F404585

General Info

Members Datasets Scaffolds Average Seq Length
318 214 636 166

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10334540|Ga0105242_103345401
Length 195
Sequence MRFVAVPTGPYNSGGFWLSRMVSDSMKAKKTRVLVNDKMQRKYVYYRTEPAGKNFHPDFKPQLTPKQMLELGVFGGKYMTDCAKEFPDDWFDDARLCKEKHDPKLNYFGVNASQPLSVWRKKGWIWKDDPRGWFQWYCRYYMGRRCEDDERQIKRWRAIKRHITQVKKNCKRVDLTCRRRQRQALLHWAYDSRKF

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
124 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
135 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
136 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
137 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
138 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
139 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
196 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
209 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
210 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
211 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 2791355260 Rhizobium sp. L9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.35
Nodule 0.31
Rhizoplane 5.66
Rhizosphere 86.16
Stem 0
Stem Tuber 0
Unclassified 4.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10334540 3300009176 Bacteria 1393
2 JGI25405J52794_10021015 3300003911 Bacteria 1318
3 Ga0065715_10433280 3300005293 Bacteria 844
4 Ga0070658_10110394 3300005327 Bacteria 2278
5 Ga0070658_11268925 3300005327 Bacteria 640
6 Ga0070683_100006310 3300005329 Bacteria 9950
7 Ga0070670_100008612 3300005331 Bacteria 8706
8 Ga0070670_100835852 3300005331 Bacteria 833
9 Ga0068869_100003314 3300005334 Bacteria 9841
10 Ga0068869_100065433 3300005334 Unclassified 2676
11 Ga0070680_100204511 3300005336 Bacteria 1665
12 Ga0070689_100037927 3300005340 Bacteria 3686
13 Ga0070689_100382741 3300005340 Bacteria 1186
14 Ga0070661_100000914 3300005344 Bacteria 21173
15 Ga0070661_100122314 3300005344 Bacteria 1950
16 Ga0070661_100297582 3300005344 Bacteria 1255
17 Ga0070669_100002063 3300005353 Bacteria 14532
18 Ga0070671_100173117 3300005355 Bacteria 1826
19 Ga0070671_100931633 3300005355 Bacteria 759
20 Ga0070671_100947406 3300005355 Bacteria 753
21 Ga0070688_100950604 3300005365 Bacteria 680
22 Ga0070659_100135065 3300005366 Bacteria 2006
23 Ga0070667_100179811 3300005367 Bacteria 1870
24 Ga0070703_10000124 3300005406 Bacteria 39666
25 Ga0070714_101925866 3300005435 Bacteria 577
26 Ga0070705_100439209 3300005440 Bacteria 976
27 Ga0070700_100027899 3300005441 Bacteria 3353
28 Ga0070700_100445276 3300005441 Bacteria 984
29 Ga0070708_100087642 3300005445 Bacteria 2829
30 Ga0070663_101183642 3300005455 Bacteria 671
31 Ga0070662_100056682 3300005457 Bacteria 2845
32 Ga0070662_100340520 3300005457 Bacteria 1227
33 Ga0070662_100548204 3300005457 Bacteria 969
34 Ga0070681_10001775 3300005458 Bacteria 19354
35 Ga0070681_10234527 3300005458 Bacteria 1749
36 Ga0068867_100120323 3300005459 Bacteria 2028
37 Ga0070679_100001349 3300005530 Bacteria 21675
38 Ga0070679_100040603 3300005530 Bacteria 4629
39 Ga0070679_100232184 3300005530 Bacteria 1804
40 Ga0068853_100458031 3300005539 Bacteria 1200
41 Ga0070704_100055895 3300005549 Bacteria 2800
