F404516

General Info

Members Datasets Scaffolds Average Seq Length
318 199 636 212

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100812497|Ga0070704_1008124971
Length 238
Sequence VDVATKFHIAARATGLERRGVVAIGPDFPSWLNKLPVVAAIAGVLVPTVAIAGVWYYFSPWYTDVGYQPTQPVPYSHKLHVGDLGLDCRYCHASVEISNVANIPPTKTCMNCHQVVKRDSVLLAPIRDSNQNNRPMRWIRVHNLPDYAYFTHRSHVKAGIGCVTCHGRIDEMEKVTQMTPLSMGWCLDCHRNPGPNRRPVSEVTNMKWTPPRDATALIAQLNKERPVNPPTDCSGCHR

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
137 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
140 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
141 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
142 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
143 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
144 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
145 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
146 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
147 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 5.35
Rhizosphere 93.71
Stem 0
Stem Tuber 0
Unclassified 14.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100812497 3300005549 Unclassified 836
2 Ga0065704_10332132 3300005289 Bacteria 836
3 Ga0065715_10000537 3300005293 Bacteria 10762
4 Ga0065715_10044255 3300005293 Bacteria 1180
5 Ga0065707_10004237 3300005295 Bacteria 4750
6 Ga0065707_10239014 3300005295 Unclassified 1162
7 Ga0070676_10017573 3300005328 Bacteria 3957
8 Ga0070690_100074086 3300005330 Bacteria 2216
9 Ga0070670_100005615 3300005331 Bacteria 10585
10 Ga0070670_100030491 3300005331 Bacteria 4644
11 Ga0070670_100036866 3300005331 Bacteria 4207
12 Ga0068869_100019556 3300005334 Bacteria 4630
13 Ga0068869_100323837 3300005334 Bacteria 1251
14 Ga0068869_100491390 3300005334 Bacteria 1023
15 Ga0070666_10240990 3300005335 Bacteria 1279
16 Ga0070660_100169288 3300005339 Bacteria 1764
17 Ga0070689_100010500 3300005340 Bacteria 6601
18 Ga0070689_100094549 3300005340 Bacteria 2360
19 Ga0070689_100234273 3300005340 Bacteria 1510
20 Ga0070687_100205488 3300005343 Unclassified 1196
21 Ga0070668_100082690 3300005347 Bacteria 2519
22 Ga0070668_100436739 3300005347 Unclassified 1123
23 Ga0070669_100070474 3300005353 Unclassified 2584
24 Ga0070669_100191037 3300005353 Bacteria 1606
25 Ga0070675_100047996 3300005354 Bacteria 3500
26 Ga0070675_100154792 3300005354 Bacteria 1968
27 Ga0070671_100073343 3300005355 Bacteria 2859
28 Ga0070671_100207554 3300005355 Bacteria 1661
29 Ga0070674_100035959 3300005356 Unclassified 3321
30 Ga0070673_100004398 3300005364 Bacteria 8908
31 Ga0070673_100034701 3300005364 Bacteria 3820
32 Ga0070673_100087610 3300005364 Bacteria 2538
33 Ga0070688_100009158 3300005365 Bacteria 5401
34 Ga0070688_100047984 3300005365 Bacteria 2651
35 Ga0070659_100425092 3300005366 Bacteria 1124
36 Ga0070709_10520788 3300005434 Bacteria 906
37 Ga0070713_100031350 3300005436 Bacteria 4234
38 Ga0070701_10002935 3300005438 Bacteria 6656
39 Ga0070700_100122466 3300005441 Bacteria 1745
40 Ga0070694_100332837 3300005444 Bacteria 1172
