F404257

General Info

Members Datasets Scaffolds Average Seq Length
317 200 634 317

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0049533|Ga0436361_0049533_857_1858
Length 333
Sequence MFGLRYLKAVRAAWYEKQGLARDVLKVGEMPDPHPAAGEVRIRVAASGINPGDVKKRQNAFGYGMPYARVIPHSDGAGQVDEIGAGLPSEWLGQAVWCYGAQSYRPFGTAAEFTVVPLDQVARLPLGVSTEQGACLGIPGITAHRAVHVAGAVNGRTVLVQGAAGTVGLCAVQLARRAGARVIGTVRSSAEETAATKAGAHEVVRNDEQLIARVGALAAEGVDHVVEVALGANLEADLELLKVGGSIATYASDREAPQIPFWPMVFKNTRLFFLGSDDFPRDAKAVAAEDLNAALEAGWSGFDVAERIPLAEIARAHELVEHPVRRGRVVVIP

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
126 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
127 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
128 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
129 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
130 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
131 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
132 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
133 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
134 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
138 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
142 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
143 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
144 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
145 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
146 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
151 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
152 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
160 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
163 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
164 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
165 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
171 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
184 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
185 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
186 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
187 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
188 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
189 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
190 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
191 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
192 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
195 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
196 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
197 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
198 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
199 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
200 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.74
Metatranscriptomes 0
Isolates 1.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.41
Nodule 0
Rhizoplane 1.89
Rhizosphere 79.18
Stem 0
Stem Tuber 0
Unclassified 6.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0049533 3300039447 Bacteria 2267
2 Ga0070676_10001523 3300005328 Bacteria 11710
3 Ga0070690_100050209 3300005330 Bacteria 2661
4 Ga0070677_10006581 3300005333 Bacteria 3862
5 Ga0068869_100001419 3300005334 Bacteria 14188
6 Ga0070666_10000556 3300005335 Bacteria 22523
7 Ga0068868_100078479 3300005338 Bacteria 2644
8 Ga0070660_100242853 3300005339 Bacteria 1467
9 Ga0070687_100005057 3300005343 Bacteria 5316
10 Ga0070668_100000760 3300005347 Bacteria 22136
11 Ga0070669_100003414 3300005353 Bacteria 11438
12 Ga0070669_100028541 3300005353 Bacteria 4019
13 Ga0070675_100040291 3300005354 Bacteria 3813
14 Ga0070675_100167738 3300005354 Unclassified 1892
