F404167

General Info

Members Datasets Scaffolds Average Seq Length
317 194 317 81

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_11403355|Ga0157376_114033551
Length 92
Sequence MFGVSPAQEASMSYQPRHGFTGPSELYTSSAMPPLSLRQRLAVMWAVWRERTEMRRSLAQMDARSLRDAGISPAAAAYESGKPFWERVGCLR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
89 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
135 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
136 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
137 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
138 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
139 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
140 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
141 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
154 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
157 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
158 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
159 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
160 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
175 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
178 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
184 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
185 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
186 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
187 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
188 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
189 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
190 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
191 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
192 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 1.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.55
Nodule 0
Rhizoplane 0.95
Rhizosphere 72.87
Stem 0
Stem Tuber 0
Unclassified 0.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10042148 3300003203 Bacteria 1600
2 Ga0070658_10045503 3300005327 Bacteria 3549
3 Ga0070676_10458286 3300005328 Bacteria 898
4 Ga0070683_100639494 3300005329 Bacteria 1018
5 Ga0070670_101125029 3300005331 Bacteria 716
6 Ga0068869_101075407 3300005334 Unclassified 703
7 Ga0070680_100001241 3300005336 Bacteria 18376
8 Ga0070660_100448028 3300005339 Bacteria 1071
9 Ga0070689_100259909 3300005340 Unclassified 1435
10 Ga0070689_100263217 3300005340 Bacteria 1426
11 Ga0070691_10007631 3300005341 Bacteria 4958
12 Ga0070691_10057509 3300005341 Bacteria 1866
13 Ga0070661_100039838 3300005344 Bacteria 3425
14 Ga0070675_100265006 3300005354 Bacteria 1506
15 Ga0070674_100850788 3300005356 Bacteria 791
16 Ga0070673_101139951 3300005364 Bacteria 729
17 Ga0070673_101880423 3300005364 Bacteria 567
18 Ga0070688_100807913 3300005365 Bacteria 734
19 Ga0070659_100167619 3300005366 Bacteria 1798
20 Ga0070667_101719552 3300005367 Bacteria 590
21 Ga0070701_10695802 3300005438 Unclassified 683
22 Ga0070701_11106736 3300005438 Bacteria 558
23 Ga0070708_100056335 3300005445 Bacteria 3496
24 Ga0070681_10003085 3300005458 Bacteria 15467
25 Ga0070681_10596898 3300005458 Bacteria 1018
26 Ga0070681_10866618 3300005458 Archaea 821
27 Ga0070681_11010744 3300005458 Bacteria 751
28 Ga0068867_101846508 3300005459 Unclassified 569
29 Ga0070685_10412205 3300005466 Bacteria 938
30 Ga0070685_10447521 3300005466 Bacteria 904
31 Ga0070706_100025293 3300005467 Bacteria 5463
32 Ga0070707_100612116 3300005468 Bacteria 1052
33 Ga0070698_100001208 3300005471 Bacteria 28691
34 Ga0070699_100156522 3300005518 Bacteria 2016
35 Ga0070679_100023728 3300005530 Bacteria 6010
36 Ga0070684_100040638 3300005535 Bacteria 4006
37 Ga0068853_100564944 3300005539 Bacteria 1078
38 Ga0070665_100008704 3300005548 Bacteria 10271
39 Ga0070665_100203508 3300005548 Bacteria 1980
40 Ga0070665_100540960 3300005548 Bacteria 1177
41 Ga0070665_101828708 3300005548 Bacteria 614
42 Ga0070665_101871439 3300005548 Bacteria 606
43 Ga0068855_100017273 3300005563 Bacteria 8684
44 Ga0068855_100234363 3300005563 Bacteria 2053
45 Ga0068855_102147393 3300005563 Unclassified 561
46 Ga0070664_100892206 3300005564 Bacteria 833
47 Ga0068857_100041540 3300005577 Bacteria 4078
48 Ga0068857_100276874 3300005577 Bacteria 1543
49 Ga0068857_101471614 3300005577 Bacteria 663
50 Ga0068854_100641654 3300005578 Bacteria 911