41 Ga0070708_100463868 3300005445 Bacteria 1195
42 Ga0070663_100091200 3300005455 Bacteria 2258
43 Ga0070678_100130918 3300005456 Bacteria 1993
44 Ga0070678_100303342 3300005456 Bacteria 1358
45 Ga0070662_100104944 3300005457 Bacteria 2145
46 Ga0070681_10276405 3300005458 Bacteria 1591
47 Ga0068867_100266792 3300005459 Unclassified 1398
48 Ga0068867_100619304 3300005459 Bacteria 946
49 Ga0070685_10008730 3300005466 Bacteria 5218
50 Ga0070685_10200393 3300005466 Bacteria 1297
51 Ga0070697_100291828 3300005536 Unclassified 1401
52 Ga0070697_100421630 3300005536 Bacteria 1160
53 Ga0070672_100030404 3300005543 Bacteria 4057
54 Ga0070686_100011362 3300005544 Bacteria 5049
55 Ga0070686_100024927 3300005544 Bacteria 3590
56 Ga0070695_100127796 3300005545 Bacteria 1748
57 Ga0070693_100003035 3300005547 Bacteria 7783
58 Ga0070704_100555426 3300005549 Bacteria 1004
59 Ga0070704_100601341 3300005549 Bacteria 967
60 Ga0068855_100284998 3300005563 Bacteria 1833
61 Ga0068857_100461025 3300005577 Unclassified 1189
62 Ga0068854_100095104 3300005578 Bacteria 2223
63 Ga0070702_100100560 3300005615 Bacteria 1772
64 Ga0068852_100367275 3300005616 Bacteria 1409
65 Ga0068859_100005433 3300005617 Bacteria 12958
66 Ga0068859_100017751 3300005617 Bacteria 7153
67 Ga0068859_100060850 3300005617 Bacteria 3805
68 Ga0068864_100001699 3300005618 Bacteria 18094
69 Ga0068863_100095887 3300005841 Bacteria 2816
70 Ga0068863_100490612 3300005841 Unclassified 1209
71 Ga0068858_100084145 3300005842 Bacteria 2959
72 Ga0068858_100544973 3300005842 Unclassified 1123
73 Ga0068860_100080535 3300005843 Bacteria 3097
74 Ga0068862_100453407 3300005844 Bacteria 1209
75 Ga0097621_100441253 3300006237 Bacteria 1171
76 Ga0068871_100417966 3300006358 Unclassified 1197
77 Ga0075428_100007546 3300006844 Bacteria 12054
78 Ga0075428_100026921 3300006844 Bacteria 6368
79 Ga0075428_100556776 3300006844 Unclassified 1226
80 Ga0075430_100094484 3300006846 Bacteria 2499
81 Ga0075431_100085944 3300006847 Unclassified 3246
82 Ga0075431_100148887 3300006847 Bacteria 2411
83 Ga0075433_10003173 3300006852 Bacteria 12670
84 Ga0075433_10132580 3300006852 Unclassified 2214
85 Ga0075434_100037695 3300006871 Bacteria 4786
86 Ga0075434_100240093 3300006871 Bacteria 1832
87 Ga0075429_100101561 3300006880 Bacteria 2511
88 Ga0075429_100627422 3300006880 Unclassified 942
89 Ga0068865_100201314 3300006881 Bacteria 1546
90 Ga0068865_100218288 3300006881 Bacteria 1489
91 Ga0068865_100549585 3300006881 Bacteria 969
92 Ga0075436_100108662 3300006914 Bacteria 1935
93 Ga0097620_100005433 3300006931 Bacteria 12958
94 Ga0097620_100017751 3300006931 Bacteria 7153
95 Ga0097620_100060849 3300006931 Bacteria 3805
96 Ga0075435_100003424 3300007076 Bacteria 10757
97 Ga0075435_100058135 3300007076 Bacteria 3131
98 Ga0111539_10001705 3300009094 Bacteria 29265
99 Ga0111539_10004600 3300009094 Bacteria 18032
100 Ga0111539_10020436 3300009094 Bacteria 8154
101 Ga0111539_10022800 3300009094 Bacteria 7691
102 Ga0111539_10073025 3300009094 Bacteria 4045