42 Ga0070704_100058724 3300005549 Bacteria 2741
43 Ga0068855_100169940 3300005563 Bacteria 2470
44 Ga0070664_100024375 3300005564 Bacteria 5003
45 Ga0070664_100151578 3300005564 Bacteria 2047
46 Ga0068857_100346181 3300005577 Bacteria 1376
47 Ga0068857_100590684 3300005577 Bacteria 1049
48 Ga0068857_100762528 3300005577 Bacteria 922
49 Ga0068854_100952656 3300005578 Bacteria 757
50 Ga0070702_100141229 3300005615 Bacteria 1534
51 Ga0068859_100035643 3300005617 Bacteria 4993
52 Ga0068859_100159577 3300005617 Bacteria 2334
53 Ga0068859_101161045 3300005617 Bacteria 850
54 Ga0068866_10735604 3300005718 Bacteria 680
55 Ga0068861_100399091 3300005719 Bacteria 1220
56 Ga0068861_100693113 3300005719 Bacteria 946
57 Ga0068863_100103707 3300005841 Bacteria 2705
58 Ga0068858_100603079 3300005842 Bacteria 1065
59 Ga0081455_10177080 3300005937 Bacteria 1618
60 Ga0081540_1000479 3300005983 Bacteria 39170
61 Ga0075365_10057542 3300006038 Bacteria 2587
62 Ga0075365_10141722 3300006038 Bacteria 1669
63 Ga0075368_10038454 3300006042 Bacteria 1873
64 Ga0075363_100016029 3300006048 Bacteria 3695
65 Ga0075364_10040051 3300006051 Bacteria 3039
66 Ga0070716_100793108 3300006173 Bacteria 733
67 Ga0070712_100238814 3300006175 Bacteria 1447
68 Ga0070712_100827451 3300006175 Bacteria 795
69 Ga0075367_10001188 3300006178 Bacteria 10935
70 Ga0075428_101905900 3300006844 Bacteria 617
71 Ga0075431_100060384 3300006847 Bacteria 3912
72 Ga0075431_101269752 3300006847 Bacteria 698
73 Ga0075433_10064263 3300006852 Bacteria 3216
74 Ga0075429_100260203 3300006880 Bacteria 1519
75 Ga0075429_100521311 3300006880 Bacteria 1041
76 Ga0097620_100035643 3300006931 Bacteria 4993
77 Ga0097620_100159585 3300006931 Bacteria 2334
78 Ga0097620_101161170 3300006931 Bacteria 850
79 Ga0075435_100019152 3300007076 Bacteria 5218
80 Ga0105240_10004609 3300009093 Bacteria 20894
81 Ga0105240_10531560 3300009093 Bacteria 1303
82 Ga0105240_11727532 3300009093 Bacteria 653
83 Ga0111539_10743742 3300009094 Bacteria 1141
84 Ga0105245_10494891 3300009098 Bacteria 1238
85 Ga0105247_10015254 3300009101 Bacteria 4605
86 Ga0105247_10378621 3300009101 Bacteria 1003
87 Ga0105247_10458345 3300009101 Bacteria 921
88 Ga0114129_10249720 3300009147 Bacteria 2382
89 Ga0114129_10274536 3300009147 Bacteria 2254
90 Ga0105243_10000131 3300009148 Bacteria 85514
91 Ga0105243_11933395 3300009148 Bacteria 623
92 Ga0105242_10000071 3300009176 Bacteria 71591
93 Ga0105242_10579945 3300009176 Bacteria 1080
94 Ga0105242_11445338 3300009176 Bacteria 716
95 Ga0105248_10113193 3300009177 Bacteria 3060
96 Ga0105237_10042718 3300009545 Bacteria 4570
97 Ga0105249_10752559 3300009553 Bacteria 1037
98 Ga0105249_11595646 3300009553 Bacteria 725
99 Ga0105239_10037405 3300010375 Bacteria 5321
100 Ga0105239_10223043 3300010375 Bacteria 2114
101 Ga0105239_10694735 3300010375 Bacteria 1163
102 Ga0157373_10025471 3300013100 Bacteria 4278
103 Ga0157371_10335379 3300013102 Bacteria 1099
104 Ga0157370_10178121 3300013104 Bacteria 1976
105 Ga0157369_12120602 3300013105 Bacteria 570
106 Ga0157378_10000017 3300013297 Bacteria 139053
107 Ga0157378_10100186 3300013297 Bacteria 2644