51 Ga0068856_100288737 3300005614 Bacteria 1657
52 Ga0068856_100359964 3300005614 Bacteria 1473
53 Ga0070702_101594194 3300005615 Unclassified 540
54 Ga0068852_102494654 3300005616 Unclassified 537
55 Ga0068859_100122431 3300005617 Bacteria 2668
56 Ga0068859_101311619 3300005617 Bacteria 798
57 Ga0068861_101526950 3300005719 Bacteria 656
58 Ga0068851_10180493 3300005834 Bacteria 1169
59 Ga0068851_10856815 3300005834 Bacteria 567
60 Ga0068858_100557382 3300005842 Bacteria 1110
61 Ga0068858_102247028 3300005842 Unclassified 539
62 Ga0068862_100563640 3300005844 Bacteria 1089
63 Ga0068862_100762779 3300005844 Bacteria 942
64 Ga0081455_10001706 3300005937 Bacteria 26586
65 Ga0081455_10018608 3300005937 Bacteria 6604
66 Ga0081455_10641037 3300005937 Bacteria 686
67 Ga0081539_10001294 3300005985 Bacteria 43916
68 Ga0075365_10054758 3300006038 Bacteria 2646
69 Ga0075365_10095809 3300006038 Bacteria 2027
70 Ga0075365_10152195 3300006038 Bacteria 1609
71 Ga0075365_10177330 3300006038 Bacteria 1489
72 Ga0075365_10381451 3300006038 Bacteria 994
73 Ga0075365_10577241 3300006038 Bacteria 795
74 Ga0075365_10729853 3300006038 Bacteria 700
75 Ga0075365_10927605 3300006038 Unclassified 614
76 Ga0075365_11081519 3300006038 Unclassified 565
77 Ga0075368_10053094 3300006042 Bacteria 1613
78 Ga0075368_10064505 3300006042 Bacteria 1471
79 Ga0075368_10125049 3300006042 Bacteria 1067
80 Ga0075363_100469476 3300006048 Unclassified 745
81 Ga0075363_100581070 3300006048 Bacteria 670
82 Ga0075364_10311557 3300006051 Bacteria 1072
83 Ga0075364_10732094 3300006051 Bacteria 675
84 Ga0075362_10056113 3300006177 Bacteria 1772
85 Ga0075362_10076569 3300006177 Bacteria 1536
86 Ga0075362_10189819 3300006177 Bacteria 998
87 Ga0075367_10017903 3300006178 Bacteria 3898
88 Ga0075367_10133243 3300006178 Bacteria 1537
89 Ga0075367_10232828 3300006178 Bacteria 1153
90 Ga0075367_10364990 3300006178 Bacteria 912
91 Ga0075369_10005835 3300006186 Bacteria 4627
92 Ga0075369_10015859 3300006186 Bacteria 3031
93 Ga0075366_10064769 3300006195 Bacteria 2174
94 Ga0075366_10077487 3300006195 Bacteria 1984
95 Ga0075366_10080732 3300006195 Bacteria 1942
96 Ga0075366_10138887 3300006195 Bacteria 1468
97 Ga0075366_10286719 3300006195 Bacteria 1007
98 Ga0097621_101036926 3300006237 Unclassified 768
99 Ga0075370_10042811 3300006353 Bacteria 2558
100 Ga0075370_10077550 3300006353 Bacteria 1907
101 Ga0075370_10138396 3300006353 Bacteria 1423
102 Ga0068865_100293655 3300006881 Bacteria 1298
103 Ga0068865_100298623 3300006881 Bacteria 1288
104 Ga0097620_100122431 3300006931 Bacteria 2668
105 Ga0097620_101311746 3300006931 Bacteria 798
106 Ga0099794_10037493 3300007265 Bacteria 2295
107 Ga0099794_10335219 3300007265 Bacteria 786
108 Ga0099795_10546051 3300007788 Unclassified 546
109 Ga0105240_10015907 3300009093 Bacteria 10206
110 Ga0105240_10102262 3300009093 Bacteria 3483
111 Ga0105240_10359612 3300009093 Bacteria 1649
112 Ga0111539_10676374 3300009094 Bacteria 1202
113 Ga0105245_10916269 3300009098 Bacteria 918
114 Ga0105245_11307245 3300009098 Unclassified 774
115 Ga0105245_12295918 3300009098 Unclassified 593
116 Ga0105247_10447934 3300009101 Bacteria 930
117 Ga0105243_10803458 3300009148 Bacteria 927
118 Ga0105241_10282377 3300009174 Bacteria 1418
119 Ga0105242_12012201 3300009176 Unclassified 620
120 Ga0105248_11594622 3300009177 Bacteria 739
121 Ga0105248_12320986 3300009177 Unclassified 611
122 Ga0105237_11995717 3300009545 Archaea 589
123 Ga0105238_10056422 3300009551 Bacteria 3941
124 Ga0105238_11048673 3300009551 Unclassified 837
125 Ga0105249_12654523 3300009553 Unclassified 573
126 Ga0105028_124652 3300009993 Bacteria 662
127 Ga0105239_10883877 3300010375 Bacteria 1025
128 Ga0105239_11628109 3300010375 Unclassified 747
129 Ga0105246_10213837 3300011119 Bacteria 1507
130 Ga0157373_10119896 3300013100 Bacteria 1849
131 Ga0157370_10168180 3300013104 Bacteria 2038
132 Ga0157369_10142949 3300013105 Bacteria 2531
133 Ga0157374_11495496 3300013296 Archaea 698
134 Ga0157378_13129222 3300013297 Unclassified 514
135 Ga0163162_11474058 3300013306 Bacteria 775
136 Ga0157372_12269693 3300013307 Bacteria 623
137 Ga0157372_12409762 3300013307 Unclassified 604
138 Ga0157372_12525393 3300013307 Archaea 590
139 Ga0157372_13168968 3300013307 Unclassified 525
140 Ga0182008_10409812 3300014497 Unclassified 730