103 Ga0111539_10599120 3300009094 Bacteria 1283
104 Ga0111539_10667697 3300009094 Unclassified 1210
105 Ga0111539_11208910 3300009094 Bacteria 878
106 Ga0105245_10045160 3300009098 Bacteria 3934
107 Ga0105245_10046810 3300009098 Bacteria 3865
108 Ga0114129_10000390 3300009147 Bacteria 51153
109 Ga0114129_10012328 3300009147 Bacteria 12166
110 Ga0114129_10282311 3300009147 Bacteria 2218
111 Ga0105243_10101987 3300009148 Unclassified 2384
112 Ga0105243_10223479 3300009148 Bacteria 1666
113 Ga0105241_10059602 3300009174 Bacteria 2935
114 Ga0105242_10015464 3300009176 Bacteria 5925
115 Ga0105248_10001705 3300009177 Bacteria 24457
116 Ga0105248_10009358 3300009177 Bacteria 10784
117 Ga0105248_10156026 3300009177 Bacteria 2576
118 Ga0105249_10031351 3300009553 Bacteria 4808
119 Ga0105249_10075032 3300009553 Bacteria 3131
120 Ga0105249_10696716 3300009553 Bacteria 1076
121 Ga0105239_10374083 3300010375 Bacteria 1610
122 Ga0105239_10866908 3300010375 Unclassified 1036
123 Ga0105246_10033494 3300011119 Bacteria 3416
124 Ga0157378_10089625 3300013297 Bacteria 2794
125 Ga0163162_10244906 3300013306 Unclassified 1924
126 Ga0163162_10604252 3300013306 Bacteria 1223
127 Ga0157375_10021319 3300013308 Bacteria 5938
128 Ga0157375_10335316 3300013308 Bacteria 1678
129 Ga0163163_10873889 3300014325 Bacteria 962
130 Ga0157380_10047033 3300014326 Bacteria 3391
131 Ga0157379_10659161 3300014968 Unclassified 980
132 Ga0157376_10165838 3300014969 Bacteria 2007
133 Ga0163161_10100127 3300017792 Bacteria 2156
134 Ga0207642_10065904 3300025899 Unclassified 1703
135 Ga0207688_10011207 3300025901 Bacteria 4881
136 Ga0207688_10301281 3300025901 Unclassified 980
137 Ga0207680_10131380 3300025903 Bacteria 1651
138 Ga0207699_10497360 3300025906 Bacteria 880
139 Ga0207645_10001445 3300025907 Bacteria 19465
140 Ga0207645_10135125 3300025907 Bacteria 1606
141 Ga0207645_10198337 3300025907 Bacteria 1320
142 Ga0207645_10446320 3300025907 Bacteria 873
143 Ga0207654_10048878 3300025911 Bacteria 2423
144 Ga0207660_10323225 3300025917 Bacteria 1232
145 Ga0207662_10004655 3300025918 Bacteria 7240
146 Ga0207662_10416806 3300025918 Unclassified 913
147 Ga0207657_10210850 3300025919 Bacteria 1559
148 Ga0207681_10168758 3300025923 Unclassified 1657
149 Ga0207681_10725667 3300025923 Bacteria 827
150 Ga0207650_10029811 3300025925 Bacteria 3925
151 Ga0207650_10056787 3300025925 Bacteria 2910
152 Ga0207650_10060566 3300025925 Bacteria 2825
153 Ga0207659_10028698 3300025926 Bacteria 3783
154 Ga0207659_10102031 3300025926 Bacteria 2165
155 Ga0207687_10315811 3300025927 Unclassified 1263
156 Ga0207687_10574919 3300025927 Bacteria 947
157 Ga0207700_10024297 3300025928 Bacteria 4193
158 Ga0207644_10039062 3300025931 Bacteria 3348
159 Ga0207644_10055291 3300025931 Bacteria 2861
160 Ga0207706_10051965 3300025933 Bacteria 3618
161 Ga0207686_10210843 3300025934 Bacteria 1396
162 Ga0207686_10394449 3300025934 Bacteria 1053
163 Ga0207686_10397637 3300025934 Unclassified 1049
164 Ga0207709_10240735 3300025935 Bacteria 1316