108 Ga0157378_10165795 3300013297 Bacteria 2069
109 Ga0157375_10001644 3300013308 Bacteria 19220
110 Ga0163163_10015878 3300014325 Bacteria 6975
111 Ga0163163_10476522 3300014325 Bacteria 1309
112 Ga0163163_10944370 3300014325 Bacteria 926
113 Ga0163163_11794150 3300014325 Bacteria 674
114 Ga0157380_10775582 3300014326 Bacteria 973
115 Ga0157379_10036310 3300014968 Bacteria 4395
116 Ga0157376_11188495 3300014969 Bacteria 790
117 Ga0163161_10491268 3300017792 Bacteria 998
118 Ga0213876_10040408 3300021384 Bacteria 2464
119 Ga0213875_10000259 3300021388 Bacteria 53341
120 Ga0207697_10002922 3300025315 Bacteria 8648
121 Ga0207653_10000240 3300025885 Bacteria 36488
122 Ga0207710_10293342 3300025900 Bacteria 820
123 Ga0207705_10245720 3300025909 Bacteria 1364
124 Ga0207707_10002809 3300025912 Bacteria 15531
125 Ga0207707_10109299 3300025912 Bacteria 2417
126 Ga0207707_10530847 3300025912 Bacteria 1001
127 Ga0207695_10169273 3300025913 Bacteria 2111
128 Ga0207695_10321993 3300025913 Bacteria 1435
129 Ga0207693_10404839 3300025915 Bacteria 1067
130 Ga0207660_10042521 3300025917 Bacteria 3190
131 Ga0207649_10000743 3300025920 Bacteria 21413
132 Ga0207649_10489532 3300025920 Bacteria 934
133 Ga0207652_10010118 3300025921 Bacteria 7598
134 Ga0207652_10251769 3300025921 Bacteria 1593
135 Ga0207681_10002672 3300025923 Bacteria 11291
136 Ga0207681_11097044 3300025923 Bacteria 668
137 Ga0207650_10000359 3300025925 Bacteria 43905
138 Ga0207650_10044067 3300025925 Bacteria 3278
139 Ga0207644_10130499 3300025931 Bacteria 1923
140 Ga0207644_10577738 3300025931 Bacteria 932
141 Ga0207644_11537463 3300025931 Bacteria 558
142 Ga0207690_10018585 3300025932 Bacteria 4265
143 Ga0207706_10318513 3300025933 Bacteria 1354
144 Ga0207686_10001646 3300025934 Bacteria 12473
145 Ga0207686_10628171 3300025934 Bacteria 848
146 Ga0207709_10000480 3300025935 Bacteria 36411
147 Ga0207670_10035747 3300025936 Bacteria 3224
148 Ga0207670_10529069 3300025936 Bacteria 961
149 Ga0207704_10092120 3300025938 Bacteria 1994
150 Ga0207711_11160854 3300025941 Unclassified 713
151 Ga0207689_10002761 3300025942 Bacteria 16240
152 Ga0207689_10006419 3300025942 Bacteria 10396
153 Ga0207661_10063333 3300025944 Bacteria 2995
154 Ga0207679_10347674 3300025945 Bacteria 1291
155 Ga0207667_10453652 3300025949 Bacteria 1303
156 Ga0207651_11200056 3300025960 Bacteria 681
157 Ga0207640_10775054 3300025981 Bacteria 829
158 Ga0207658_10120201 3300025986 Bacteria 2093
159 Ga0207658_10171420 3300025986 Bacteria 1788
160 Ga0207658_10851584 3300025986 Bacteria 829
161 Ga0207703_11288382 3300026035 Bacteria 703
162 Ga0207639_10389879 3300026041 Bacteria 1253
163 Ga0207708_10044579 3300026075 Bacteria 3380
164 Ga0207648_10147519 3300026089 Bacteria 2075
165 Ga0207648_10161229 3300026089 Bacteria 1981
166 Ga0207674_10172306 3300026116 Bacteria 2117
167 Ga0209813_10012897 3300027866 Bacteria 2220
168 Ga0207428_10677153 3300027907 Bacteria 739
169 Ga0268264_11697041 3300028381 Bacteria 642
170 Ga0265338_10135001 3300028800 Bacteria 1941
171 Ga0316579_10049906 3300031691 Bacteria 1956
172 Ga0307410_11514988 3300031852 Bacteria 591
173 Ga0307406_10750853 3300031901 Unclassified 819
