F404533

General Info

Members Datasets Scaffolds Average Seq Length
318 208 636 220

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10255511|Ga0081455_102555111
Length 245
Sequence VIELAHVSKWYGPVQVLDDCSMSIAKGEVVVICGPSGSGKSTLVAGVRSLVAGLEFSVSYTTRAPRGSEVDGEAYHFTTRENFEAMIARDEFLEWADVFGNYYGTARSALDQARQHNNDLLLDIDVQGAMQVMQKMPDAISIFILPPSPQVLEMRLRNRSLAENMSDETVIQRRLTEARNELQFLEKYKYAVVNDVLDQAVTELKAVVMTERGEEGRYLRELAQSCRTSAMSERLTHSLHSFVRE

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
126 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
129 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
135 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
143 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
207 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
208 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 1.57
Rhizosphere 97.8
Stem 0
Stem Tuber 0
Unclassified 14.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10255511 3300005937 Bacteria 1279
2 JGI24748J21848_1000003 3300002074 Bacteria 323921
3 JGI24034J26672_10000005 3300002239 Bacteria 404185
4 Ga0065707_10119832 3300005295 Unclassified 2149
5 Ga0070658_10013359 3300005327 Bacteria 6589
6 Ga0070658_10036457 3300005327 Bacteria 3964
7 Ga0070658_10278523 3300005327 Bacteria 1423
8 Ga0070676_10071407 3300005328 Unclassified 2085
9 Ga0070683_100393010 3300005329 Unclassified 1322
10 Ga0070683_100444814 3300005329 Bacteria 1236
11 Ga0070683_100611568 3300005329 Viruses 1043
12 Ga0070690_100047601 3300005330 Bacteria 2729
13 Ga0068869_100027416 3300005334 Bacteria 3972
14 Ga0068868_100037912 3300005338 Bacteria 3739
15 Ga0068868_100129889 3300005338 Bacteria 2061
16 Ga0070660_100130779 3300005339 Bacteria 2009
17 Ga0070689_100038393 3300005340 Bacteria 3664
18 Ga0070691_10287211 3300005341 Bacteria 894
19 Ga0070687_100114467 3300005343 Bacteria 1532
20 Ga0070669_100643715 3300005353 Unclassified 891
21 Ga0070671_100054366 3300005355 Unclassified 3329
22 Ga0070671_100157467 3300005355 Bacteria 1919
23 Ga0070673_100005656 3300005364 Bacteria 8031
24 Ga0070673_100040857 3300005364 Bacteria 3561
25 Ga0070703_10000091 3300005406 Bacteria 45812
26 Ga0070709_10266939 3300005434 Bacteria 1239
27 Ga0070714_100362627 3300005435 Bacteria 1363
28 Ga0070710_10058403 3300005437 Bacteria 2188
29 Ga0070711_100143189 3300005439 Bacteria 1795
30 Ga0070705_100086089 3300005440 Unclassified 1944
31 Ga0070694_100009596 3300005444 Bacteria 5937
32 Ga0070694_100014511 3300005444 Bacteria 4933
33 Ga0070663_100978002 3300005455 Bacteria 735
34 Ga0070681_10371485 3300005458 Bacteria 1340
35 Ga0068867_100679453 3300005459 Bacteria 906
36 Ga0070706_100009136 3300005467 Bacteria 9229
37 Ga0070706_100285783 3300005467 Unclassified 1539
38 Ga0070707_100000435 3300005468 Bacteria 41411
39 Ga0070707_100037180 3300005468 Bacteria 4646
40 Ga0070707_100074881 3300005468 Bacteria 3265
41 Ga0070707_100081147 3300005468 Bacteria 3131
42 Ga0070698_100000312 3300005471 Bacteria 49298
43 Ga0070698_100221441 3300005471 Bacteria 1826
44 Ga0070698_100532288 3300005471 Unclassified 1114
45 Ga0070699_100003472 3300005518 Bacteria 13934
46 Ga0070699_100257642 3300005518 Unclassified 1560
47 Ga0070679_100571407 3300005530 Bacteria 1074
48 Ga0070697_100033242 3300005536 Bacteria 4153
49 Ga0070697_100044547 3300005536 Bacteria 3594
50 Ga0070697_100102173 3300005536 Bacteria 2382