141 Ga0157379_10717378 3300014968 Bacteria 939
142 Ga0157376_10625840 3300014969 Unclassified 1074
143 Ga0157376_11403355 3300014969 Unclassified 730
144 Ga0157376_11894971 3300014969 Bacteria 633
145 Ga0197907_10074666 3300020069 Bacteria 574
146 Ga0206356_10270514 3300020070 Unclassified 541
147 Ga0206354_11230951 3300020081 Archaea 649
148 Ga0206353_11253160 3300020082 Bacteria 1128
149 Ga0213872_10021095 3300021361 Bacteria 3000
150 Ga0213871_10009838 3300021441 Bacteria 2153
151 Ga0224712_10233400 3300022467 Unclassified 845
152 Ga0207426_1022042 3300025302 Bacteria 2192
153 Ga0207697_10081025 3300025315 Bacteria 1368
154 Ga0207656_10573761 3300025321 Archaea 575
155 Ga0207710_10229700 3300025900 Bacteria 923
156 Ga0207688_10376413 3300025901 Bacteria 878
157 Ga0207647_10118477 3300025904 Bacteria 1562
158 Ga0207645_10120830 3300025907 Bacteria 1700
159 Ga0207705_10013851 3300025909 Bacteria 5814
160 Ga0207684_10129217 3300025910 Bacteria 2168
161 Ga0207707_10027217 3300025912 Bacteria 5000
162 Ga0207707_10137952 3300025912 Bacteria 2132
163 Ga0207707_10816836 3300025912 Bacteria 776
164 Ga0207707_11610939 3300025912 Bacteria 511
165 Ga0207695_10031242 3300025913 Bacteria 5845
166 Ga0207695_10167532 3300025913 Bacteria 2124
167 Ga0207660_10137179 3300025917 Bacteria 1867
168 Ga0207660_10484875 3300025917 Archaea 1002
169 Ga0207657_10156849 3300025919 Bacteria 1851
170 Ga0207657_10641824 3300025919 Unclassified 827
171 Ga0207649_10166772 3300025920 Bacteria 1530
172 Ga0207652_10121688 3300025921 Bacteria 2322
173 Ga0207646_10078850 3300025922 Bacteria 2944
174 Ga0207681_10318137 3300025923 Bacteria 1237
175 Ga0207694_10059748 3300025924 Bacteria 2966
176 Ga0207650_10133713 3300025925 Bacteria 1943
177 Ga0207650_11374932 3300025925 Unclassified 601
178 Ga0207659_10538476 3300025926 Bacteria 991
179 Ga0207687_10572691 3300025927 Bacteria 949
180 Ga0207690_10875860 3300025932 Archaea 744
181 Ga0207669_10195983 3300025937 Bacteria 1462
182 Ga0207661_11342919 3300025944 Archaea 656
183 Ga0207679_10370686 3300025945 Bacteria 1253
184 Ga0207667_10041746 3300025949 Bacteria 4878
185 Ga0207667_10342395 3300025949 Bacteria 1526
186 Ga0207651_10668837 3300025960 Unclassified 913
187 Ga0207651_10949400 3300025960 Bacteria 767
188 Ga0207640_11312790 3300025981 Bacteria 646
189 Ga0207677_11639183 3300026023 Unclassified 596
190 Ga0207639_10221169 3300026041 Bacteria 1635
191 Ga0207708_10499597 3300026075 Bacteria 1019
192 Ga0207702_10177453 3300026078 Bacteria 1959
193 Ga0207702_10519627 3300026078 Bacteria 1162
194 Ga0207648_12020874 3300026089 Unclassified 538
195 Ga0207674_10026439 3300026116 Bacteria 6163
196 Ga0207674_10140734 3300026116 Bacteria 2372
197 Ga0207674_10652222 3300026116 Bacteria 1016
198 Ga0207698_11292393 3300026142 Archaea 744
199 Ga0207428_10275178 3300027907 Bacteria 1251
200 Ga0268266_10006545 3300028379 Bacteria 10659
201 Ga0268266_10152629 3300028379 Bacteria 2083
202 Ga0268266_10448558 3300028379 Bacteria 1226
203 Ga0268266_11234510 3300028379 Unclassified 723
204 Ga0268266_11861693 3300028379 Bacteria 576
205 Ga0268265_11189049 3300028380 Bacteria 760
206 Ga0268265_11460486 3300028380 Unclassified 687
207 Ga0268265_11807775 3300028380 Unclassified 617
208 Ga0265332_10279176 3300031238 Unclassified 690
209 Ga0265332_10304342 3300031238 Bacteria 658
210 Ga0265325_10125519 3300031241 Bacteria 1234
211 Ga0265331_10080081 3300031250 Bacteria 1519
212 Ga0265316_10510965 3300031344 Bacteria 858
213 Ga0265314_10580198 3300031711 Unclassified 580
214 Ga0307411_10545095 3300032005 Bacteria 989
215 Ga0373930_0143299 3300034816 Bacteria 595
216 Ga0373928_0178761 3300035084 Unclassified 602
217 Ga0373934_0090837 3300035086 Bacteria 1231
218 Ga0373940_0279340 3300035088 Unclassified 570
219 Ga0373932_0074821 3300035112 Bacteria 1058
220 Ga0373939_0398510 3300035114 Unclassified 570
221 Ga0373941_0095971 3300035115 Bacteria 1025
222 Ga0373961_0315929 3300035241 Unclassified 581
223 Ga0373931_0084610 3300035691 Bacteria 1757
224 Ga0373927_0156311 3300035695 Bacteria 1494
225 Ga0373933_0241453 3300035724 Bacteria 1162
226 Ga0373937_0123180 3300036401 Bacteria 2417
227 Ga0373937_0829647 3300036401 Unclassified 873
228 Ga0373925_1010362 3300037068 Bacteria 685
229 Ga0395899_0038719 3300037312 Bacteria 3570