174 Ga0307407_10497868 3300031903 Bacteria 893
175 Ga0307409_100303375 3300031995 Bacteria 1487
176 Ga0307416_101373109 3300032002 Bacteria 812
177 Ga0307415_100244912 3300032126 Bacteria 1453
178 Ga0373945_0267458 3300035116 Bacteria 726
179 Ga0373954_0401720 3300035118 Bacteria 678
180 Ga0373943_0438933 3300035170 Bacteria 757
181 Ga0373955_0527849 3300035172 Bacteria 721
182 Ga0316574_0314945 3300035398 Bacteria 994
183 Ga0373924_0198896 3300035410 Unclassified 884
184 Ga0373927_0037926 3300035695 Bacteria 3131
185 Ga0373927_0109350 3300035695 Bacteria 1801
186 Ga0373937_0333511 3300036401 Bacteria 1436
187 Ga0373937_0441028 3300036401 Bacteria 1236
188 Ga0316582_0206744 3300036647 Bacteria 1340
189 Ga0373925_0774662 3300037068 Bacteria 791
190 Ga0373925_1501943 3300037068 Bacteria 551
191 Ga0395900_0154934 3300037418 Bacteria 2340
192 Ga0395898_0169157 3300037466 Bacteria 2089
193 Ga0395901_0429591 3300038443 Bacteria 1353
194 Ga0400489_00447 3300039093 Bacteria 3865
195 Ga0436365_0200284 3300039437 Bacteria 1257
196 Ga0436365_0200333 3300039437 Bacteria 719
197 Ga0436365_1087662 3300039437 Bacteria 20046
198 Ga0436365_1107127 3300039437 Bacteria 2300
199 Ga0436362_0831410 3300039453 Bacteria 583
200 Ga0451798_0023562 3300041458 Unclassified 1355
201 Ga0451807_0734183 3300041486 Bacteria 636
202 Ga0451849_1107444 3300041505 Bacteria 564
203 Ga0439433_0169644 3300041999 Bacteria 568
204 Ga0450894_036174 3300042131 Unclassified 700
205 Ga0451577_0743657 3300042876 Bacteria 887
206 Ga0453684_0001856 3300044712 Bacteria 55167
207 Ga0453684_0011242 3300044712 Bacteria 15068
208 Ga0453684_0011531 3300044712 Bacteria 14789
209 Ga0453684_0059442 3300044712 Bacteria 4927
210 Ga0453684_0326057 3300044712 Bacteria 1738
211 Ga0466957_0056109 3300044842 Bacteria 2408
212 Ga0451576_0045419 3300045051 Bacteria 4627
213 Ga0466958_0234629 3300045836 Bacteria 1172
214 Ga0495639_0156956 3300046475 Bacteria 1100
215 Ga0495639_0350616 3300046475 Bacteria 741
216 Ga0495639_0443020 3300046475 Bacteria 659
217 Ga0495662_0102710 3300046476 Unclassified 1399
218 Ga0495630_0148680 3300046517 Bacteria 1782
219 Ga0495630_0618558 3300046517 Unclassified 830
220 Ga0495630_0830848 3300046517 Bacteria 705
221 Ga0495652_0560202 3300046529 Bacteria 785
222 Ga0495621_0009081 3300046539 Unclassified 3005
223 Ga0495621_0038551 3300046539 Bacteria 1667
224 Ga0495645_0532771 3300046543 Bacteria 730
225 Ga0495622_0078914 3300046557 Unclassified 1515
226 Ga0495668_0198886 3300046616 Bacteria 1097
227 Ga0495634_0410086 3300046642 Unclassified 804
228 Ga0495635_0047923 3300046663 Unclassified 2946
229 Ga0495661_0170856 3300046665 Bacteria 1160
230 Ga0495613_0137154 3300046689 Bacteria 1750
231 Ga0495600_0374501 3300046809 Unclassified 889
232 Ga0495581_0254747 3300047315 Bacteria 1026
233 Ga0495581_0327682 3300047315 Bacteria 894
234 Ga0495636_0348407 3300047318 Bacteria 699
235 Ga0495614_0570128 3300048089 Bacteria 542
236 Ga0496100_0338539 3300048903 Bacteria 1134
237 Ga0496101_0121031 3300048904 Bacteria 1979
238 Ga0496101_0382013 3300048904 Bacteria 1108
239 Ga0496102_0149674 3300048905 Bacteria 2192
240 Ga0496104_0002486 3300048907 Bacteria 15864