165 Ga0207709_10406709 3300025935 Unclassified 1042
166 Ga0207670_10016542 3300025936 Bacteria 4436
167 Ga0207670_10297937 3300025936 Bacteria 1262
168 Ga0207669_10011754 3300025937 Unclassified 4275
169 Ga0207669_10061865 3300025937 Bacteria 2303
170 Ga0207704_10027805 3300025938 Bacteria 3127
171 Ga0207704_10376540 3300025938 Unclassified 1113
172 Ga0207691_10006978 3300025940 Bacteria 10899
173 Ga0207691_10044046 3300025940 Bacteria 4109
174 Ga0207691_10066777 3300025940 Bacteria 3253
175 Ga0207711_10029970 3300025941 Bacteria 4590
176 Ga0207711_10125602 3300025941 Bacteria 2295
177 Ga0207711_10269825 3300025941 Unclassified 1565
178 Ga0207689_10506508 3300025942 Bacteria 1012
179 Ga0207679_10195512 3300025945 Unclassified 1685
180 Ga0207651_10003966 3300025960 Bacteria 7350
181 Ga0207651_10630709 3300025960 Bacteria 939
182 Ga0207712_10009556 3300025961 Bacteria 6138
183 Ga0207668_10050590 3300025972 Bacteria 2865
184 Ga0207668_10172923 3300025972 Bacteria 1696
185 Ga0207640_10091206 3300025981 Bacteria 2110
186 Ga0207658_10087444 3300025986 Bacteria 2407
187 Ga0207703_10119410 3300026035 Bacteria 2261
188 Ga0207678_10058901 3300026067 Bacteria 3305
189 Ga0207708_10023580 3300026075 Bacteria 4653
190 Ga0207708_10082298 3300026075 Bacteria 2475
191 Ga0207641_10039078 3300026088 Bacteria 3968
192 Ga0207641_10099647 3300026088 Bacteria 2557
193 Ga0207648_10020538 3300026089 Bacteria 5946
194 Ga0207648_10273059 3300026089 Bacteria 1511
195 Ga0207648_10329992 3300026089 Bacteria 1372
196 Ga0207676_10024124 3300026095 Bacteria 4498
197 Ga0207676_10053002 3300026095 Bacteria 3174
198 Ga0207674_10245157 3300026116 Bacteria 1739
199 Ga0207674_10538578 3300026116 Unclassified 1128
200 Ga0207675_100056753 3300026118 Unclassified 3652
201 Ga0207675_100069130 3300026118 Bacteria 3301
202 Ga0207675_100185882 3300026118 Bacteria 1992
203 Ga0207683_10109782 3300026121 Bacteria 2469
204 Ga0207683_10410952 3300026121 Bacteria 1246
205 Ga0207698_10164266 3300026142 Bacteria 1946
206 Ga0209999_1034355 3300027543 Bacteria 944
207 Ga0209998_10033638 3300027717 Bacteria 1143
208 Ga0209974_10095076 3300027876 Bacteria 1036
209 Ga0209974_10193585 3300027876 Bacteria 749
210 Ga0207428_10011341 3300027907 Bacteria 7882
211 Ga0207428_10030042 3300027907 Bacteria 4495
212 Ga0207428_10074127 3300027907 Bacteria 2669
213 Ga0207428_10218645 3300027907 Bacteria 1429
214 Ga0268266_10076030 3300028379 Bacteria 2918
215 Ga0268265_10175313 3300028380 Bacteria 1837
216 Ga0268264_10113873 3300028381 Bacteria 2374
217 Ga0265320_10012407 3300031240 Bacteria 4960
218 Ga0307413_10319109 3300031824 Bacteria 1186
219 Ga0307410_10211386 3300031852 Bacteria 1487
220 Ga0307416_100597337 3300032002 Bacteria 1183
221 Ga0373926_0066033 3300035083 Bacteria 1324
222 Ga0373923_0063950 3300035111 Unclassified 1568
223 Ga0373956_0084983 3300035119 Bacteria 1455
224 Ga0373960_0048549 3300035121 Unclassified 1252
225 Ga0373955_0106141 3300035172 Bacteria 1619
226 Ga0373925_0000476 3300037068 Bacteria 40075