51 Ga0070697_100374311 3300005536 Unclassified 1233
52 Ga0070695_100133742 3300005545 Bacteria 1712
53 Ga0070695_100203290 3300005545 Bacteria 1417
54 Ga0070695_100347778 3300005545 Bacteria 1110
55 Ga0070696_100476539 3300005546 Unclassified 989
56 Ga0070665_100088459 3300005548 Unclassified 3103
57 Ga0070665_100167521 3300005548 Bacteria 2199
58 Ga0070704_100152564 3300005549 Bacteria 1818
59 Ga0068855_100006256 3300005563 Bacteria 14518
60 Ga0068855_100015159 3300005563 Bacteria 9283
61 Ga0068855_100028673 3300005563 Bacteria 6661
62 Ga0068855_100052136 3300005563 Bacteria 4817
63 Ga0068855_100184118 3300005563 Bacteria 2360
64 Ga0068855_100443617 3300005563 Unclassified 1417
65 Ga0068857_100091766 3300005577 Bacteria 2719
66 Ga0068854_100359585 3300005578 Bacteria 1194
67 Ga0068856_100051629 3300005614 Bacteria 4054
68 Ga0068856_100299432 3300005614 Bacteria 1626
69 Ga0068856_100950215 3300005614 Bacteria 878
70 Ga0070702_100186891 3300005615 Unclassified 1360
71 Ga0068852_100573934 3300005616 Unclassified 1130
72 Ga0068852_100589728 3300005616 Bacteria 1115
73 Ga0068859_100006573 3300005617 Bacteria 11798
74 Ga0068864_100111190 3300005618 Bacteria 2440
75 Ga0068866_10011288 3300005718 Bacteria 3860
76 Ga0068861_100079049 3300005719 Bacteria 2570
77 Ga0068861_100282932 3300005719 Bacteria 1429
78 Ga0068863_100245210 3300005841 Bacteria 1730
79 Ga0068858_100000311 3300005842 Bacteria 51906
80 Ga0068858_100141204 3300005842 Bacteria 2261
81 Ga0068858_100163390 3300005842 Bacteria 2097
82 Ga0068860_100081011 3300005843 Bacteria 3087
83 Ga0068860_100099588 3300005843 Unclassified 2772
84 Ga0068860_100106361 3300005843 Bacteria 2680
85 Ga0068860_100479410 3300005843 Bacteria 1240
86 Ga0068862_100077077 3300005844 Unclassified 2886
87 Ga0081540_1002998 3300005983 Bacteria 13532
88 Ga0070716_100357372 3300006173 Bacteria 1036
89 Ga0068871_100219153 3300006358 Bacteria 1648
90 Ga0075428_100032741 3300006844 Bacteria 5741
91 Ga0075433_10025719 3300006852 Bacteria 4978
92 Ga0075433_10149590 3300006852 Bacteria 2077
93 Ga0075433_10244510 3300006852 Unclassified 1593
94 Ga0075433_10543896 3300006852 Bacteria 1021
95 Ga0075434_100086377 3300006871 Bacteria 3137
96 Ga0075434_100129537 3300006871 Bacteria 2541
97 Ga0075429_100028211 3300006880 Bacteria 4874
98 Ga0075436_100000011 3300006914 Bacteria 208094
99 Ga0097620_100006573 3300006931 Bacteria 11798
100 Ga0075435_100046123 3300007076 Bacteria 3495
101 Ga0105240_10000311 3300009093 Bacteria 93752
102 Ga0105240_10180798 3300009093 Bacteria 2489
103 Ga0105240_10236105 3300009093 Bacteria 2122
104 Ga0105240_10795479 3300009093 Bacteria 1025
105 Ga0111539_10016807 3300009094 Bacteria 9063
106 Ga0105245_10552836 3300009098 Bacteria 1173
107 Ga0105247_10000022 3300009101 Bacteria 219796
108 Ga0114129_10014339 3300009147 Bacteria 11296
109 Ga0105243_10000357 3300009148 Bacteria 48866
110 Ga0105243_10000920 3300009148 Bacteria 27587
111 Ga0105243_10509485 3300009148 Viruses 1142
112 Ga0105241_10489087 3300009174 Bacteria 1095
113 Ga0105242_10000916 3300009176 Bacteria 22943
114 Ga0105242_10006463 3300009176 Bacteria 9028
115 Ga0105248_10081515 3300009177 Unclassified 3637
116 Ga0105248_10136864 3300009177 Bacteria 2763
117 Ga0105248_10317003 3300009177 Unclassified 1756
118 Ga0105248_10459979 3300009177 Bacteria 1434
119 Ga0105238_10030285 3300009551 Bacteria 5509
120 Ga0105238_10489591 3300009551 Unclassified 1230