15 Ga0070674_100032247 3300005356 Bacteria 3478
16 Ga0070667_100004847 3300005367 Bacteria 11273
17 Ga0070711_100116375 3300005439 Bacteria 1970
18 Ga0070700_100189987 3300005441 Bacteria 1435
19 Ga0070708_100022894 3300005445 Bacteria 5306
20 Ga0070662_100004982 3300005457 Bacteria 8440
21 Ga0068867_100007955 3300005459 Bacteria 7489
22 Ga0070706_100003746 3300005467 Bacteria 14861
23 Ga0070706_100008101 3300005467 Bacteria 9799
24 Ga0070706_100169060 3300005467 Unclassified 2041
25 Ga0070706_100210897 3300005467 Unclassified 1814
26 Ga0070707_100568717 3300005468 Bacteria 1096
27 Ga0070698_100024879 3300005471 Bacteria 6241
28 Ga0070698_100060778 3300005471 Bacteria 3812
29 Ga0070698_100062273 3300005471 Unclassified 3764
30 Ga0070699_100027644 3300005518 Bacteria 4892
31 Ga0070699_100416160 3300005518 Bacteria 1216
32 Ga0070697_100017461 3300005536 Bacteria 5646
33 Ga0068853_100492887 3300005539 Bacteria 1156
34 Ga0070672_100003647 3300005543 Bacteria 10000
35 Ga0070693_100002660 3300005547 Bacteria 8227
36 Ga0070664_100153775 3300005564 Bacteria 2032
37 Ga0068857_100056723 3300005577 Bacteria 3476
38 Ga0068852_100016780 3300005616 Bacteria 5723
39 Ga0068859_100026294 3300005617 Bacteria 5834
40 Ga0068864_100046951 3300005618 Bacteria 3707
41 Ga0068866_10000902 3300005718 Bacteria 13094
42 Ga0068861_100004108 3300005719 Bacteria 9766
43 Ga0068863_100000783 3300005841 Bacteria 31944
44 Ga0068858_100001938 3300005842 Bacteria 21099
45 Ga0068860_100009197 3300005843 Bacteria 9820
46 Ga0068862_100095590 3300005844 Bacteria 2592
47 Ga0081455_10003228 3300005937 Bacteria 18890
48 Ga0081455_10183660 3300005937 Bacteria 1581
49 Ga0070717_10115756 3300006028 Unclassified 2291
50 Ga0075368_10014088 3300006042 Bacteria 2947
51 Ga0075363_100005656 3300006048 Bacteria 5593
52 Ga0075363_100045977 3300006048 Bacteria 2315
53 Ga0075432_10062039 3300006058 Bacteria 1332
54 Ga0070716_100001938 3300006173 Bacteria 9402
55 Ga0070712_100006270 3300006175 Bacteria 7367
56 Ga0075367_10029376 3300006178 Bacteria 3144
57 Ga0075367_10053011 3300006178 Bacteria 2402
58 Ga0075366_10000186 3300006195 Bacteria 27357
59 Ga0075366_10054434 3300006195 Bacteria 2376
60 Ga0075366_10076281 3300006195 Bacteria 2000
61 Ga0075370_10021966 3300006353 Bacteria 3499
62 Ga0075370_10059697 3300006353 Bacteria 2171
63 Ga0075428_100184320 3300006844 Bacteria 2259
64 Ga0075428_100264042 3300006844 Bacteria 1853
65 Ga0075428_100480191 3300006844 Unclassified 1330
66 Ga0075430_100112415 3300006846 Bacteria 2270
67 Ga0075431_100228183 3300006847 Bacteria 1898
68 Ga0075431_100372671 3300006847 Unclassified 1433
69 Ga0075431_100456739 3300006847 Bacteria 1272
70 Ga0075433_10022283 3300006852 Bacteria 5317
71 Ga0075433_10116782 3300006852 Unclassified 2367
72 Ga0075434_100261819 3300006871 Bacteria 1748
73 Ga0075429_100071148 3300006880 Bacteria 3028
74 Ga0075429_100091596 3300006880 Bacteria 2652
75 Ga0075429_100107787 3300006880 Bacteria 2434
76 Ga0068865_100001184 3300006881 Bacteria 15163
77 Ga0097620_100026294 3300006931 Bacteria 5834
78 Ga0075435_100242129 3300007076 Bacteria 1534
79 Ga0099794_10021720 3300007265 Plasmid 2919
80 Ga0099794_10046951 3300007265 Bacteria 2070
81 Ga0105240_10005075 3300009093 Bacteria 19737
82 Ga0111539_10008067 3300009094 Bacteria 13420
83 Ga0105245_10413966 3300009098 Unclassified 1350
84 Ga0114129_10211625 3300009147 Bacteria 2621
85 Ga0114129_10240108 3300009147 Bacteria 2436
86 Ga0105243_10057080 3300009148 Bacteria 3108
87 Ga0105242_10004790 3300009176 Bacteria 10469
88 Ga0105248_10015826 3300009177 Bacteria 8313
89 Ga0105237_10006162 3300009545 Bacteria 13405
90 Ga0105237_10092009 3300009545 Bacteria 3023