227 Ga0373925_0001039 3300037068 Bacteria 25175
228 Ga0439439_0010684 3300041406 Unclassified 2199
229 Ga0439453_0004278 3300041408 Archaea 2115
230 Ga0451853_2185180 3300041512 Unclassified 1540
231 Ga0451853_3358092 3300041512 Bacteria 1200
232 Ga0439431_0006532 3300041997 Bacteria 2580
233 Ga0439449_0011778 3300042007 Bacteria 3288
234 Ga0439451_028810 3300042009 Bacteria 1119
235 Ga0450923_029662 3300042125 Bacteria 1109
236 Ga0439446_0033257 3300042156 Bacteria 1498
237 Ga0439434_0042395 3300042435 Unclassified 1399
238 Ga0439435_0003739 3300042436 Bacteria 3198
239 Ga0439435_0009713 3300042436 Bacteria 2264
240 Ga0439435_0050150 3300042436 Bacteria 1193
241 Ga0439464_0021418 3300042439 Bacteria 1775
242 Ga0439460_0125603 3300042461 Bacteria 842
243 Ga0451577_0059952 3300042876 Bacteria 3392
244 Ga0495629_0000024 3300046459 Bacteria 136884
245 Ga0495639_0000654 3300046475 Bacteria 16009
246 Ga0495608_0123140 3300046511 Bacteria 1662
247 Ga0495666_0000017 3300046526 Bacteria 68024
248 Ga0495586_0000935 3300046535 Bacteria 16565
249 Ga0495622_0031685 3300046557 Bacteria 2470
250 Ga0495647_0036844 3300046681 Bacteria 1843
251 Ga0495658_0001684 3300046683 Bacteria 11507
252 Ga0495581_0136043 3300047315 Bacteria 1432
253 Ga0495674_0165826 3300047319 Unclassified 1846
254 Ga0495676_0001160 3300047321 Bacteria 22428
255 Ga0495680_0110878 3300047322 Bacteria 2033
256 Ga0496101_0076360 3300048904 Bacteria 2468
257 Ga0496102_0097826 3300048905 Bacteria 2722
258 Ga0496104_0002341 3300048907 Bacteria 16378
259 Ga0496104_0006875 3300048907 Bacteria 10030
260 Ga0496106_0206480 3300048909 Unclassified 1564
261 Ga0496106_0268177 3300048909 Bacteria 1367
262 Ga0496106_0412928 3300048909 Unclassified 1085
263 Ga0496107_0239109 3300048910 Unclassified 1351
264 Ga0496108_0041101 3300048911 Bacteria 3858
265 Ga0496109_0008603 3300048912 Bacteria 8688
266 Ga0496109_0116081 3300048912 Bacteria 2491
267 Ga0496110_0035291 3300048913 Bacteria 4338
268 Ga0496111_0076482 3300048914 Unclassified 2440
269 Ga0496112_0051249 3300048915 Bacteria 4048
270 Ga0496112_0222313 3300048915 Bacteria 1844
271 Ga0496113_0007479 3300048916 Bacteria 7035
272 Ga0496114_0013119 3300048917 Bacteria 6639
273 Ga0501036_0261744 3300049572 Bacteria 1449
274 Ga0501040_0053106 3300049576 Viruses 2775
275 Ga0501042_0023587 3300049578 Bacteria 4307
276 Ga0501048_0364973 3300049582 Archaea 1030
277 Ga0501071_0047715 3300049587 Bacteria 3077
278 Ga0501072_0024359 3300049588 Bacteria 4707
279 Ga0501075_0123455 3300049591 Bacteria 1971
280 Ga0501076_0075317 3300049592 Bacteria 2705
281 Ga0501076_0176324 3300049592 Bacteria 1742
282 Ga0501081_0504356 3300049743 Bacteria 902
283 Ga0501035_0331085 3300049822 Bacteria 1278
284 Ga0501045_0071533 3300049824 Bacteria 2553
285 nmdc:mga05p37_115095_c1 3300050507 Bacteria 3306
286 nmdc:mga05p37_234444_c1 3300050507 Bacteria 2210
287 nmdc:mga05p37_241092_c1 3300050507 Bacteria 2174
288 nmdc:mga05p37_365_c1 3300050507 Bacteria 48774
289 nmdc:mga09592_132183_c1 3300050508 Bacteria 2148