121 Ga0105249_10013474 3300009553 Bacteria 7219
122 Ga0105249_10048194 3300009553 Bacteria 3885
123 Ga0105239_10023320 3300010375 Bacteria 6816
124 Ga0157371_10099890 3300013102 Bacteria 2058
125 Ga0157370_10095641 3300013104 Bacteria 2787
126 Ga0157370_10167741 3300013104 Bacteria 2041
127 Ga0157370_10535643 3300013104 Bacteria 1074
128 Ga0157369_10032199 3300013105 Bacteria 5768
129 Ga0157369_10237455 3300013105 Bacteria 1904
130 Ga0157369_10702687 3300013105 Bacteria 1041
131 Ga0157369_10958620 3300013105 Unclassified 876
132 Ga0157374_10818763 3300013296 Bacteria 947
133 Ga0157378_10000051 3300013297 Bacteria 102008
134 Ga0157378_10018763 3300013297 Bacteria 6080
135 Ga0157378_10045305 3300013297 Bacteria 3907
136 Ga0157378_10344971 3300013297 Bacteria 1453
137 Ga0163162_10029185 3300013306 Bacteria 5458
138 Ga0163162_10042087 3300013306 Bacteria 4570
139 Ga0163162_10084380 3300013306 Bacteria 3252
140 Ga0157372_10146959 3300013307 Bacteria 2718
141 Ga0157372_10704332 3300013307 Unclassified 1175
142 Ga0157375_10011570 3300013308 Bacteria 7794
143 Ga0157380_10002035 3300014326 Bacteria 13517
144 Ga0157380_10150236 3300014326 Bacteria 2013
145 Ga0157377_10613844 3300014745 Unclassified 778
146 Ga0157379_10051663 3300014968 Bacteria 3671
147 Ga0157376_10543003 3300014969 Bacteria 1149
148 Ga0207672_1000527 3300025223 Bacteria 4738
149 Ga0207653_10000034 3300025885 Bacteria 103130
150 Ga0207710_10000001 3300025900 Bacteria 1797433
151 Ga0207647_10194412 3300025904 Unclassified 1175
152 Ga0207699_10335526 3300025906 Bacteria 1064
153 Ga0207645_10225332 3300025907 Bacteria 1236
154 Ga0207705_10000063 3300025909 Bacteria 145090
155 Ga0207705_10006300 3300025909 Bacteria 8806
156 Ga0207705_10044281 3300025909 Bacteria 3198
157 Ga0207705_10045466 3300025909 Bacteria 3155
158 Ga0207705_10181437 3300025909 Bacteria 1589
159 Ga0207684_10005477 3300025910 Bacteria 11690
160 Ga0207684_10030480 3300025910 Bacteria 4591
161 Ga0207707_10262700 3300025912 Bacteria 1498
162 Ga0207695_10000600 3300025913 Bacteria 72224
163 Ga0207695_10229280 3300025913 Bacteria 1762
164 Ga0207695_10432444 3300025913 Bacteria 1200
165 Ga0207663_10192263 3300025916 Bacteria 1466
166 Ga0207662_10028023 3300025918 Bacteria 3254
167 Ga0207662_10122529 3300025918 Bacteria 1632
168 Ga0207657_10045062 3300025919 Bacteria 3874
169 Ga0207657_10367554 3300025919 Unclassified 1133
170 Ga0207646_10015934 3300025922 Bacteria 7069
171 Ga0207646_10018206 3300025922 Bacteria 6556
172 Ga0207681_10468946 3300025923 Unclassified 1027
173 Ga0207694_10007947 3300025924 Bacteria 8024
174 Ga0207700_10306934 3300025928 Bacteria 1371
175 Ga0207690_10210818 3300025932 Bacteria 1481
176 Ga0207686_10000170 3300025934 Bacteria 49724
177 Ga0207686_10001061 3300025934 Bacteria 16235
178 Ga0207709_10001213 3300025935 Bacteria 18538
179 Ga0207709_10079409 3300025935 Bacteria 2110
180 Ga0207709_10501198 3300025935 Bacteria 947
181 Ga0207670_10641923 3300025936 Unclassified 875
182 Ga0207704_10081216 3300025938 Bacteria 2096
183 Ga0207689_10038076 3300025942 Bacteria 3984
184 Ga0207661_10699415 3300025944 Bacteria 932
185 Ga0207661_10893964 3300025944 Unclassified 818
186 Ga0207667_10002295 3300025949 Bacteria 24024
187 Ga0207667_10011625 3300025949 Bacteria 10220
188 Ga0207667_10403014 3300025949 Unclassified 1393
189 Ga0207651_10063050 3300025960 Bacteria 2586