91 Ga0105249_10006557 3300009553 Bacteria 10128
92 Ga0105249_10083783 3300009553 Unclassified 2968
93 Ga0105249_10259727 3300009553 Bacteria 1725
94 Ga0105239_10000839 3300010375 Bacteria 43658
95 Ga0105239_10192904 3300010375 Bacteria 2280
96 Ga0163162_10018958 3300013306 Bacteria 6747
97 Ga0157375_10005405 3300013308 Bacteria 11104
98 Ga0157380_10004783 3300014326 Bacteria 9435
99 Ga0157379_10007030 3300014968 Bacteria 9725
100 Ga0157376_10146080 3300014969 Bacteria 2127
101 Ga0163161_10004265 3300017792 Bacteria 9968
102 Ga0213872_10000480 3300021361 Bacteria 32172
103 Ga0213872_10004215 3300021361 Bacteria 7717
104 Ga0213872_10023756 3300021361 Bacteria 2820
105 Ga0213875_10001452 3300021388 Bacteria 15343
106 Ga0213875_10005521 3300021388 Bacteria 6777
107 Ga0213875_10009531 3300021388 Plasmid 4916
108 Ga0213871_10004799 3300021441 Bacteria 2737
109 Ga0207682_10001293 3300025893 Bacteria 11496
110 Ga0207642_10001208 3300025899 Bacteria 7980
111 Ga0207680_10007698 3300025903 Bacteria 5264
112 Ga0207645_10000991 3300025907 Bacteria 23445
113 Ga0207684_10000828 3300025910 Bacteria 35600
114 Ga0207684_10006278 3300025910 Bacteria 10841
115 Ga0207684_10023604 3300025910 Bacteria 5252
116 Ga0207695_10021849 3300025913 Bacteria 7285
117 Ga0207671_10032329 3300025914 Bacteria 3895
118 Ga0207693_10017285 3300025915 Bacteria 5753
119 Ga0207662_10070190 3300025918 Bacteria 2119
120 Ga0207646_10012143 3300025922 Bacteria 8288
121 Ga0207646_10249433 3300025922 Bacteria 1604
122 Ga0207681_10002446 3300025923 Bacteria 11773
123 Ga0207681_10127028 3300025923 Unclassified 1879
124 Ga0207650_10200395 3300025925 Bacteria 1599
125 Ga0207659_10006201 3300025926 Bacteria 7313
126 Ga0207706_10002990 3300025933 Bacteria 16305
127 Ga0207709_10021356 3300025935 Bacteria 3664
128 Ga0207669_10001042 3300025937 Bacteria 11839
129 Ga0207704_10000481 3300025938 Bacteria 17780
130 Ga0207665_10009157 3300025939 Bacteria 6501
131 Ga0207691_10005915 3300025940 Bacteria 11815
132 Ga0207711_10124381 3300025941 Bacteria 2306
133 Ga0207689_10001694 3300025942 Bacteria 20950
134 Ga0207679_10160067 3300025945 Bacteria 1842
135 Ga0207712_10025923 3300025961 Bacteria 3900
136 Ga0207712_10062268 3300025961 Unclassified 2651
137 Ga0207668_10008134 3300025972 Bacteria 6242
138 Ga0207658_10000803 3300025986 Bacteria 26405
139 Ga0207677_10018398 3300026023 Bacteria 4192
140 Ga0207703_10000414 3300026035 Bacteria 45564
141 Ga0207708_10047024 3300026075 Bacteria 3287
142 Ga0207641_10004330 3300026088 Bacteria 12325
143 Ga0207648_10023230 3300026089 Bacteria 5561
144 Ga0207676_10009499 3300026095 Bacteria 6923
145 Ga0207674_10095926 3300026116 Bacteria 2951
146 Ga0207675_100001498 3300026118 Bacteria 23384
147 Ga0207683_10146453 3300026121 Bacteria 2130
148 Ga0207698_10012806 3300026142 Bacteria 5507
149 Ga0209588_1020737 3300027671 Unclassified 2059
150 Ga0207428_10025799 3300027907 Bacteria 4914
151 Ga0207428_10341496 3300027907 Unclassified 1103
152 Ga0268265_10009864 3300028380 Bacteria 6450
153 Ga0268264_10002739 3300028381 Bacteria 15386
154 Ga0307517_10000970 3300028786 Bacteria 48633
155 Ga0307515_10000821 3300028794 Bacteria 71579
156 Ga0307515_10250184 3300028794 Bacteria 1526
157 Ga0307509_10083525 3300031507 Bacteria 3292
158 Ga0307516_10112872 3300031730 Bacteria 2517
159 Ga0307414_10010588 3300032004 Bacteria 5360
160 Ga0436364_0072684 3300037853 Bacteria 11732
161 Ga0436364_0205832 3300037853 Bacteria 4412
162 Ga0436364_0352348 3300037853 Bacteria 5261
163 Ga0436364_0424120 3300037853 Bacteria 16590
164 Ga0436364_0621505 3300037853 Bacteria 4871
165 Ga0436364_0762908 3300037853 Bacteria 1489