290 nmdc:mga09592_146441_c1 3300050508 Bacteria 2036
291 nmdc:mga09592_50429_c1 3300050508 Bacteria 3510
292 nmdc:mga0qj67_70783_c1 3300050509 Bacteria 2783
293 nmdc:mga06r32_116177_c1 3300050510 Bacteria 2636
294 nmdc:mga06r32_290270_c1 3300050510 Bacteria 1622
295 nmdc:mga06r32_51588_c1 3300050510 Bacteria 3937
296 nmdc:mga08y16_106277_c1 3300050511 Bacteria 2922
297 nmdc:mga08y16_175321_c1 3300050511 Bacteria 2226
298 nmdc:mga08y16_219511_c1 3300050511 Bacteria 1968
299 nmdc:mga08y16_22436_c1 3300050511 Bacteria 6663
300 nmdc:mga08y16_2510_c1 3300050511 Bacteria 18866
301 nmdc:mga08y16_31399_c1 3300050511 Bacteria 5586
302 nmdc:mga08y16_387010_c1 3300050511 Bacteria 1433
303 nmdc:mga08y16_9526_c1 3300050511 Bacteria 10193
304 nmdc:mga0n895_40481_c1 3300050512 Bacteria 4526
305 nmdc:mga0n895_4725_c1 3300050512 Bacteria 11248
306 nmdc:mga0n895_562267_c1 3300050512 Bacteria 1146
307 nmdc:mga0rr50_128401_c1 3300050513 Bacteria 2027
308 nmdc:mga0rr50_3449_c1 3300050513 Bacteria 9098
309 nmdc:mga08x19_188560_c1 3300050514 Bacteria 1410
310 nmdc:mga0a205_287136_c1 3300050515 Bacteria 1520
311 nmdc:mga0a205_79708_c1 3300050515 Bacteria 3164
312 Ga0495601_0132162 3300053077 Bacteria 1626
313 Ga0500566_0102054 3300053094 Unclassified 1571
314 Ga0501084_0191745 3300054114 Unclassified 1724
315 Ga0590071_001123 3300059421 Bacteria 7253
316 Ga0590074_000345 3300059423 Bacteria 6488
317 Ga0590077_000162 3300059426 Bacteria 18830
318 Ga0530510_0132502 3300061734 Bacteria 1834
319 Ga0070704_100812497
320 Ga0065704_10332132
321 Ga0065715_10000537
322 Ga0065715_10044255
323 Ga0065707_10004237
324 Ga0065707_10239014
325 Ga0070676_10017573
326 Ga0070690_100074086
327 Ga0070670_100005615
328 Ga0070670_100030491
329 Ga0070670_100036866
330 Ga0068869_100019556
331 Ga0068869_100323837
332 Ga0068869_100491390
333 Ga0070666_10240990
334 Ga0070660_100169288
335 Ga0070689_100010500
336 Ga0070689_100094549
337 Ga0070689_100234273
338 Ga0070687_100205488
339 Ga0070668_100082690
340 Ga0070668_100436739
341 Ga0070669_100070474
342 Ga0070669_100191037
343 Ga0070675_100047996
344 Ga0070675_100154792
345 Ga0070671_100073343
346 Ga0070671_100207554
347 Ga0070674_100035959
348 Ga0070673_100004398
349 Ga0070673_100034701
350 Ga0070673_100087610
351 Ga0070688_100009158
352 Ga0070688_100047984
353 Ga0070659_100425092
354 Ga0070709_10520788
355 Ga0070713_100031350
356 Ga0070701_10002935
357 Ga0070700_100122466
358 Ga0070694_100332837
359 Ga0070708_100463868
360 Ga0070663_100091200
361 Ga0070678_100130918
362 Ga0070678_100303342
363 Ga0070662_100104944
364 Ga0070681_10276405
365 Ga0068867_100266792
366 Ga0068867_100619304
367 Ga0070685_10008730
368 Ga0070685_10200393
369 Ga0070697_100291828
370 Ga0070697_100421630
371 Ga0070672_100030404
372 Ga0070686_100011362
373 Ga0070686_100024927
374 Ga0070695_100127796
375 Ga0070693_100003035
376 Ga0070704_100555426
377 Ga0070704_100601341
378 Ga0068855_100284998
379 Ga0068857_100461025
380 Ga0068854_100095104
381 Ga0070702_100100560
382 Ga0068852_100367275
383 Ga0068859_100005433