190 Ga0207712_10265398 3300025961 Unclassified 1394
191 Ga0207677_10283569 3300026023 Bacteria 1361
192 Ga0207703_10000024 3300026035 Bacteria 217968
193 Ga0207703_10081712 3300026035 Bacteria 2694
194 Ga0207703_10234171 3300026035 Bacteria 1648
195 Ga0207703_10235708 3300026035 Bacteria 1643
196 Ga0207703_10429421 3300026035 Bacteria 1231
197 Ga0207678_10141927 3300026067 Bacteria 2050
198 Ga0207702_10131064 3300026078 Bacteria 2256
199 Ga0207702_10581768 3300026078 Bacteria 1097
200 Ga0207702_10856664 3300026078 Bacteria 900
201 Ga0207648_10335675 3300026089 Bacteria 1360
202 Ga0207676_10139198 3300026095 Unclassified 2075
203 Ga0207675_100008290 3300026118 Bacteria 9789
204 Ga0207698_10021812 3300026142 Bacteria 4437
205 Ga0207698_10220438 3300026142 Bacteria 1714
206 Ga0209588_1071073 3300027671 Bacteria 1124
207 Ga0207428_10007576 3300027907 Bacteria 9895
208 Ga0268265_10201699 3300028380 Bacteria 1726
209 Ga0268264_10139782 3300028381 Unclassified 2158
210 Ga0265318_10000133 3300028577 Bacteria 68589
211 Ga0265336_10016428 3300028666 Bacteria 2420
212 Ga0265338_10002653 3300028800 Bacteria 26316
213 Ga0265338_10022339 3300028800 Bacteria 6552
214 Ga0265328_10000783 3300031239 Bacteria 14691
215 Ga0265320_10004102 3300031240 Bacteria 9575
216 Ga0265320_10013172 3300031240 Bacteria 4767
217 Ga0265339_10005583 3300031249 Bacteria 8351
218 Ga0265314_10005356 3300031711 Bacteria 11594
219 Ga0265314_10008173 3300031711 Bacteria 9001
220 Ga0265342_10000401 3300031712 Bacteria 47920
221 Ga0265342_10006575 3300031712 Bacteria 8644
222 Ga0373923_0139763 3300035111 Bacteria 1094
223 Ga0373954_0095356 3300035118 Bacteria 1432
224 Ga0373956_0169520 3300035119 Bacteria 1030
225 Ga0316574_0182796 3300035398 Bacteria 1349
226 Ga0373935_0040654 3300035692 Bacteria 2919
227 Ga0373933_0097013 3300035724 Bacteria 1825
228 Ga0373937_0017736 3300036401 Bacteria 6351
229 Ga0395900_0873713 3300037418 Unclassified 824
230 Ga0395905_0033939 3300037471 Bacteria 4792
231 Ga0395905_0059993 3300037471 Bacteria 3557
232 Ga0395905_0157946 3300037471 Unclassified 2132
233 Ga0242420_005083 3300038996 Bacteria 2021
234 Ga0439448_0000872 3300042005 Bacteria 7378
235 Ga0451577_0005287 3300042876 Bacteria 13271
236 Ga0451577_0077491 3300042876 Unclassified 2964
237 Ga0453683_0125486 3300044673 Unclassified 1616
238 Ga0451576_0142628 3300045051 Unclassified 2498
239 Ga0451576_0497586 3300045051 Unclassified 1280
240 Ga0451576_1590353 3300045051 Unclassified 678
241 Ga0495603_0135045 3300046455 Bacteria 1436
242 Ga0495629_0003230 3300046459 Bacteria 12346
243 Ga0495629_0006933 3300046459 Bacteria 8359
244 Ga0495641_0045185 3300046461 Bacteria 2029
245 Ga0495641_0187004 3300046461 Bacteria 928
246 Ga0495651_0103700 3300046462 Bacteria 2113
247 Ga0495651_0151964 3300046462 Bacteria 1668
248 Ga0495653_0019755 3300046463 Bacteria 5463
249 Ga0495580_0099779 3300046472 Bacteria 2020
250 Ga0495582_0001286 3300046473 Bacteria 14091
251 Ga0495582_0049399 3300046473 Bacteria 2316
252 Ga0495662_0129647 3300046476 Bacteria 1240
253 Ga0495664_0002099 3300046477 Bacteria 10652
254 Ga0495664_0293775 3300046477 Bacteria 981
255 Ga0495594_0000949 3300046499 Bacteria 15046
256 Ga0495594_0007917 3300046499 Bacteria 5463
257 Ga0495583_0037956 3300046506 Bacteria 2279
258 Ga0495608_0092877 3300046511 Bacteria 1950
259 Ga0495630_0081561 3300046517 Bacteria 2441
260 Ga0495632_0144089 3300046519 Bacteria 1104