166 Ga0436364_0848545 3300037853 Bacteria 5217
167 Ga0436364_1327140 3300037853 Plasmid 4998
168 Ga0436364_1390548 3300037853 Bacteria 46473
169 Ga0436364_1536076 3300037853 Bacteria 7978
170 Ga0242420_011757 3300038996 Bacteria 1474
171 Ga0436365_1033789 3300039437 Bacteria 5553
172 Ga0436365_1056084 3300039437 Unclassified 2334
173 Ga0436365_1415112 3300039437 Bacteria 2650
174 Ga0436361_0107731 3300039447 Bacteria 1288
175 Ga0436361_0496418 3300039447 Bacteria 13437
176 Ga0436361_0786779 3300039447 Bacteria 144856
177 Ga0451798_0129247 3300041458 Bacteria 6065
178 Ga0451800_0653842 3300041459 Bacteria 1502
179 Ga0451802_1237831 3300041460 Bacteria 1384
180 Ga0451804_0230161 3300041463 Bacteria 2630
181 Ga0451841_0741614 3300041498 Bacteria 1203
182 Ga0451849_1131308 3300041505 Bacteria 1286
183 Ga0451855_1518034 3300041511 Bacteria 1408
184 Ga0439431_0019814 3300041997 Bacteria 1602
185 Ga0450919_001689 3300042121 Bacteria 2887
186 Ga0495627_000118 3300046453 Bacteria 99480
187 Ga0495603_0049517 3300046455 Bacteria 2501
188 Ga0495638_0003281 3300046460 Bacteria 12758
189 Ga0495638_0041603 3300046460 Bacteria 2906
190 Ga0495638_0172419 3300046460 Unclassified 1240
191 Ga0495650_0000051 3300046471 Bacteria 318297
192 Ga0495650_0010430 3300046471 Bacteria 5183
193 Ga0495605_0000072 3300046474 Bacteria 133731
194 Ga0495605_0003941 3300046474 Bacteria 8778
195 Ga0495605_0024378 3300046474 Bacteria 3166
196 Ga0495605_0038821 3300046474 Bacteria 2387
197 Ga0495584_0003388 3300046491 Bacteria 8795
198 Ga0495585_0000531 3300046492 Bacteria 36056
199 Ga0495585_0009687 3300046492 Bacteria 5769
200 Ga0495596_0000029 3300046500 Bacteria 103615
201 Ga0495596_0000174 3300046500 Bacteria 44820
202 Ga0495596_0000185 3300046500 Bacteria 43439
203 Ga0495596_0000595 3300046500 Bacteria 22676
204 Ga0495596_0006778 3300046500 Bacteria 5232
205 Ga0495596_0007725 3300046500 Bacteria 4833
206 Ga0495596_0012565 3300046500 Bacteria 3620
207 Ga0495607_0000319 3300046501 Bacteria 50035
208 Ga0495607_0015013 3300046501 Bacteria 5032
209 Ga0495583_0012640 3300046506 Bacteria 4759
210 Ga0495616_0000241 3300046513 Bacteria 44479
211 Ga0495616_0019009 3300046513 Bacteria 3755
212 Ga0495631_0002679 3300046518 Bacteria 9904
213 Ga0495631_0013895 3300046518 Bacteria 3895
214 Ga0495632_0000033 3300046519 Bacteria 164240
215 Ga0495632_0000156 3300046519 Bacteria 70702
216 Ga0495632_0000853 3300046519 Bacteria 26790
217 Ga0495632_0002109 3300046519 Bacteria 15548
218 Ga0495632_0010064 3300046519 Bacteria 5634
219 Ga0495632_0012899 3300046519 Bacteria 4794
220 Ga0495632_0016417 3300046519 Bacteria 4120
221 Ga0495632_0097835 3300046519 Bacteria 1385
222 Ga0495643_0000742 3300046522 Bacteria 37024
223 Ga0495643_0008398 3300046522 Bacteria 6541
224 Ga0495643_0014785 3300046522 Bacteria 4634
225 Ga0495643_0030375 3300046522 Bacteria 3017
226 Ga0495644_0012205 3300046523 Bacteria 3302
227 Ga0495648_0000116 3300046524 Bacteria 98123
228 Ga0495648_0003664 3300046524 Bacteria 13437
229 Ga0495648_0004521 3300046524 Bacteria 11857
230 Ga0495642_0000010 3300046528 Bacteria 136557
231 Ga0495642_0000069 3300046528 Bacteria 61616
232 Ga0495642_0000459 3300046528 Bacteria 21479
233 Ga0495654_0024631 3300046530 Bacteria 3108
234 Ga0495609_0002143 3300046538 Bacteria 12418
235 Ga0495609_0009852 3300046538 Bacteria 4607
236 Ga0495668_0000532 3300046616 Bacteria 47353
237 Ga0495668_0025080 3300046616 Bacteria 3390
238 Ga0495668_0050162 3300046616 Bacteria 2313
239 Ga0495625_0115430 3300046660 Bacteria 1832
240 Ga0495661_0152913 3300046665 Bacteria 1245
241 Ga0495669_0000094 3300046684 Bacteria 57198