241 Ga0496104_0014301 3300048907 Bacteria 7166
242 Ga0496105_0007650 3300048908 Bacteria 8374
243 Ga0496105_0039653 3300048908 Bacteria 3883
244 Ga0496106_0004834 3300048909 Bacteria 9969
245 Ga0496108_0035523 3300048911 Bacteria 4144
246 Ga0496109_0500423 3300048912 Unclassified 1147
247 Ga0496110_0078462 3300048913 Bacteria 2940
248 Ga0496112_0985946 3300048915 Bacteria 763
249 Ga0496114_0064272 3300048917 Bacteria 3073
250 Ga0496115_0389368 3300048918 Bacteria 1132
251 Ga0496115_0999157 3300048918 Bacteria 639
252 Ga0501032_0094722 3300049569 Bacteria 1979
253 Ga0501033_0073655 3300049570 Bacteria 2507
254 Ga0501034_0026873 3300049571 Bacteria 5856
255 Ga0501034_0273306 3300049571 Bacteria 1630
256 Ga0501037_0206497 3300049573 Bacteria 1386
257 Ga0501037_0241644 3300049573 Bacteria 1265
258 Ga0501038_0495183 3300049574 Bacteria 935
259 Ga0501039_0102953 3300049575 Bacteria 2228
260 Ga0501039_0337255 3300049575 Unclassified 1185
261 Ga0501039_0809561 3300049575 Bacteria 731
262 Ga0501040_0027622 3300049576 Bacteria 3822
263 Ga0501046_0024815 3300049580 Bacteria 4913
264 Ga0501046_0029953 3300049580 Bacteria 4422
265 Ga0501046_0082482 3300049580 Bacteria 2483
266 Ga0501047_0046884 3300049581 Bacteria 4175
267 Ga0501047_0055301 3300049581 Bacteria 3838
268 Ga0501048_0083786 3300049582 Bacteria 2248
269 Ga0501048_0284803 3300049582 Bacteria 1175
270 Ga0501067_0056183 3300049583 Bacteria 2181
271 Ga0501068_0092875 3300049584 Bacteria 1863
272 Ga0501068_0314606 3300049584 Bacteria 1003
273 Ga0501069_0249814 3300049585 Bacteria 1034
274 Ga0501070_0235455 3300049586 Bacteria 1500
275 Ga0501070_0313967 3300049586 Bacteria 1275
276 Ga0501070_0452907 3300049586 Bacteria 1034
277 Ga0501073_0026814 3300049589 Bacteria 4125
278 Ga0501074_0547113 3300049590 Bacteria 819
279 Ga0501079_0202402 3300049741 Bacteria 1551
280 Ga0501079_1113185 3300049741 Bacteria 622
281 Ga0501080_0321441 3300049742 Bacteria 1401
282 Ga0501080_0667644 3300049742 Bacteria 919
283 Ga0501080_1079838 3300049742 Bacteria 693
284 Ga0501083_0102723 3300049744 Bacteria 1884
285 Ga0501083_0373513 3300049744 Bacteria 927
286 Ga0501035_0035072 3300049822 Bacteria 4555
287 Ga0501044_0337319 3300049823 Bacteria 1429
288 Ga0501044_0354580 3300049823 Bacteria 1386
289 Ga0501044_0820126 3300049823 Bacteria 808
290 Ga0501045_0602664 3300049824 Bacteria 813
291 nmdc:mga00v17_5710_c1 3300050491 Bacteria 6575
292 nmdc:mga0yw44_112066_c1 3300050492 Bacteria 1749
293 nmdc:mga0yw44_587827_c1 3300050492 Bacteria 756
294 nmdc:mga06z11_13088_c1 3300050494 Bacteria 3631
295 nmdc:mga06z11_23101_c1 3300050494 Bacteria 2916
296 nmdc:mga04h51_19804_c1 3300050495 Bacteria 2000
297 nmdc:mga05p37_13883_c1 3300050507 Bacteria 9654
298 nmdc:mga05p37_57223_c1 3300050507 Bacteria 4802
299 nmdc:mga09592_1271869_c1 3300050508 Bacteria 606
300 nmdc:mga09592_86712_c1 3300050508 Bacteria 2672
301 nmdc:mga0qj67_1446577_c1 3300050509 Bacteria 530
302 nmdc:mga0qj67_87676_c1 3300050509 Bacteria 2498
303 nmdc:mga06r32_56335_c1 3300050510 Bacteria 3773
304 nmdc:mga06r32_809402_c1 3300050510 Bacteria 897
305 nmdc:mga0n895_55773_c1 3300050512 Bacteria 3890