384 Ga0068859_100017751
385 Ga0068859_100060850
386 Ga0068864_100001699
387 Ga0068863_100095887
388 Ga0068863_100490612
389 Ga0068858_100084145
390 Ga0068858_100544973
391 Ga0068860_100080535
392 Ga0068862_100453407
393 Ga0097621_100441253
394 Ga0068871_100417966
395 Ga0075428_100007546
396 Ga0075428_100026921
397 Ga0075428_100556776
398 Ga0075430_100094484
399 Ga0075431_100085944
400 Ga0075431_100148887
401 Ga0075433_10003173
402 Ga0075433_10132580
403 Ga0075434_100037695
404 Ga0075434_100240093
405 Ga0075429_100101561
406 Ga0075429_100627422
407 Ga0068865_100201314
408 Ga0068865_100218288
409 Ga0068865_100549585
410 Ga0075436_100108662
411 Ga0097620_100005433
412 Ga0097620_100017751
413 Ga0097620_100060849
414 Ga0075435_100003424
415 Ga0075435_100058135
416 Ga0111539_10001705
417 Ga0111539_10004600
418 Ga0111539_10020436
419 Ga0111539_10022800
420 Ga0111539_10073025
421 Ga0111539_10599120
422 Ga0111539_10667697
423 Ga0111539_11208910
424 Ga0105245_10045160
425 Ga0105245_10046810
426 Ga0114129_10000390
427 Ga0114129_10012328
428 Ga0114129_10282311
429 Ga0105243_10101987
430 Ga0105243_10223479
431 Ga0105241_10059602
432 Ga0105242_10015464
433 Ga0105248_10001705
434 Ga0105248_10009358
435 Ga0105248_10156026
436 Ga0105249_10031351
437 Ga0105249_10075032
438 Ga0105249_10696716
439 Ga0105239_10374083
440 Ga0105239_10866908
441 Ga0105246_10033494
442 Ga0157378_10089625
443 Ga0163162_10244906
444 Ga0163162_10604252
445 Ga0157375_10021319
446 Ga0157375_10335316
447 Ga0163163_10873889
448 Ga0157380_10047033
449 Ga0157379_10659161
450 Ga0157376_10165838
451 Ga0163161_10100127
452 Ga0207642_10065904
453 Ga0207688_10011207
454 Ga0207688_10301281
455 Ga0207680_10131380
456 Ga0207699_10497360
457 Ga0207645_10001445
458 Ga0207645_10135125
459 Ga0207645_10198337
460 Ga0207645_10446320
461 Ga0207654_10048878
462 Ga0207660_10323225
463 Ga0207662_10004655
464 Ga0207662_10416806
465 Ga0207657_10210850
466 Ga0207681_10168758
467 Ga0207681_10725667
468 Ga0207650_10029811
469 Ga0207650_10056787
470 Ga0207650_10060566
471 Ga0207659_10028698
472 Ga0207659_10102031
473 Ga0207687_10315811
474 Ga0207687_10574919
475 Ga0207700_10024297
476 Ga0207644_10039062
477 Ga0207644_10055291
478 Ga0207706_10051965
479 Ga0207686_10210843
480 Ga0207686_10394449
481 Ga0207686_10397637
482 Ga0207709_10240735
483 Ga0207709_10406709
484 Ga0207670_10016542
485 Ga0207670_10297937
486 Ga0207669_10011754
487 Ga0207669_10061865
488 Ga0207704_10027805
489 Ga0207704_10376540
490 Ga0207691_10006978
491 Ga0207691_10044046
492 Ga0207691_10066777
493 Ga0207711_10029970
494 Ga0207711_10125602
495 Ga0207711_10269825
496 Ga0207689_10506508
497 Ga0207679_10195512
498 Ga0207651_10003966
499 Ga0207651_10630709
500 Ga0207712_10009556
501 Ga0207668_10050590
502 Ga0207668_10172923
503 Ga0207640_10091206
504 Ga0207658_10087444
505 Ga0207703_10119410
506 Ga0207678_10058901
507 Ga0207708_10023580
508 Ga0207708_10082298
509 Ga0207641_10039078
510 Ga0207641_10099647
511 Ga0207648_10020538
512 Ga0207648_10273059