242 Ga0495669_0002700 3300046684 Bacteria 7273
243 Ga0495669_0049219 3300046684 Bacteria 1886
244 Ga0495671_0000092 3300046692 Bacteria 85232
245 Ga0495671_0000484 3300046692 Bacteria 30964
246 Ga0495671_0124705 3300046692 Bacteria 1256
247 Ga0495649_0003057 3300046694 Bacteria 11458
248 Ga0495649_0009486 3300046694 Bacteria 5780
249 Ga0495589_0005190 3300046794 Bacteria 6889
250 Ga0495589_0007542 3300046794 Bacteria 5700
251 Ga0495589_0025588 3300046794 Bacteria 2995
252 Ga0495660_0003072 3300046810 Bacteria 10414
253 Ga0495660_0008842 3300046810 Bacteria 5881
254 Ga0495660_0092700 3300046810 Bacteria 1567
255 Ga0495672_0000031 3300047320 Bacteria 298258
256 Ga0495672_0000322 3300047320 Bacteria 63657
257 Ga0495683_0002931 3300047323 Bacteria 10102
258 Ga0495683_0014357 3300047323 Bacteria 4126
259 Ga0495683_0037358 3300047323 Bacteria 2462
260 Ga0495687_000002 3300047443 Bacteria 1085770
261 Ga0495687_007514 3300047443 Bacteria 6404
262 Ga0495677_0005375 3300047445 Bacteria 4860
263 Ga0495677_0042066 3300047445 Bacteria 1673
264 Ga0495681_0043501 3300047470 Bacteria 2165
265 Ga0495686_0000312 3300047472 Bacteria 81912
266 Ga0495686_0050159 3300047472 Bacteria 2623
267 Ga0495626_0001921 3300048091 Bacteria 15459
268 Ga0495626_0003590 3300048091 Bacteria 9872
269 Ga0495626_0011377 3300048091 Bacteria 4710
270 Ga0495626_0011457 3300048091 Bacteria 4689
271 Ga0495626_0014931 3300048091 Bacteria 3986
272 Ga0495626_0018080 3300048091 Bacteria 3547
273 Ga0495626_0043543 3300048091 Bacteria 2105
274 Ga0496108_0047290 3300048911 Bacteria 3597
275 Ga0496109_0155070 3300048912 Bacteria 2145
276 Ga0495678_000218 3300049459 Bacteria 66538
277 Ga0495678_003690 3300049459 Bacteria 9269
278 Ga0495682_0000365 3300049460 Bacteria 32900
279 Ga0495682_0000439 3300049460 Bacteria 29004
280 Ga0501080_0606016 3300049742 Bacteria 972
281 nmdc:mga0k408_24282_c1 3300050493 Bacteria 3427
282 nmdc:mga0k408_5789_c1 3300050493 Bacteria 6580
283 nmdc:mga06z11_72203_c1 3300050494 Bacteria 1829
284 nmdc:mga04h51_7946_c1 3300050495 Bacteria 2822
285 nmdc:mga07m45_61176_c1 3300050496 Bacteria 2133
286 nmdc:mga05p37_198041_c1 3300050507 Bacteria 2435
287 nmdc:mga05p37_53987_c1 3300050507 Bacteria 4944
288 nmdc:mga09592_107475_c1 3300050508 Bacteria 2393
289 nmdc:mga09592_197570_c1 3300050508 Bacteria 1741
290 nmdc:mga06r32_228128_c1 3300050510 Bacteria 1850
291 nmdc:mga06r32_31590_c1 3300050510 Unclassified 4975
292 nmdc:mga08y16_44593_c1 3300050511 Unclassified 4646
293 nmdc:mga0n895_124004_c1 3300050512 Bacteria 2606
294 nmdc:mga0n895_191637_c1 3300050512 Bacteria 2075
295 nmdc:mga0rr50_170255_c1 3300050513 Bacteria 1774
296 Ga0500646_0002184 3300053090 Bacteria 5105
297 Ga0500583_0161286 3300053092 Unclassified 1117
298 Ga0500651_0000649 3300053093 Bacteria 17344
299 Ga0500651_0015349 3300053093 Bacteria 4700
300 Ga0500650_0042318 3300053098 Bacteria 2105
301 Ga0500592_014814 3300053116 Unclassified 1250
302 Ga0500623_120855 3300053127 Unclassified 1148
303 Ga0500628_002074 3300053129 Bacteria 3363
304 Ga0500642_0010100 3300053130 Bacteria 3314
305 Ga0500652_000108 3300053131 Bacteria 32608
306 Ga0500652_000194 3300053131 Bacteria 23543
307 Ga0500655_001485 3300053133 Bacteria 4440
308 Ga0500568_0056739 3300053139 Bacteria 1525
309 Ga0500604_0001250 3300053151 Bacteria 7088
310 Ga0500604_0004900 3300053151 Bacteria 3549
311 Ga0500622_0001458 3300053156 Bacteria 18891
312 Ga0500622_0028521 3300053156 Bacteria 2939
313 Ga0500599_007642 3300053736 Bacteria 1395
314 2588295749 2588253510 Bacteria 6901809
315 2644139647 2643221625 Bacteria 6512927
316 2644244603 2643221644 Bacteria 6865017