261 Ga0495666_0001843 3300046526 Bacteria 10480
262 Ga0495652_0004269 3300046529 Bacteria 13729
263 Ga0495665_0002340 3300046531 Bacteria 10239
264 Ga0495640_0003065 3300046533 Bacteria 13452
265 Ga0495586_0002042 3300046535 Bacteria 10966
266 Ga0495587_0210356 3300046536 Bacteria 1098
267 Ga0495598_0007614 3300046537 Bacteria 2491
268 Ga0495621_0260051 3300046539 Unclassified 711
269 Ga0495645_0014451 3300046543 Bacteria 5601
270 Ga0495622_0098091 3300046557 Bacteria 1344
271 Ga0495634_0012191 3300046642 Bacteria 6232
272 Ga0495634_0513876 3300046642 Bacteria 701
273 Ga0495635_0003669 3300046663 Bacteria 10641
274 Ga0495588_0065844 3300046674 Bacteria 1880
275 Ga0495657_0056720 3300046675 Bacteria 2607
276 Ga0495657_0221530 3300046675 Bacteria 1147
277 Ga0495599_0018033 3300046678 Bacteria 4396
278 Ga0495623_0239334 3300046679 Bacteria 1026
279 Ga0495646_0118813 3300046680 Bacteria 1497
280 Ga0495613_0004941 3300046689 Bacteria 10015
281 Ga0495613_0027824 3300046689 Bacteria 4207
282 Ga0495624_0398133 3300046690 Bacteria 827
283 Ga0495649_0108422 3300046694 Bacteria 1473
284 Ga0495600_0006993 3300046809 Bacteria 6888
285 Ga0495581_0006663 3300047315 Bacteria 6693
286 Ga0495581_0035545 3300047315 Bacteria 2883
287 Ga0495604_0015843 3300047317 Bacteria 6018
288 Ga0495604_0018401 3300047317 Bacteria 5594
289 Ga0495636_0040568 3300047318 Bacteria 1930
290 Ga0495674_0008176 3300047319 Bacteria 9980
291 Ga0495676_0001600 3300047321 Bacteria 19649
292 Ga0495680_0011498 3300047322 Bacteria 7830
293 Ga0495687_144318 3300047443 Bacteria 823
294 Ga0495675_0014187 3300047444 Bacteria 5038
295 Ga0495684_0313827 3300047471 Unclassified 1123
296 Ga0495593_0025511 3300047673 Bacteria 3272
297 Ga0495614_0001026 3300048089 Bacteria 11911
298 Ga0495614_0007728 3300048089 Bacteria 4778
299 Ga0496104_0113464 3300048907 Bacteria 2599
300 Ga0496104_0432516 3300048907 Bacteria 1228
301 Ga0496106_0014847 3300048909 Bacteria 5759
302 Ga0496109_0328492 3300048912 Bacteria 1444
303 Ga0496112_0519584 3300048915 Bacteria 1125
304 Ga0496126_0000010 3300048929 Bacteria 744888
305 Ga0495682_0037285 3300049460 Bacteria 1789
306 Ga0501073_0008719 3300049589 Bacteria 7507
307 Ga0501035_0099160 3300049822 Bacteria 2558
308 nmdc:mga09592_67446_c1 3300050508 Bacteria 3034
309 nmdc:mga0n895_170418_c1 3300050512 Unclassified 2209
310 nmdc:mga0n895_55434_c1 3300050512 Bacteria 3901
311 nmdc:mga0rr50_36970_c1 3300050513 Bacteria 3521
312 nmdc:mga08x19_13_c1 3300050514 Bacteria 366166
313 nmdc:mga0a205_15651_c2 3300050515 Bacteria 3315
314 nmdc:mga0a205_67747_c1 3300050515 Unclassified 3448
315 nmdc:mga0a205_873767_c1 3300050515 Unclassified 746
316 Ga0495612_0187096 3300053078 Bacteria 911
317 Ga0495655_0068953 3300053083 Bacteria 984
318 Ga0500566_0339807 3300053094 Unclassified 692
319 Ga0081455_10255511
320 JGI24748J21848_1000003
321 JGI24034J26672_10000005
322 Ga0065707_10119832
323 Ga0070658_10013359
324 Ga0070658_10036457
325 Ga0070658_10278523
326 Ga0070676_10071407
327 Ga0070683_100393010
328 Ga0070683_100444814
329 Ga0070683_100611568
330 Ga0070690_100047601
331 Ga0068869_100027416
332 Ga0068868_100037912
333 Ga0068868_100129889
334 Ga0070660_100130779
335 Ga0070689_100038393
336 Ga0070691_10287211
337 Ga0070687_100114467
338 Ga0070669_100643715
339 Ga0070671_100054366
340 Ga0070671_100157467
341 Ga0070673_100005656
342 Ga0070673_100040857