230 Ga0395899_0046489 3300037312 Bacteria 3233
231 Ga0395899_0069432 3300037312 Bacteria 2580
232 Ga0395900_0191298 3300037418 Bacteria 2075
233 Ga0395900_0271450 3300037418 Bacteria 1690
234 Ga0395900_1089684 3300037418 Bacteria 716
235 Ga0395898_0177693 3300037466 Bacteria 2034
236 Ga0395905_1363495 3300037471 Unclassified 613
237 Ga0395901_0001004 3300038443 Bacteria 30516
238 Ga0395901_0057519 3300038443 Bacteria 4044
239 Ga0395901_0106386 3300038443 Bacteria 2944
240 Ga0436365_0957444 3300039437 Bacteria 975
241 Ga0436360_0041678 3300039438 Unclassified 948
242 Ga0436360_0048664 3300039438 Bacteria 3795
243 Ga0436361_0705189 3300039447 Bacteria 5316
244 Ga0436362_1069785 3300039453 Bacteria 2222
245 Ga0436362_1275183 3300039453 Bacteria 730
246 Ga0451789_0991220 3300041443 Unclassified 858
247 Ga0451791_0896702 3300041451 Unclassified 893
248 Ga0451807_0841591 3300041486 Unclassified 763
249 Ga0451833_1261752 3300041491 Bacteria 719
250 Ga0439458_0023025 3300042157 Bacteria 1451
251 Ga0466963_0056364 3300044694 Bacteria 2615
252 Ga0466964_0753221 3300044706 Unclassified 547
253 Ga0466957_0221113 3300044842 Bacteria 1250
254 Ga0466967_0753899 3300045976 Unclassified 965
255 Ga0495675_0760616 3300047444 Unclassified 539
256 Ga0501034_0001445 3300049571 Bacteria 31511
257 Ga0501034_0004609 3300049571 Bacteria 15277
258 Ga0501034_0409998 3300049571 Unclassified 1277
259 Ga0501034_0516064 3300049571 Bacteria 1107
260 Ga0501043_0314221 3300049579 Bacteria 1195
261 Ga0501046_0076488 3300049580 Bacteria 2593
262 Ga0501047_0368113 3300049581 Bacteria 1272
263 Ga0501068_0020664 3300049584 Bacteria 3839
264 Ga0501070_0181279 3300049586 Bacteria 1733
265 Ga0501070_0181738 3300049586 Bacteria 1731
266 Ga0501083_0485677 3300049744 Unclassified 804
267 Ga0501044_0008008 3300049823 Bacteria 11614
268 Ga0501044_1017269 3300049823 Unclassified 700
269 nmdc:mga03683_129650_c1 3300050489 Bacteria 1127
270 nmdc:mga03683_1326_c3 3300050489 Bacteria 1896
271 nmdc:mga03683_264157_c1 3300050489 Bacteria 802
272 nmdc:mga03683_307638_c1 3300050489 Bacteria 744
273 nmdc:mga03683_638767_c1 3300050489 Unclassified 523
274 nmdc:mga03683_79543_c1 3300050489 Bacteria 1413
275 nmdc:mga03683_96962_c1 3300050489 Unclassified 1292
276 nmdc:mga03n38_257252_c1 3300050490 Bacteria 924
277 nmdc:mga03n38_427683_c1 3300050490 Bacteria 733
278 nmdc:mga00v17_249254_c1 3300050491 Bacteria 1151
279 nmdc:mga00v17_576800_c1 3300050491 Bacteria 726
280 nmdc:mga00v17_864596_c1 3300050491 Unclassified 574
281 nmdc:mga0yw44_114792_c1 3300050492 Bacteria 1729
282 nmdc:mga0yw44_134164_c1 3300050492 Bacteria 1605
283 nmdc:mga0yw44_13422_c1 3300050492 Bacteria 4314
284 nmdc:mga0yw44_196439_c2 3300050492 Unclassified 532
285 nmdc:mga0yw44_220108_c1 3300050492 Bacteria 1258
286 nmdc:mga0yw44_229090_c1 3300050492 Bacteria 1233
287 nmdc:mga0yw44_865620_c1 3300050492 Unclassified 613
288 nmdc:mga0yw44_985965_c1 3300050492 Bacteria 570
289 nmdc:mga0k408_236404_c1 3300050493 Bacteria 1091
290 nmdc:mga0k408_51799_c1 3300050493 Bacteria 2378
291 nmdc:mga0k408_73480_c1 3300050493 Bacteria 1997
292 nmdc:mga0k408_78215_c1 3300050493 Bacteria 1934
293 nmdc:mga06z11_13450_c1 3300050494 Bacteria 3594
294 nmdc:mga06z11_304571_c1 3300050494 Bacteria 948
295 nmdc:mga06z11_901337_c1 3300050494 Unclassified 539
296 nmdc:mga04h51_180099_c1 3300050495 Bacteria 822
297 nmdc:mga07m45_32923_c1 3300050496 Bacteria 2876
298 nmdc:mga07m45_892094_c1 3300050496 Unclassified 509
299 nmdc:mga08y16_543668_c1 3300050511 Bacteria 1176
300 nmdc:mga08y16_715120_c1 3300050511 Bacteria 1000
301 nmdc:mga0sz30_75875_c1 3300050516 Bacteria 1451
302 nmdc:mga0sz30_77_c1 3300050516 Bacteria 37634
303 Ga0500578_0653904 3300053086 Bacteria 571
304 Ga0500643_065529 3300053087 Bacteria 1014
305 Ga0500643_137002 3300053087 Unclassified 658
306 Ga0500644_0010230 3300053088 Bacteria 2533
307 Ga0500644_0261617 3300053088 Bacteria 732
308 Ga0500647_0022657 3300053091 Bacteria 2941
309 Ga0500583_0588846 3300053092 Bacteria 513
310 Ga0500651_0017479 3300053093 Bacteria 4426
311 Ga0500651_0514290 3300053093 Unclassified 659
312 Ga0500651_0529645 3300053093 Bacteria 647
313 Ga0500650_0208643 3300053098 Bacteria 888
314 Ga0500595_120430 3300053119 Unclassified 742
315 Ga0500577_0282846 3300053142 Unclassified 723