317 2644272460 2643221648 Bacteria 6521465
318 Ga0436361_0049533
319 Ga0070676_10001523
320 Ga0070690_100050209
321 Ga0070677_10006581
322 Ga0068869_100001419
323 Ga0070666_10000556
324 Ga0068868_100078479
325 Ga0070660_100242853
326 Ga0070687_100005057
327 Ga0070668_100000760
328 Ga0070669_100003414
329 Ga0070669_100028541
330 Ga0070675_100040291
331 Ga0070675_100167738
332 Ga0070674_100032247
333 Ga0070667_100004847
334 Ga0070711_100116375
335 Ga0070700_100189987
336 Ga0070708_100022894
337 Ga0070662_100004982
338 Ga0068867_100007955
339 Ga0070706_100003746
340 Ga0070706_100008101
341 Ga0070706_100169060
342 Ga0070706_100210897
343 Ga0070707_100568717
344 Ga0070698_100024879
345 Ga0070698_100060778
346 Ga0070698_100062273
347 Ga0070699_100027644
348 Ga0070699_100416160
349 Ga0070697_100017461
350 Ga0068853_100492887
351 Ga0070672_100003647
352 Ga0070693_100002660
353 Ga0070664_100153775
354 Ga0068857_100056723
355 Ga0068852_100016780
356 Ga0068859_100026294
357 Ga0068864_100046951
358 Ga0068866_10000902
359 Ga0068861_100004108
360 Ga0068863_100000783
361 Ga0068858_100001938
362 Ga0068860_100009197
363 Ga0068862_100095590
364 Ga0081455_10003228
365 Ga0081455_10183660
366 Ga0070717_10115756
367 Ga0075368_10014088
368 Ga0075363_100005656
369 Ga0075363_100045977
370 Ga0075432_10062039
371 Ga0070716_100001938
372 Ga0070712_100006270
373 Ga0075367_10029376
374 Ga0075367_10053011
375 Ga0075366_10000186
376 Ga0075366_10054434
377 Ga0075366_10076281
378 Ga0075370_10021966
379 Ga0075370_10059697
380 Ga0075428_100184320
381 Ga0075428_100264042
382 Ga0075428_100480191
383 Ga0075430_100112415
384 Ga0075431_100228183
385 Ga0075431_100372671
386 Ga0075431_100456739
387 Ga0075433_10022283
388 Ga0075433_10116782
389 Ga0075434_100261819
390 Ga0075429_100071148
391 Ga0075429_100091596
392 Ga0075429_100107787
393 Ga0068865_100001184
394 Ga0097620_100026294
395 Ga0075435_100242129
396 Ga0099794_10021720
397 Ga0099794_10046951
398 Ga0105240_10005075
399 Ga0111539_10008067
400 Ga0105245_10413966
401 Ga0114129_10211625
402 Ga0114129_10240108
403 Ga0105243_10057080
404 Ga0105242_10004790
405 Ga0105248_10015826
406 Ga0105237_10006162
407 Ga0105237_10092009
408 Ga0105249_10006557
409 Ga0105249_10083783
410 Ga0105249_10259727
411 Ga0105239_10000839
412 Ga0105239_10192904
413 Ga0163162_10018958
414 Ga0157375_10005405
415 Ga0157380_10004783
416 Ga0157379_10007030
417 Ga0157376_10146080
418 Ga0163161_10004265
419 Ga0213872_10000480
420 Ga0213872_10004215
421 Ga0213872_10023756
422 Ga0213875_10001452
423 Ga0213875_10005521
424 Ga0213875_10009531
425 Ga0213871_10004799
426 Ga0207682_10001293
427 Ga0207642_10001208
428 Ga0207680_10007698
429 Ga0207645_10000991
430 Ga0207684_10000828
431 Ga0207684_10006278
432 Ga0207684_10023604
433 Ga0207695_10021849
434 Ga0207671_10032329
435 Ga0207693_10017285
436 Ga0207662_10070190
437 Ga0207646_10012143
438 Ga0207646_10249433
439 Ga0207681_10002446
440 Ga0207681_10127028
441 Ga0207650_10200395
442 Ga0207659_10006201
443 Ga0207706_10002990
444 Ga0207709_10021356
445 Ga0207669_10001042
446 Ga0207704_10000481
447 Ga0207665_10009157
448 Ga0207691_10005915
449 Ga0207711_10124381
450 Ga0207689_10001694
451 Ga0207679_10160067
452 Ga0207712_10025923
453 Ga0207712_10062268
454 Ga0207668_10008134
455 Ga0207658_10000803
456 Ga0207677_10018398
457 Ga0207703_10000414
458 Ga0207708_10047024
459 Ga0207641_10004330
460 Ga0207648_10023230
461 Ga0207676_10009499
462 Ga0207674_10095926
463 Ga0207675_100001498
464 Ga0207683_10146453
465 Ga0207698_10012806
466 Ga0209588_1020737
467 Ga0207428_10025799
468 Ga0207428_10341496
469 Ga0268265_10009864
470 Ga0268264_10002739
471 Ga0307517_10000970
