121752
498 Ga0466963_0172206
499 Ga0466971_0087075
500 Ga0466970_0028771
501 Ga0466957_0003979
502 Ga0466957_0061662
503 Ga0466960_0028231
504 Ga0466960_0089932
505 Ga0466960_0239159
506 Ga0466959_0102978
507 Ga0466959_0262310
508 Ga0466958_0025732
509 Ga0466958_0276459
510 Ga0466967_0009323
511 Ga0466967_0179484
512 Ga0466967_0286061
513 Ga0466967_0317194
514 Ga0466967_0342890
515 Ga0495641_0044353
516 Ga0495651_0120143
517 Ga0495653_0002706
518 Ga0495653_0194441
519 Ga0495664_0003244
520 Ga0495608_0008245
521 Ga0495608_0039622
522 Ga0495628_0282815
523 Ga0495640_0046499
524 Ga0495667_0008264
525 Ga0495667_0047355
526 Ga0495668_0076966
527 Ga0495635_0003587
528 Ga0495635_0005700
529 Ga0495657_0042058
530 Ga0495624_0001191
531 Ga0495604_0051690
532 Ga0495674_0000654
533 Ga0495676_0007138
534 Ga0495680_0008274
535 Ga0495684_0004087
536 Ga0495684_0026376
537 Ga0495684_0183009
538 Ga0495593_0062064
539 Ga0495593_0153388
540 Ga0496100_0156843
541 Ga0496101_0023377
542 Ga0496101_0027870
543 Ga0496101_0109097
544 Ga0496102_0006948
545 Ga0496102_0008402
546 Ga0496102_0238984
547 Ga0496102_0418456
548 Ga0496104_0002443
549 Ga0496104_0039628
550 Ga0496104_0045077
551 Ga0496104_0197106
552 Ga0496104_0197824
553 Ga0496104_0251992
554 Ga0496104_0344328
555 Ga0496105_0003130
556 Ga0496105_0108974
557 Ga0496105_0134960
558 Ga0496105_0175550
559 Ga0496105_0337234
560 Ga0496106_0159817
561 Ga0496107_0076217
562 Ga0496107_0107973
563 Ga0496107_0343764
564 Ga0496108_0003988
565 Ga0496108_0070251
566 Ga0496108_0304467
567 Ga0496109_0031216
568 Ga0496109_0106691
569 Ga0496109_0407039
570 Ga0496110_0022391
571 Ga0496111_0029184
572 Ga0496111_0089248
573 Ga0496111_0096602
574 Ga0496111_0236739
575 Ga0496112_0041908
576 Ga0496112_0087749
577 Ga0496113_0015754
578 Ga0496113_0197828
579 Ga0496114_0005036
580 Ga0496114_0011307
581 Ga0496114_0033602
582 Ga0496114_0037377
583 Ga0496114_0049932
584 Ga0496114_0080108
585 Ga0496114_0147357
586 Ga0501036_0014161
587 Ga0501036_0105083
588 Ga0501036_0418794
589 Ga0501038_0203426
590 Ga0501039_0011115
591 Ga0501039_0148903
592 Ga0501040_0017639
593 Ga0501041_0037302
594 Ga0501042_0052716
595 Ga0501043_0184292
596 Ga0501046_0055311
597 Ga0501046_0236309
598 Ga0501047_0102277
599 Ga0501048_0014629
600 Ga0501048_0067287
601 Ga0501071_0076829
602 Ga0501072_0036101
603 Ga0501074_0095566
604 Ga0501075_0202097
605 Ga0501077_0031466
606 Ga0501045_0079193
607 Ga0501045_0086135
608 Ga0501045_0148553
609 nmdc:mga0qj67_328160_c1
610 nmdc:mga06r32_11567_c1
611 nmdc:mga0rr50_24796_c1
612 Ga0495619_0043627
613 Ga0495619_0204307
614 Ga0501084_0013964
615 Ga0501084_0015954
616 Ga0501082_0034119
617 Ga0466962_0111063
618 Ga0530510_0020042
619 2559428288
620 2623497779
621 2643852299
622 2644136821
623 2644607763
624 2791916896
625 2808871885
626 2812373236
627 2819426035
628 2819665094
629 2819692809
630 2819727208
631 2870727822
632 2891327838
633 2919448259
634 3003004973
635 8047716306
636 8053952199

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05853

BKACE

beta-keto acid cleavage enzyme

33

301

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2y7d-assembly1.cif.gz_D crystal structure of the 3-keto-5-aminohexanoate cleavage enzyme (kce) from candidatus cloacamonas acidaminovorans (orthorombic form) 0.9535 5 273
3no5-assembly3.cif.gz_E crystal structure of a pfam duf849 domain containing protein (reut_a1631) from ralstonia eutropha jmp134 at 1.90 a resolution 0.9454 4 276
2y7d-assembly1.cif.gz_C crystal structure of the 3-keto-5-aminohexanoate cleavage enzyme (kce) from candidatus cloacamonas acidaminovorans (orthorombic form) 0.945 5 273
3fa5-assembly1.cif.gz_B crystal structure of a duf849 family protein (pden_3495) from paracoccus denitrificans pd1222 at 1.90 a resolution 0.945 5 276
3e49-assembly1.cif.gz_D crystal structure of a prokaryotic domain of unknown function (duf849) with a tim barrel fold (bxe_c0966) from burkholderia xenovorans lb400 at 1.75 a resolution 0.9442 6 276
ID Description Score Start End Superfamily
af_P71976_1_271_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9617 6 283 3.20.20.70
af_P71976_1_271_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9548 6 283 3.20.20.70
2y7dC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.945 5 273 3.20.20.70
3no5E00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9269 4 272 3.20.20.70
2y7dC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9245 5 273 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3D4WRT5-F1-model_v4 3-keto-5-aminohexanoate cleavage protein 0.9951 4 174 GO:0043720
GO:0046872
AF-A0A852Z912-F1-model_v4 Uncharacterized protein (DUF849 family) 0.9948 6 278 GO:0043720
GO:0046872
AF-A0A7Z0DQ68-F1-model_v4 Uncharacterized protein (DUF849 family) 0.9939 5 277 GO:0043720
GO:0046872
AF-A0A1H1WYP0-F1-model_v4 Uncharacterized conserved protein, DUF849 family 0.9939 5 276 GO:0043720
GO:0046872
AF-W6JXU0-F1-model_v4 3-keto-5-aminohexanoate cleavage enzyme 0.9938 6 278 GO:0043720
GO:0046872

Map