343 Ga0070703_10000091
344 Ga0070709_10266939
345 Ga0070714_100362627
346 Ga0070710_10058403
347 Ga0070711_100143189
348 Ga0070705_100086089
349 Ga0070694_100009596
350 Ga0070694_100014511
351 Ga0070663_100978002
352 Ga0070681_10371485
353 Ga0068867_100679453
354 Ga0070706_100009136
355 Ga0070706_100285783
356 Ga0070707_100000435
357 Ga0070707_100037180
358 Ga0070707_100074881
359 Ga0070707_100081147
360 Ga0070698_100000312
361 Ga0070698_100221441
362 Ga0070698_100532288
363 Ga0070699_100003472
364 Ga0070699_100257642
365 Ga0070679_100571407
366 Ga0070697_100033242
367 Ga0070697_100044547
368 Ga0070697_100102173
369 Ga0070697_100374311
370 Ga0070695_100133742
371 Ga0070695_100203290
372 Ga0070695_100347778
373 Ga0070696_100476539
374 Ga0070665_100088459
375 Ga0070665_100167521
376 Ga0070704_100152564
377 Ga0068855_100006256
378 Ga0068855_100015159
379 Ga0068855_100028673
380 Ga0068855_100052136
381 Ga0068855_100184118
382 Ga0068855_100443617
383 Ga0068857_100091766
384 Ga0068854_100359585
385 Ga0068856_100051629
386 Ga0068856_100299432
387 Ga0068856_100950215
388 Ga0070702_100186891
389 Ga0068852_100573934
390 Ga0068852_100589728
391 Ga0068859_100006573
392 Ga0068864_100111190
393 Ga0068866_10011288
394 Ga0068861_100079049
395 Ga0068861_100282932
396 Ga0068863_100245210
397 Ga0068858_100000311
398 Ga0068858_100141204
399 Ga0068858_100163390
400 Ga0068860_100081011
401 Ga0068860_100099588
402 Ga0068860_100106361
403 Ga0068860_100479410
404 Ga0068862_100077077
405 Ga0081540_1002998
406 Ga0070716_100357372
407 Ga0068871_100219153
408 Ga0075428_100032741
409 Ga0075433_10025719
410 Ga0075433_10149590
411 Ga0075433_10244510
412 Ga0075433_10543896
413 Ga0075434_100086377
414 Ga0075434_100129537
415 Ga0075429_100028211
416 Ga0075436_100000011
417 Ga0097620_100006573
418 Ga0075435_100046123
419 Ga0105240_10000311
420 Ga0105240_10180798
421 Ga0105240_10236105
422 Ga0105240_10795479
423 Ga0111539_10016807
424 Ga0105245_10552836
425 Ga0105247_10000022
426 Ga0114129_10014339
427 Ga0105243_10000357
428 Ga0105243_10000920
429 Ga0105243_10509485
430 Ga0105241_10489087
431 Ga0105242_10000916
432 Ga0105242_10006463
433 Ga0105248_10081515
434 Ga0105248_10136864
435 Ga0105248_10317003
436 Ga0105248_10459979
437 Ga0105238_10030285
438 Ga0105238_10489591
439 Ga0105249_10013474
440 Ga0105249_10048194
441 Ga0105239_10023320
442 Ga0157371_10099890
443 Ga0157370_10095641
444 Ga0157370_10167741
445 Ga0157370_10535643
446 Ga0157369_10032199
447 Ga0157369_10237455
448 Ga0157369_10702687
449 Ga0157369_10958620
450 Ga0157374_10818763
451 Ga0157378_10000051
452 Ga0157378_10018763
453 Ga0157378_10045305
454 Ga0157378_10344971
455 Ga0163162_10029185
456 Ga0163162_10042087
457 Ga0163162_10084380
458 Ga0157372_10146959
459 Ga0157372_10704332
460 Ga0157375_10011570
461 Ga0157380_10002035
462 Ga0157380_10150236
463 Ga0157377_10613844
464 Ga0157379_10051663
465 Ga0157376_10543003
466 Ga0207672_1000527
467 Ga0207653_10000034
468 Ga0207710_10000001
469 Ga0207647_10194412
470 Ga0207699_10335526
471 Ga0207645_10225332
472 Ga0207705_10000063
473 Ga0207705_10006300
474 Ga0207705_10044281
475 Ga0207705_10045466
476 Ga0207705_10181437
477 Ga0207684_10005477
478 Ga0207684_10030480
479 Ga0207707_10262700
480 Ga0207695_10000600
481 Ga0207695_10229280
482 Ga0207695_10432444
483 Ga0207663_10192263
484 Ga0207662_10028023
485 Ga0207662_10122529
486 Ga0207657_10045062