316 Ga0500616_0004217 3300053153 Bacteria 10358
317 Ga0500552_022064 3300053733 Bacteria 916

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053733 Ga0500552_022064 Ga0500552_022064_348_605 77
2 3300039437 Ga0436365_0957444 Ga0436365_0957444_294_530 78
3 3300005458 Ga0070681_10596898 Ga0070681_105968982 79
4 3300005548 Ga0070665_101871439 Ga0070665_1018714391 79
5 3300005577 Ga0068857_100041540 Ga0068857_1000415402 79
6 3300005937 Ga0081455_10001706 Ga0081455_100017066 79
7 3300006038 Ga0075365_10577241 Ga0075365_105772412 79
8 3300006048 Ga0075363_100581070 Ga0075363_1005810702 79
9 3300006051 Ga0075364_10311557 Ga0075364_103115572 79
10 3300006195 Ga0075366_10138887 Ga0075366_101388872 79
11 3300009098 Ga0105245_10916269 Ga0105245_109162692 79
12 3300025912 Ga0207707_11610939 Ga0207707_116109391 79
13 3300025949 Ga0207667_10342395 Ga0207667_103423952 79
14 3300026116 Ga0207674_10026439 Ga0207674_100264392 79
15 3300028379 Ga0268266_11234510 Ga0268266_112345102 79
16 3300035115 Ga0373941_0095971 Ga0373941_0095971_764_1003 79
17 3300050490 nmdc:mga03n38_257252_c1 nmdc:mga03n38_257252_c1_641_904 79
18 3300005327 Ga0070658_10045503 Ga0070658_100455033 80
19 3300005329 Ga0070683_100639494 Ga0070683_1006394941 80
20 3300005336 Ga0070680_100001241 Ga0070680_10000124112 80
21 3300005339 Ga0070660_100448028 Ga0070660_1004480282 80
22 3300005340 Ga0070689_100259909 Ga0070689_1002599093 80
23 3300005340 Ga0070689_100263217 Ga0070689_1002632171 80
24 3300005341 Ga0070691_10007631 Ga0070691_100076314 80
25 3300005341 Ga0070691_10057509 Ga0070691_100575092 80
26 3300005344 Ga0070661_100039838 Ga0070661_1000398383 80
27 3300005354 Ga0070675_100265006 Ga0070675_1002650062 80
28 3300005356 Ga0070674_100850788 Ga0070674_1008507881 80
29 3300005364 Ga0070673_101880423 Ga0070673_1018804232 80
30 3300005366 Ga0070659_100167619 Ga0070659_1001676193 80
31 3300005438 Ga0070701_10695802 Ga0070701_106958021 80
32 3300005458 Ga0070681_10003085 Ga0070681_100030857 80
33 3300005458 Ga0070681_10866618 Ga0070681_108666181 80
34 3300005458 Ga0070681_11010744 Ga0070681_110107441 80
35 3300005466 Ga0070685_10447521 Ga0070685_104475211 80
36 3300005530 Ga0070679_100023728 Ga0070679_1000237283 80
37 3300005535 Ga0070684_100040638 Ga0070684_1000406381 80
38 3300005539 Ga0068853_100564944 Ga0068853_1005649442 80
39 3300005548 Ga0070665_100203508 Ga0070665_1002035082 80
40 3300005563 Ga0068855_100017273 Ga0068855_1000172735 80
41 3300005563 Ga0068855_100234363 Ga0068855_1002343633 80
42 3300005563 Ga0068855_102147393 Ga0068855_1021473931 80
43 3300005564 Ga0070664_100892206 Ga0070664_1008922062 80
44 3300005577 Ga0068857_100276874 Ga0068857_1002768743 80
45 3300005577 Ga0068857_101471614 Ga0068857_1014716141 80
46 3300005578 Ga0068854_100641654 Ga0068854_1006416542 80
47 3300005614 Ga0068856_100288737 Ga0068856_1002887373 80
48 3300005614 Ga0068856_100359964 Ga0068856_1003599642 80
49 3300005615 Ga0070702_101594194 Ga0070702_1015941941 80
50 3300005617 Ga0068859_100122431 Ga0068859_1001224313 80
51 3300005834 Ga0068851_10180493 Ga0068851_101804932 80
52 3300005844 Ga0068862_100762779 Ga0068862_1007627792 80
53 3300006038 Ga0075365_10095809 Ga0075365_100958092 80
54 3300006038 Ga0075365_10927605 Ga0075365_109276052 80
55 3300006042 Ga0075368_10125049 Ga0075368_101250492 80
56 3300006178 Ga0075367_10017903 Ga0075367_100179033 80
57 3300006195 Ga0075366_10077487 Ga0075366_100774872 80
58 3300006353 Ga0075370_10138396 Ga0075370_101383962 80
59 3300006881 Ga0068865_100293655 Ga0068865_1002936552 80
60 3300006881 Ga0068865_100298623 Ga0068865_1002986232 80
61 3300006931 Ga0097620_100122431 Ga0097620_1001224313 80
62 3300009093 Ga0105240_10015907 Ga0105240_100159072 80
63 3300009093 Ga0105240_10102262 Ga0105240_101022624 80
64 3300009093 Ga0105240_10359612 Ga0105240_103596123 80
65 3300009098 Ga0105245_11307245 Ga0105245_113072452 80
66 3300009174 Ga0105241_10282377 Ga0105241_102823772 80
67 3300009545 Ga0105237_11995717 Ga0105237_119957172 80
68 3300009551 Ga0105238_10056422 Ga0105238_100564222 80
69 3300009551 Ga0105238_11048673 Ga0105238_110486732 80
70 3300009553 Ga0105249_12654523 Ga0105249_126545231 80
71 3300010375 Ga0105239_10883877 Ga0105239_108838771 80
72 3300013100 Ga0157373_10119896 Ga0157373_101198962 80
73 3300013104 Ga0157370_10168180 Ga0157370_101681802 80