306 nmdc:mga0rr50_95839_c1 3300050513 Bacteria 2320
307 nmdc:mga0a205_5768_c1 3300050515 Bacteria 11163
308 Ga0495595_0008971 3300053084 Bacteria 4124
309 Ga0495619_0042272 3300053085 Bacteria 2984
310 Ga0495619_0292578 3300053085 Bacteria 1128
311 Ga0500641_0274981 3300053096 Bacteria 700
312 Ga0500559_0034372 3300053136 Bacteria 2186
313 Ga0500616_0192431 3300053153 Bacteria 910
314 Ga0500636_0004764 3300053177 Bacteria 7694
315 Ga0501084_0000156 3300054114 Bacteria 52508
316 Ga0501084_0177206 3300054114 Bacteria 1799
317 Ga0501082_0260990 3300060353 Bacteria 1507
318 2793324824 2791355260 Bacteria 6598818
319 Ga0105242_10334540
320 JGI25405J52794_10021015
321 Ga0065715_10433280
322 Ga0070658_10110394
323 Ga0070658_11268925
324 Ga0070683_100006310
325 Ga0070670_100008612
326 Ga0070670_100835852
327 Ga0068869_100003314
328 Ga0068869_100065433
329 Ga0070680_100204511
330 Ga0070689_100037927
331 Ga0070689_100382741
332 Ga0070661_100000914
333 Ga0070661_100122314
334 Ga0070661_100297582
335 Ga0070669_100002063
336 Ga0070671_100173117
337 Ga0070671_100931633
338 Ga0070671_100947406
339 Ga0070688_100950604
340 Ga0070659_100135065
341 Ga0070667_100179811
342 Ga0070703_10000124
343 Ga0070714_101925866
344 Ga0070705_100439209
345 Ga0070700_100027899
346 Ga0070700_100445276
347 Ga0070708_100087642
348 Ga0070663_101183642
349 Ga0070662_100056682
350 Ga0070662_100340520
351 Ga0070662_100548204
352 Ga0070681_10001775
353 Ga0070681_10234527
354 Ga0068867_100120323
355 Ga0070679_100001349
356 Ga0070679_100040603
357 Ga0070679_100232184
358 Ga0068853_100458031
359 Ga0070704_100055895
360 Ga0070704_100058724
361 Ga0068855_100169940
362 Ga0070664_100024375
363 Ga0070664_100151578
364 Ga0068857_100346181
365 Ga0068857_100590684
366 Ga0068857_100762528
367 Ga0068854_100952656
368 Ga0070702_100141229
369 Ga0068859_100035643
370 Ga0068859_100159577
371 Ga0068859_101161045
372 Ga0068866_10735604
373 Ga0068861_100399091
374 Ga0068861_100693113
375 Ga0068863_100103707
376 Ga0068858_100603079
377 Ga0081455_10177080
378 Ga0081540_1000479
379 Ga0075365_10057542
380 Ga0075365_10141722
381 Ga0075368_10038454
382 Ga0075363_100016029
383 Ga0075364_10040051
384 Ga0070716_100793108
385 Ga0070712_100238814
386 Ga0070712_100827451
387 Ga0075367_10001188
388 Ga0075428_101905900
389 Ga0075431_100060384
390 Ga0075431_101269752
391 Ga0075433_10064263
392 Ga0075429_100260203
393 Ga0075429_100521311
394 Ga0097620_100035643
395 Ga0097620_100159585
396 Ga0097620_101161170
397 Ga0075435_100019152
398 Ga0105240_10004609
399 Ga0105240_10531560
400 Ga0105240_11727532
401 Ga0111539_10743742
402 Ga0105245_10494891
403 Ga0105247_10015254
404 Ga0105247_10378621
405 Ga0105247_10458345
406 Ga0114129_10249720
407 Ga0114129_10274536
408 Ga0105243_10000131
409 Ga0105243_11933395
410 Ga0105242_10000071
411 Ga0105242_10579945
412 Ga0105242_11445338
413 Ga0105248_10113193
414 Ga0105237_10042718
415 Ga0105249_10752559
416 Ga0105249_11595646
417 Ga0105239_10037405
418 Ga0105239_10223043
419 Ga0105239_10694735
420 Ga0157373_10025471
421 Ga0157371_10335379
422 Ga0157370_10178121
423 Ga0157369_12120602
424 Ga0157378_10000017
425 Ga0157378_10100186
426 Ga0157378_10165795
427 Ga0157375_10001644