513 Ga0207648_10329992
514 Ga0207676_10024124
515 Ga0207676_10053002
516 Ga0207674_10245157
517 Ga0207674_10538578
518 Ga0207675_100056753
519 Ga0207675_100069130
520 Ga0207675_100185882
521 Ga0207683_10109782
522 Ga0207683_10410952
523 Ga0207698_10164266
524 Ga0209999_1034355
525 Ga0209998_10033638
526 Ga0209974_10095076
527 Ga0209974_10193585
528 Ga0207428_10011341
529 Ga0207428_10030042
530 Ga0207428_10074127
531 Ga0207428_10218645
532 Ga0268266_10076030
533 Ga0268265_10175313
534 Ga0268264_10113873
535 Ga0265320_10012407
536 Ga0307413_10319109
537 Ga0307410_10211386
538 Ga0307416_100597337
539 Ga0373926_0066033
540 Ga0373923_0063950
541 Ga0373956_0084983
542 Ga0373960_0048549
543 Ga0373955_0106141
544 Ga0373925_0000476
545 Ga0373925_0001039
546 Ga0439439_0010684
547 Ga0439453_0004278
548 Ga0451853_2185180
549 Ga0451853_3358092
550 Ga0439431_0006532
551 Ga0439449_0011778
552 Ga0439451_028810
553 Ga0450923_029662
554 Ga0439446_0033257
555 Ga0439434_0042395
556 Ga0439435_0003739
557 Ga0439435_0009713
558 Ga0439435_0050150
559 Ga0439464_0021418
560 Ga0439460_0125603
561 Ga0451577_0059952
562 Ga0495629_0000024
563 Ga0495639_0000654
564 Ga0495608_0123140
565 Ga0495666_0000017
566 Ga0495586_0000935
567 Ga0495622_0031685
568 Ga0495647_0036844
569 Ga0495658_0001684
570 Ga0495581_0136043
571 Ga0495674_0165826
572 Ga0495676_0001160
573 Ga0495680_0110878
574 Ga0496101_0076360
575 Ga0496102_0097826
576 Ga0496104_0002341
577 Ga0496104_0006875
578 Ga0496106_0206480
579 Ga0496106_0268177
580 Ga0496106_0412928
581 Ga0496107_0239109
582 Ga0496108_0041101
583 Ga0496109_0008603
584 Ga0496109_0116081
585 Ga0496110_0035291
586 Ga0496111_0076482
587 Ga0496112_0051249
588 Ga0496112_0222313
589 Ga0496113_0007479
590 Ga0496114_0013119
591 Ga0501036_0261744
592 Ga0501040_0053106
593 Ga0501042_0023587
594 Ga0501048_0364973
595 Ga0501071_0047715
596 Ga0501072_0024359
597 Ga0501075_0123455
598 Ga0501076_0075317
599 Ga0501076_0176324
600 Ga0501081_0504356
601 Ga0501035_0331085
602 Ga0501045_0071533
603 nmdc:mga05p37_115095_c1
604 nmdc:mga05p37_234444_c1
605 nmdc:mga05p37_241092_c1
606 nmdc:mga05p37_365_c1
607 nmdc:mga09592_132183_c1
608 nmdc:mga09592_146441_c1
609 nmdc:mga09592_50429_c1
610 nmdc:mga0qj67_70783_c1
611 nmdc:mga06r32_116177_c1
612 nmdc:mga06r32_290270_c1
613 nmdc:mga06r32_51588_c1
614 nmdc:mga08y16_106277_c1
615 nmdc:mga08y16_175321_c1
616 nmdc:mga08y16_219511_c1
617 nmdc:mga08y16_22436_c1
618 nmdc:mga08y16_2510_c1
619 nmdc:mga08y16_31399_c1
620 nmdc:mga08y16_387010_c1
621 nmdc:mga08y16_9526_c1
622 nmdc:mga0n895_40481_c1
623 nmdc:mga0n895_4725_c1
624 nmdc:mga0n895_562267_c1
625 nmdc:mga0rr50_128401_c1
626 nmdc:mga0rr50_3449_c1
627 nmdc:mga08x19_188560_c1
628 nmdc:mga0a205_287136_c1
629 nmdc:mga0a205_79708_c1
630 Ga0495601_0132162
631 Ga0500566_0102054
632 Ga0501084_0191745
633 Ga0590071_001123
634 Ga0590074_000345
635 Ga0590077_000162
636 Ga0530510_0132502

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14522

Cytochrome_C7

Cytochrome c7 and related cytochrome c

148

238

0.81

Map