74 3300013105 Ga0157369_10142949 Ga0157369_101429493 80
75 3300013296 Ga0157374_11495496 Ga0157374_114954962 80
76 3300013307 Ga0157372_12269693 Ga0157372_122696931 80
77 3300013307 Ga0157372_12409762 Ga0157372_124097622 80
78 3300013307 Ga0157372_12525393 Ga0157372_125253931 80
79 3300013307 Ga0157372_13168968 Ga0157372_131689681 80
80 3300014969 Ga0157376_10625840 Ga0157376_106258402 80
81 3300020069 Ga0197907_10074666 Ga0197907_100746662 80
82 3300020070 Ga0206356_10270514 Ga0206356_102705142 80
83 3300020081 Ga0206354_11230951 Ga0206354_112309511 80
84 3300020082 Ga0206353_11253160 Ga0206353_112531601 80
85 3300021361 Ga0213872_10021095 Ga0213872_100210954 80
86 3300021441 Ga0213871_10009838 Ga0213871_100098382 80
87 3300022467 Ga0224712_10233400 Ga0224712_102334002 80
88 3300025302 Ga0207426_1022042 Ga0207426_10220422 80
89 3300025321 Ga0207656_10573761 Ga0207656_105737612 80
90 3300025904 Ga0207647_10118477 Ga0207647_101184772 80
91 3300025909 Ga0207705_10013851 Ga0207705_100138514 80
92 3300025912 Ga0207707_10027217 Ga0207707_100272175 80
93 3300025912 Ga0207707_10137952 Ga0207707_101379522 80
94 3300025912 Ga0207707_10816836 Ga0207707_108168361 80
95 3300025913 Ga0207695_10031242 Ga0207695_100312424 80
96 3300025913 Ga0207695_10167532 Ga0207695_101675322 80
97 3300025917 Ga0207660_10137179 Ga0207660_101371792 80
98 3300025917 Ga0207660_10484875 Ga0207660_104848752 80
99 3300025919 Ga0207657_10156849 Ga0207657_101568492 80
100 3300025919 Ga0207657_10641824 Ga0207657_106418241 80
101 3300025920 Ga0207649_10166772 Ga0207649_101667722 80
102 3300025921 Ga0207652_10121688 Ga0207652_101216883 80
103 3300025923 Ga0207681_10318137 Ga0207681_103181372 80
104 3300025924 Ga0207694_10059748 Ga0207694_100597482 80
105 3300025925 Ga0207650_11374932 Ga0207650_113749321 80
106 3300025926 Ga0207659_10538476 Ga0207659_105384762 80
107 3300025932 Ga0207690_10875860 Ga0207690_108758602 80
108 3300025937 Ga0207669_10195983 Ga0207669_101959831 80
109 3300025944 Ga0207661_11342919 Ga0207661_113429191 80
110 3300025945 Ga0207679_10370686 Ga0207679_103706862 80
111 3300025949 Ga0207667_10041746 Ga0207667_100417462 80
112 3300025981 Ga0207640_11312790 Ga0207640_113127901 80
113 3300026075 Ga0207708_10499597 Ga0207708_104995972 80
114 3300026078 Ga0207702_10177453 Ga0207702_101774533 80
115 3300026078 Ga0207702_10519627 Ga0207702_105196272 80
116 3300026116 Ga0207674_10140734 Ga0207674_101407342 80
117 3300026116 Ga0207674_10652222 Ga0207674_106522222 80
118 3300026142 Ga0207698_11292393 Ga0207698_112923932 80
119 3300028379 Ga0268266_10152629 Ga0268266_101526292 80
120 3300028380 Ga0268265_11807775 Ga0268265_118077751 80
121 3300035114 Ga0373939_0398510 Ga0373939_0398510_42_299 80
122 3300035724 Ga0373933_0241453 Ga0373933_0241453_404_646 80
123 3300036401 Ga0373937_0829647 Ga0373937_0829647_304_546 80
124 3300037312 Ga0395899_0038719 Ga0395899_0038719_781_1023 80
125 3300037312 Ga0395899_0046489 Ga0395899_0046489_2462_2704 80
126 3300037312 Ga0395899_0069432 Ga0395899_0069432_515_757 80
127 3300037418 Ga0395900_0191298 Ga0395900_0191298_1627_1869 80
128 3300037418 Ga0395900_0271450 Ga0395900_0271450_1048_1290 80
129 3300037418 Ga0395900_1089684 Ga0395900_1089684_418_660 80
130 3300037466 Ga0395898_0177693 Ga0395898_0177693_454_696 80
131 3300037471 Ga0395905_1363495 Ga0395905_1363495_212_454 80
132 3300038443 Ga0395901_0001004 Ga0395901_0001004_13951_14193 80
133 3300038443 Ga0395901_0057519 Ga0395901_0057519_2294_2536 80
134 3300038443 Ga0395901_0106386 Ga0395901_0106386_1747_1989 80
135 3300039438 Ga0436360_0041678 Ga0436360_0041678_395_637 80
136 3300039438 Ga0436360_0048664 Ga0436360_0048664_2576_2830 80
137 3300039447 Ga0436361_0705189 Ga0436361_0705189_1663_1917 80
138 3300039453 Ga0436362_1275183 Ga0436362_1275183_465_707 80
139 3300044694 Ga0466963_0056364 Ga0466963_0056364_1050_1292 80
140 3300044706 Ga0466964_0753221 Ga0466964_0753221_64_306 80
141 3300044842 Ga0466957_0221113 Ga0466957_0221113_866_1108 80
142 3300045976 Ga0466967_0753899 Ga0466967_0753899_13_255 80
143 3300049571 Ga0501034_0001445 Ga0501034_0001445_24094_24348 80
144 3300049571 Ga0501034_0004609 Ga0501034_0004609_1095_1337 80
145 3300049571 Ga0501034_0409998 Ga0501034_0409998_37_279 80
146 3300049571 Ga0501034_0516064 Ga0501034_0516064_213_455 80