487 Ga0207657_10367554
488 Ga0207646_10015934
489 Ga0207646_10018206
490 Ga0207681_10468946
491 Ga0207694_10007947
492 Ga0207700_10306934
493 Ga0207690_10210818
494 Ga0207686_10000170
495 Ga0207686_10001061
496 Ga0207709_10001213
497 Ga0207709_10079409
498 Ga0207709_10501198
499 Ga0207670_10641923
500 Ga0207704_10081216
501 Ga0207689_10038076
502 Ga0207661_10699415
503 Ga0207661_10893964
504 Ga0207667_10002295
505 Ga0207667_10011625
506 Ga0207667_10403014
507 Ga0207651_10063050
508 Ga0207712_10265398
509 Ga0207677_10283569
510 Ga0207703_10000024
511 Ga0207703_10081712
512 Ga0207703_10234171
513 Ga0207703_10235708
514 Ga0207703_10429421
515 Ga0207678_10141927
516 Ga0207702_10131064
517 Ga0207702_10581768
518 Ga0207702_10856664
519 Ga0207648_10335675
520 Ga0207676_10139198
521 Ga0207675_100008290
522 Ga0207698_10021812
523 Ga0207698_10220438
524 Ga0209588_1071073
525 Ga0207428_10007576
526 Ga0268265_10201699
527 Ga0268264_10139782
528 Ga0265318_10000133
529 Ga0265336_10016428
530 Ga0265338_10002653
531 Ga0265338_10022339
532 Ga0265328_10000783
533 Ga0265320_10004102
534 Ga0265320_10013172
535 Ga0265339_10005583
536 Ga0265314_10005356
537 Ga0265314_10008173
538 Ga0265342_10000401
539 Ga0265342_10006575
540 Ga0373923_0139763
541 Ga0373954_0095356
542 Ga0373956_0169520
543 Ga0316574_0182796
544 Ga0373935_0040654
545 Ga0373933_0097013
546 Ga0373937_0017736
547 Ga0395900_0873713
548 Ga0395905_0033939
549 Ga0395905_0059993
550 Ga0395905_0157946
551 Ga0242420_005083
552 Ga0439448_0000872
553 Ga0451577_0005287
554 Ga0451577_0077491
555 Ga0453683_0125486
556 Ga0451576_0142628
557 Ga0451576_0497586
558 Ga0451576_1590353
559 Ga0495603_0135045
560 Ga0495629_0003230
561 Ga0495629_0006933
562 Ga0495641_0045185
563 Ga0495641_0187004
564 Ga0495651_0103700
565 Ga0495651_0151964
566 Ga0495653_0019755
567 Ga0495580_0099779
568 Ga0495582_0001286
569 Ga0495582_0049399
570 Ga0495662_0129647
571 Ga0495664_0002099
572 Ga0495664_0293775
573 Ga0495594_0000949
574 Ga0495594_0007917
575 Ga0495583_0037956
576 Ga0495608_0092877
577 Ga0495630_0081561
578 Ga0495632_0144089
579 Ga0495666_0001843
580 Ga0495652_0004269
581 Ga0495665_0002340
582 Ga0495640_0003065
583 Ga0495586_0002042
584 Ga0495587_0210356
585 Ga0495598_0007614
586 Ga0495621_0260051
587 Ga0495645_0014451
588 Ga0495622_0098091
589 Ga0495634_0012191
590 Ga0495634_0513876
591 Ga0495635_0003669
592 Ga0495588_0065844
593 Ga0495657_0056720
594 Ga0495657_0221530
595 Ga0495599_0018033
596 Ga0495623_0239334
597 Ga0495646_0118813
598 Ga0495613_0004941
599 Ga0495613_0027824
600 Ga0495624_0398133
601 Ga0495649_0108422
602 Ga0495600_0006993
603 Ga0495581_0006663
604 Ga0495581_0035545
605 Ga0495604_0015843
606 Ga0495604_0018401
607 Ga0495636_0040568
608 Ga0495674_0008176
609 Ga0495676_0001600
610 Ga0495680_0011498
611 Ga0495687_144318
612 Ga0495675_0014187
613 Ga0495684_0313827
614 Ga0495593_0025511
615 Ga0495614_0001026
616 Ga0495614_0007728
617 Ga0496104_0113464
618 Ga0496104_0432516
619 Ga0496106_0014847
620 Ga0496109_0328492
621 Ga0496112_0519584
622 Ga0496126_0000010
623 Ga0495682_0037285
624 Ga0501073_0008719
625 Ga0501035_0099160
626 nmdc:mga09592_67446_c1
627 nmdc:mga0n895_170418_c1
628 nmdc:mga0n895_55434_c1
629 nmdc:mga0rr50_36970_c1
630 nmdc:mga08x19_13_c1
631 nmdc:mga0a205_15651_c2
632 nmdc:mga0a205_67747_c1
633 nmdc:mga0a205_873767_c1
634 Ga0495612_0187096
635 Ga0495655_0068953
636 Ga0500566_0339807