428 Ga0163163_10015878
429 Ga0163163_10476522
430 Ga0163163_10944370
431 Ga0163163_11794150
432 Ga0157380_10775582
433 Ga0157379_10036310
434 Ga0157376_11188495
435 Ga0163161_10491268
436 Ga0213876_10040408
437 Ga0213875_10000259
438 Ga0207697_10002922
439 Ga0207653_10000240
440 Ga0207710_10293342
441 Ga0207705_10245720
442 Ga0207707_10002809
443 Ga0207707_10109299
444 Ga0207707_10530847
445 Ga0207695_10169273
446 Ga0207695_10321993
447 Ga0207693_10404839
448 Ga0207660_10042521
449 Ga0207649_10000743
450 Ga0207649_10489532
451 Ga0207652_10010118
452 Ga0207652_10251769
453 Ga0207681_10002672
454 Ga0207681_11097044
455 Ga0207650_10000359
456 Ga0207650_10044067
457 Ga0207644_10130499
458 Ga0207644_10577738
459 Ga0207644_11537463
460 Ga0207690_10018585
461 Ga0207706_10318513
462 Ga0207686_10001646
463 Ga0207686_10628171
464 Ga0207709_10000480
465 Ga0207670_10035747
466 Ga0207670_10529069
467 Ga0207704_10092120
468 Ga0207711_11160854
469 Ga0207689_10002761
470 Ga0207689_10006419
471 Ga0207661_10063333
472 Ga0207679_10347674
473 Ga0207667_10453652
474 Ga0207651_11200056
475 Ga0207640_10775054
476 Ga0207658_10120201
477 Ga0207658_10171420
478 Ga0207658_10851584
479 Ga0207703_11288382
480 Ga0207639_10389879
481 Ga0207708_10044579
482 Ga0207648_10147519
483 Ga0207648_10161229
484 Ga0207674_10172306
485 Ga0209813_10012897
486 Ga0207428_10677153
487 Ga0268264_11697041
488 Ga0265338_10135001
489 Ga0316579_10049906
490 Ga0307410_11514988
491 Ga0307406_10750853
492 Ga0307407_10497868
493 Ga0307409_100303375
494 Ga0307416_101373109
495 Ga0307415_100244912
496 Ga0373945_0267458
497 Ga0373954_0401720
498 Ga0373943_0438933
499 Ga0373955_0527849
500 Ga0316574_0314945
501 Ga0373924_0198896
502 Ga0373927_0037926
503 Ga0373927_0109350
504 Ga0373937_0333511
505 Ga0373937_0441028
506 Ga0316582_0206744
507 Ga0373925_0774662
508 Ga0373925_1501943
509 Ga0395900_0154934
510 Ga0395898_0169157
511 Ga0395901_0429591
512 Ga0400489_00447
513 Ga0436365_0200284
514 Ga0436365_0200333
515 Ga0436365_1087662
516 Ga0436365_1107127
517 Ga0436362_0831410
518 Ga0451798_0023562
519 Ga0451807_0734183
520 Ga0451849_1107444
521 Ga0439433_0169644
522 Ga0450894_036174
523 Ga0451577_0743657
524 Ga0453684_0001856
525 Ga0453684_0011242
526 Ga0453684_0011531
527 Ga0453684_0059442
528 Ga0453684_0326057
529 Ga0466957_0056109
530 Ga0451576_0045419
531 Ga0466958_0234629
532 Ga0495639_0156956
533 Ga0495639_0350616
534 Ga0495639_0443020
535 Ga0495662_0102710
536 Ga0495630_0148680
537 Ga0495630_0618558
538 Ga0495630_0830848
539 Ga0495652_0560202
540 Ga0495621_0009081
541 Ga0495621_0038551
542 Ga0495645_0532771
543 Ga0495622_0078914
544 Ga0495668_0198886
545 Ga0495634_0410086
546 Ga0495635_0047923
547 Ga0495661_0170856
548 Ga0495613_0137154
549 Ga0495600_0374501
550 Ga0495581_0254747
551 Ga0495581_0327682
552 Ga0495636_0348407
553 Ga0495614_0570128
554 Ga0496100_0338539
555 Ga0496101_0121031
556 Ga0496101_0382013
557 Ga0496102_0149674
558 Ga0496104_0002486
559 Ga0496104_0014301
560 Ga0496105_0007650
561 Ga0496105_0039653
562 Ga0496106_0004834
563 Ga0496108_0035523
564 Ga0496109_0500423
565 Ga0496110_0078462
566 Ga0496112_0985946
567 Ga0496114_0064272