147 3300049584 Ga0501068_0020664 Ga0501068_0020664_1915_2169 80
148 3300049586 Ga0501070_0181279 Ga0501070_0181279_1414_1668 80
149 3300049744 Ga0501083_0485677 Ga0501083_0485677_347_589 80
150 3300049823 Ga0501044_0008008 Ga0501044_0008008_3845_4099 80
151 3300050489 nmdc:mga03683_264157_c1 nmdc:mga03683_264157_c1_336_578 80
152 3300050490 nmdc:mga03n38_427683_c1 nmdc:mga03n38_427683_c1_470_712 80
153 3300050492 nmdc:mga0yw44_865620_c1 nmdc:mga0yw44_865620_c1_327_569 80
154 3300050493 nmdc:mga0k408_51799_c1 nmdc:mga0k408_51799_c1_1392_1634 80
155 3300050495 nmdc:mga04h51_180099_c1 nmdc:mga04h51_180099_c1_38_280 80
156 3300050511 nmdc:mga08y16_715120_c1 nmdc:mga08y16_715120_c1_216_473 80
157 3300053091 Ga0500647_0022657 Ga0500647_0022657_2269_2523 80
158 3300003203 JGI25406J46586_10042148 JGI25406J46586_100421482 81
159 3300005328 Ga0070676_10458286 Ga0070676_104582862 81
160 3300005331 Ga0070670_101125029 Ga0070670_1011250292 81
161 3300005334 Ga0068869_101075407 Ga0068869_1010754071 81
162 3300005364 Ga0070673_101139951 Ga0070673_1011399512 81
163 3300005365 Ga0070688_100807913 Ga0070688_1008079132 81
164 3300005367 Ga0070667_101719552 Ga0070667_1017195521 81
165 3300005438 Ga0070701_11106736 Ga0070701_111067361 81
166 3300005445 Ga0070708_100056335 Ga0070708_1000563354 81
167 3300005459 Ga0068867_101846508 Ga0068867_1018465081 81
168 3300005466 Ga0070685_10412205 Ga0070685_104122052 81
169 3300005467 Ga0070706_100025293 Ga0070706_1000252932 81
170 3300005468 Ga0070707_100612116 Ga0070707_1006121162 81
171 3300005471 Ga0070698_100001208 Ga0070698_10000120810 81
172 3300005518 Ga0070699_100156522 Ga0070699_1001565221 81
173 3300005548 Ga0070665_100008704 Ga0070665_1000087044 81
174 3300005548 Ga0070665_100540960 Ga0070665_1005409602 81
175 3300005548 Ga0070665_101828708 Ga0070665_1018287081 81
176 3300005616 Ga0068852_102494654 Ga0068852_1024946541 81
177 3300005617 Ga0068859_101311619 Ga0068859_1013116192 81
178 3300005719 Ga0068861_101526950 Ga0068861_1015269502 81
179 3300005834 Ga0068851_10856815 Ga0068851_108568151 81
180 3300005842 Ga0068858_100557382 Ga0068858_1005573822 81
181 3300005842 Ga0068858_102247028 Ga0068858_1022470282 81
182 3300005844 Ga0068862_100563640 Ga0068862_1005636402 81
183 3300005937 Ga0081455_10018608 Ga0081455_100186088 81
184 3300005937 Ga0081455_10641037 Ga0081455_106410372 81
185 3300005985 Ga0081539_10001294 Ga0081539_1000129443 81
186 3300006038 Ga0075365_10054758 Ga0075365_100547583 81
187 3300006038 Ga0075365_10152195 Ga0075365_101521952 81
188 3300006038 Ga0075365_10177330 Ga0075365_101773302 81
189 3300006038 Ga0075365_10381451 Ga0075365_103814512 81
190 3300006038 Ga0075365_10729853 Ga0075365_107298532 81
191 3300006038 Ga0075365_11081519 Ga0075365_110815191 81
192 3300006042 Ga0075368_10053094 Ga0075368_100530941 81
193 3300006042 Ga0075368_10064505 Ga0075368_100645051 81
194 3300006048 Ga0075363_100469476 Ga0075363_1004694762 81
195 3300006051 Ga0075364_10732094 Ga0075364_107320942 81
196 3300006177 Ga0075362_10056113 Ga0075362_100561132 81
197 3300006177 Ga0075362_10076569 Ga0075362_100765692 81
198 3300006177 Ga0075362_10189819 Ga0075362_101898192 81
199 3300006178 Ga0075367_10133243 Ga0075367_101332433 81
200 3300006178 Ga0075367_10232828 Ga0075367_102328282 81
201 3300006178 Ga0075367_10364990 Ga0075367_103649901 81
202 3300006186 Ga0075369_10005835 Ga0075369_100058354 81
203 3300006186 Ga0075369_10015859 Ga0075369_100158593 81
204 3300006195 Ga0075366_10064769 Ga0075366_100647692 81
205 3300006195 Ga0075366_10080732 Ga0075366_100807322 81
206 3300006195 Ga0075366_10286719 Ga0075366_102867192 81
207 3300006237 Ga0097621_101036926 Ga0097621_1010369261 81
208 3300006353 Ga0075370_10042811 Ga0075370_100428113 81
209 3300006353 Ga0075370_10077550 Ga0075370_100775502 81
210 3300006931 Ga0097620_101311746 Ga0097620_1013117462 81
211 3300007265 Ga0099794_10037493 Ga0099794_100374933 81
212 3300007265 Ga0099794_10335219 Ga0099794_103352191 81
213 3300007788 Ga0099795_10546051 Ga0099795_105460511 81
214 3300009094 Ga0111539_10676374 Ga0111539_106763741 81
215 3300009098 Ga0105245_12295918 Ga0105245_122959182 81
216 3300009101 Ga0105247_10447934 Ga0105247_104479342 81
217 3300009148 Ga0105243_10803458 Ga0105243_108034582 81
218 3300009176 Ga0105242_12012201 Ga0105242_120122012 81