472 Ga0307515_10000821
473 Ga0307515_10250184
474 Ga0307509_10083525
475 Ga0307516_10112872
476 Ga0307414_10010588
477 Ga0436364_0072684
478 Ga0436364_0205832
479 Ga0436364_0352348
480 Ga0436364_0424120
481 Ga0436364_0621505
482 Ga0436364_0762908
483 Ga0436364_0848545
484 Ga0436364_1327140
485 Ga0436364_1390548
486 Ga0436364_1536076
487 Ga0242420_011757
488 Ga0436365_1033789
489 Ga0436365_1056084
490 Ga0436365_1415112
491 Ga0436361_0107731
492 Ga0436361_0496418
493 Ga0436361_0786779
494 Ga0451798_0129247
495 Ga0451800_0653842
496 Ga0451802_1237831
497 Ga0451804_0230161
498 Ga0451841_0741614
499 Ga0451849_1131308
500 Ga0451855_1518034
501 Ga0439431_0019814
502 Ga0450919_001689
503 Ga0495627_000118
504 Ga0495603_0049517
505 Ga0495638_0003281
506 Ga0495638_0041603
507 Ga0495638_0172419
508 Ga0495650_0000051
509 Ga0495650_0010430
510 Ga0495605_0000072
511 Ga0495605_0003941
512 Ga0495605_0024378
513 Ga0495605_0038821
514 Ga0495584_0003388
515 Ga0495585_0000531
516 Ga0495585_0009687
517 Ga0495596_0000029
518 Ga0495596_0000174
519 Ga0495596_0000185
520 Ga0495596_0000595
521 Ga0495596_0006778
522 Ga0495596_0007725
523 Ga0495596_0012565
524 Ga0495607_0000319
525 Ga0495607_0015013
526 Ga0495583_0012640
527 Ga0495616_0000241
528 Ga0495616_0019009
529 Ga0495631_0002679
530 Ga0495631_0013895
531 Ga0495632_0000033
532 Ga0495632_0000156
533 Ga0495632_0000853
534 Ga0495632_0002109
535 Ga0495632_0010064
536 Ga0495632_0012899
537 Ga0495632_0016417
538 Ga0495632_0097835
539 Ga0495643_0000742
540 Ga0495643_0008398
541 Ga0495643_0014785
542 Ga0495643_0030375
543 Ga0495644_0012205
544 Ga0495648_0000116
545 Ga0495648_0003664
546 Ga0495648_0004521
547 Ga0495642_0000010
548 Ga0495642_0000069
549 Ga0495642_0000459
550 Ga0495654_0024631
551 Ga0495609_0002143
552 Ga0495609_0009852
553 Ga0495668_0000532
554 Ga0495668_0025080
555 Ga0495668_0050162
556 Ga0495625_0115430
557 Ga0495661_0152913
558 Ga0495669_0000094
559 Ga0495669_0002700
560 Ga0495669_0049219
561 Ga0495671_0000092
562 Ga0495671_0000484
563 Ga0495671_0124705
564 Ga0495649_0003057
565 Ga0495649_0009486
566 Ga0495589_0005190
567 Ga0495589_0007542
568 Ga0495589_0025588
569 Ga0495660_0003072
570 Ga0495660_0008842
571 Ga0495660_0092700
572 Ga0495672_0000031
573 Ga0495672_0000322
574 Ga0495683_0002931
575 Ga0495683_0014357
576 Ga0495683_0037358
577 Ga0495687_000002
578 Ga0495687_007514
579 Ga0495677_0005375
580 Ga0495677_0042066
581 Ga0495681_0043501
582 Ga0495686_0000312
583 Ga0495686_0050159
584 Ga0495626_0001921
585 Ga0495626_0003590
586 Ga0495626_0011377
587 Ga0495626_0011457
588 Ga0495626_0014931
589 Ga0495626_0018080
590 Ga0495626_0043543
591 Ga0496108_0047290
592 Ga0496109_0155070
593 Ga0495678_000218
594 Ga0495678_003690
595 Ga0495682_0000365
596 Ga0495682_0000439
597 Ga0501080_0606016
598 nmdc:mga0k408_24282_c1
599 nmdc:mga0k408_5789_c1
600 nmdc:mga06z11_72203_c1
601 nmdc:mga04h51_7946_c1
602 nmdc:mga07m45_61176_c1
603 nmdc:mga05p37_198041_c1
604 nmdc:mga05p37_53987_c1
605 nmdc:mga09592_107475_c1
606 nmdc:mga09592_197570_c1
607 nmdc:mga06r32_228128_c1
608 nmdc:mga06r32_31590_c1
609 nmdc:mga08y16_44593_c1
610 nmdc:mga0n895_124004_c1
611 nmdc:mga0n895_191637_c1
612 nmdc:mga0rr50_170255_c1
613 Ga0500646_0002184
614 Ga0500583_0161286
615 Ga0500651_0000649
616 Ga0500651_0015349
617 Ga0500650_0042318
618 Ga0500592_014814
619 Ga0500623_120855
620 Ga0500628_002074
621 Ga0500642_0010100
622 Ga0500652_000108
623 Ga0500652_000194
624 Ga0500655_001485
625 Ga0500568_0056739
626 Ga0500604_0001250
627 Ga0500604_0004900
628 Ga0500622_0001458
629 Ga0500622_0028521
630 Ga0500599_007642
631 2588295749
632 2644139647
633 2644244603
634 2644272460