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00625

Guanylate_kin

Guanylate kinase

26

211

0.93

PF00005

ABC_tran

ABC transporter

17

198

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yki-assembly1.cif.gz_A crystal structure of magi2 pdz0-gk domain in complex with phospho-sapap1 gbr3 peptide 0.957 48 97
3lnc-assembly1.cif.gz_A crystal structure of guanylate kinase from anaplasma phagocytophilum 0.9537 15 198
3lnc-assembly1.cif.gz_B crystal structure of guanylate kinase from anaplasma phagocytophilum 0.9495 16 198
2qor-assembly1.cif.gz_A crystal structure of plasmodium vivax guanylate kinase 0.9374 16 195
1lvg-assembly1.cif.gz_A crystal structure of mouse guanylate kinase in complex with gmp and adp 0.9356 21 198
ID Description Score Start End Superfamily
af_Q94JM2_119_167_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 1.002 49 95 3.30.63.10
af_Q2QPW1_160_210_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9927 49 98 3.30.63.10
3tr0A02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9902 49 104 3.30.63.10
2qorA02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9831 49 100 3.30.63.10
af_Q5TCQ9_142_196_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9569 48 97 3.30.63.10
ID Description Score Start End GO Terms
AF-E5AWN8-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9867 32 169 GO:0004385
GO:0005524
GO:0005829
AF-A0A6M3ATD5-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9847 36 183 GO:0004385
GO:0005524
GO:0005829
AF-A0A1W9GKP5-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9835 21 199 GO:0004385
GO:0005524
GO:0005829
AF-A0A2K1PAI3-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9791 17 204 GO:0004385
GO:0005524
GO:0005829
AF-A0A2M7DS87-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9764 16 199 GO:0004385
GO:0005524
GO:0005829

Map