568 Ga0496115_0389368
569 Ga0496115_0999157
570 Ga0501032_0094722
571 Ga0501033_0073655
572 Ga0501034_0026873
573 Ga0501034_0273306
574 Ga0501037_0206497
575 Ga0501037_0241644
576 Ga0501038_0495183
577 Ga0501039_0102953
578 Ga0501039_0337255
579 Ga0501039_0809561
580 Ga0501040_0027622
581 Ga0501046_0024815
582 Ga0501046_0029953
583 Ga0501046_0082482
584 Ga0501047_0046884
585 Ga0501047_0055301
586 Ga0501048_0083786
587 Ga0501048_0284803
588 Ga0501067_0056183
589 Ga0501068_0092875
590 Ga0501068_0314606
591 Ga0501069_0249814
592 Ga0501070_0235455
593 Ga0501070_0313967
594 Ga0501070_0452907
595 Ga0501073_0026814
596 Ga0501074_0547113
597 Ga0501079_0202402
598 Ga0501079_1113185
599 Ga0501080_0321441
600 Ga0501080_0667644
601 Ga0501080_1079838
602 Ga0501083_0102723
603 Ga0501083_0373513
604 Ga0501035_0035072
605 Ga0501044_0337319
606 Ga0501044_0354580
607 Ga0501044_0820126
608 Ga0501045_0602664
609 nmdc:mga00v17_5710_c1
610 nmdc:mga0yw44_112066_c1
611 nmdc:mga0yw44_587827_c1
612 nmdc:mga06z11_13088_c1
613 nmdc:mga06z11_23101_c1
614 nmdc:mga04h51_19804_c1
615 nmdc:mga05p37_13883_c1
616 nmdc:mga05p37_57223_c1
617 nmdc:mga09592_1271869_c1
618 nmdc:mga09592_86712_c1
619 nmdc:mga0qj67_1446577_c1
620 nmdc:mga0qj67_87676_c1
621 nmdc:mga06r32_56335_c1
622 nmdc:mga06r32_809402_c1
623 nmdc:mga0n895_55773_c1
624 nmdc:mga0rr50_95839_c1
625 nmdc:mga0a205_5768_c1
626 Ga0495595_0008971
627 Ga0495619_0042272
628 Ga0495619_0292578
629 Ga0500641_0274981
630 Ga0500559_0034372
631 Ga0500616_0192431
632 Ga0500636_0004764
633 Ga0501084_0000156
634 Ga0501084_0177206
635 Ga0501082_0260990
636 2793324824

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tku-assembly1.cif.gz_A structure of the yeast clamp loader (replication factor c rfc) bound to the open sliding clamp (proliferating cell nuclear antigen pcna) 0.2838 32 169
5jdk-assembly1.cif.gz_A crystal structure of the dna binding domain of sap1 in fission yeast s.pombe 0.2677 38 162
5jdk-assembly1.cif.gz_A crystal structure of the dna binding domain of sap1 in fission yeast s.pombe 0.2305 38 162
1o7l-assembly2.cif.gz_C molybdate-activated form of mode from escherichia coli 0.2278 1 155
7tku-assembly1.cif.gz_A structure of the yeast clamp loader (replication factor c rfc) bound to the open sliding clamp (proliferating cell nuclear antigen pcna) 0.2176 32 169
ID Description Score Start End Superfamily
af_G5EGC9_77_173_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.2413 26 95 1.10.10.10
af_H2KZ39_61_158_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.1808 28 62 1.10.10.10
af_G5EGC9_77_173_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.1665 26 95 1.10.10.10
af_A4HSS0_32_246_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.1419 3 150 3.30.420.10
af_A4HSS0_32_246_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.1302 3 150 3.30.420.10
ID Description Score Start End GO Terms
AF-Q89SC6-F1-model_v4 Blr2476 protein 0.9271 1 169
AF-A0A2H0PGP7-F1-model_v4 GIY-YIG domain-containing protein 0.9269 2 169
AF-A3WZQ2-F1-model_v4 Uncharacterized protein 0.9264 4 169
AF-A0A0G0I225-F1-model_v4 Uncharacterized protein 0.925 4 169
AF-R6IUN0-F1-model_v4 deleted 0.9228 5 166

Map