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

166

288

0.92

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

36

126

0.84

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

198

331

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gaz-assembly1.cif.gz_B crystal structure of an alcohol dehydrogenase superfamily protein from novosphingobium aromaticivorans 0.8789 1 309
1yb5-assembly1.cif.gz_A crystal structure of human zeta-crystallin with bound nadp 0.8738 1 306
3fbg-assembly1.cif.gz_A crystal structure of a putative arginate lyase from staphylococcus haemolyticus 0.8688 2 307
2eih-assembly1.cif.gz_A crystal structure of nad-dependent alcohol dehydrogenase 0.8649 1 309
4j6f-assembly1.cif.gz_B crystal structure of putative alcohol dehydrogenase from sinorhizobium meliloti 1021, nysgrc-target 012230 0.8543 1 309
ID Description Score Start End Superfamily
af_I1LVH0_49_172_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.919 2 125 3.90.180.10
af_O45496_9_126_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.917 1 125 3.90.180.10
af_P28304_1_127_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9158 2 125 3.90.180.10
4a27B01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.912 1 125 3.90.180.10
af_A0A0R0I1N1_1_153_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9107 2 141 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A4Q3N5Q4-F1-model_v4 deleted 0.9924 1 108
AF-A0A6J4MY61-F1-model_v4 Quinone oxidoreductase (EC 1.6.5.5) 0.9885 1 136 GO:0003960
AF-A0A4Q3N5Q4-F1-model_v4 deleted 0.9745 1 108
AF-A0A2V9QB22-F1-model_v4 Alcohol dehydrogenase-like N-terminal domain-containing protein 0.9639 17 176
AF-A0A6J4MY61-F1-model_v4 Quinone oxidoreductase (EC 1.6.5.5) 0.9537 1 136 GO:0003960

Map