219 3300009177 Ga0105248_11594622 Ga0105248_115946222 81
220 3300009177 Ga0105248_12320986 Ga0105248_123209861 81
221 3300009993 Ga0105028_124652 Ga0105028_1246522 81
222 3300010375 Ga0105239_11628109 Ga0105239_116281092 81
223 3300011119 Ga0105246_10213837 Ga0105246_102138371 81
224 3300013297 Ga0157378_13129222 Ga0157378_131292222 81
225 3300013306 Ga0163162_11474058 Ga0163162_114740582 81
226 3300014497 Ga0182008_10409812 Ga0182008_104098122 81
227 3300014968 Ga0157379_10717378 Ga0157379_107173782 81
228 3300014969 Ga0157376_11403355 Ga0157376_114033551 81
229 3300014969 Ga0157376_11894971 Ga0157376_118949711 81
230 3300025315 Ga0207697_10081025 Ga0207697_100810252 81
231 3300025900 Ga0207710_10229700 Ga0207710_102297002 81
232 3300025901 Ga0207688_10376413 Ga0207688_103764132 81
233 3300025907 Ga0207645_10120830 Ga0207645_101208302 81
234 3300025910 Ga0207684_10129217 Ga0207684_101292172 81
235 3300025922 Ga0207646_10078850 Ga0207646_100788503 81
236 3300025925 Ga0207650_10133713 Ga0207650_101337132 81
237 3300025927 Ga0207687_10572691 Ga0207687_105726911 81
238 3300025960 Ga0207651_10668837 Ga0207651_106688372 81
239 3300025960 Ga0207651_10949400 Ga0207651_109494001 81
240 3300026023 Ga0207677_11639183 Ga0207677_116391831 81
241 3300026041 Ga0207639_10221169 Ga0207639_102211692 81
242 3300026089 Ga0207648_12020874 Ga0207648_120208741 81
243 3300027907 Ga0207428_10275178 Ga0207428_102751782 81
244 3300028379 Ga0268266_10006545 Ga0268266_100065454 81
245 3300028379 Ga0268266_10448558 Ga0268266_104485582 81
246 3300028379 Ga0268266_11861693 Ga0268266_118616932 81
247 3300028380 Ga0268265_11189049 Ga0268265_111890492 81
248 3300028380 Ga0268265_11460486 Ga0268265_114604861 81
249 3300031238 Ga0265332_10279176 Ga0265332_102791761 81
250 3300031238 Ga0265332_10304342 Ga0265332_103043421 81
251 3300031241 Ga0265325_10125519 Ga0265325_101255191 81
252 3300031250 Ga0265331_10080081 Ga0265331_100800811 81
253 3300031344 Ga0265316_10510965 Ga0265316_105109652 81
254 3300031711 Ga0265314_10580198 Ga0265314_105801981 81
255 3300032005 Ga0307411_10545095 Ga0307411_105450952 81
256 3300034816 Ga0373930_0143299 Ga0373930_0143299_227_472 81
257 3300035084 Ga0373928_0178761 Ga0373928_0178761_259_504 81
258 3300035086 Ga0373934_0090837 Ga0373934_0090837_126_371 81
259 3300035088 Ga0373940_0279340 Ga0373940_0279340_186_431 81
260 3300035112 Ga0373932_0074821 Ga0373932_0074821_58_303 81
261 3300035241 Ga0373961_0315929 Ga0373961_0315929_104_349 81
262 3300035691 Ga0373931_0084610 Ga0373931_0084610_732_977 81
263 3300035695 Ga0373927_0156311 Ga0373927_0156311_97_342 81
264 3300036401 Ga0373937_0123180 Ga0373937_0123180_1020_1265 81
265 3300037068 Ga0373925_1010362 Ga0373925_1010362_368_613 81
266 3300039453 Ga0436362_1069785 Ga0436362_1069785_1725_1970 81
267 3300041443 Ga0451789_0991220 Ga0451789_0991220_524_769 81
268 3300041451 Ga0451791_0896702 Ga0451791_0896702_270_515 81
269 3300041486 Ga0451807_0841591 Ga0451807_0841591_351_596 81
270 3300041491 Ga0451833_1261752 Ga0451833_1261752_441_686 81
271 3300042157 Ga0439458_0023025 Ga0439458_0023025_225_470 81
272 3300047444 Ga0495675_0760616 Ga0495675_0760616_176_421 81
273 3300049579 Ga0501043_0314221 Ga0501043_0314221_422_667 81
274 3300049580 Ga0501046_0076488 Ga0501046_0076488_1873_2118 81
275 3300049581 Ga0501047_0368113 Ga0501047_0368113_541_786 81
276 3300049586 Ga0501070_0181738 Ga0501070_0181738_1197_1442 81
277 3300049823 Ga0501044_1017269 Ga0501044_1017269_165_410 81
278 3300050489 nmdc:mga03683_129650_c1 nmdc:mga03683_129650_c1_388_642 81
279 3300050489 nmdc:mga03683_1326_c3 nmdc:mga03683_1326_c3_856_1101 81
280 3300050489 nmdc:mga03683_307638_c1 nmdc:mga03683_307638_c1_264_518 81
281 3300050489 nmdc:mga03683_638767_c1 nmdc:mga03683_638767_c1_243_488 81
282 3300050489 nmdc:mga03683_79543_c1 nmdc:mga03683_79543_c1_700_957 81
283 3300050489 nmdc:mga03683_96962_c1 nmdc:mga03683_96962_c1_482_727 81
284 3300050491 nmdc:mga00v17_249254_c1 nmdc:mga00v17_249254_c1_160_417 81
285 3300050491 nmdc:mga00v17_576800_c1 nmdc:mga00v17_576800_c1_451_708 81
286 3300050491 nmdc:mga00v17_864596_c1 nmdc:mga00v17_864596_c1_67_312 81
287 3300050492 nmdc:mga0yw44_114792_c1 nmdc:mga0yw44_114792_c1_328_585 81
288 3300050492 nmdc:mga0yw44_134164_c1 nmdc:mga0yw44_134164_c1_58_315 81
289 3300050492 nmdc:mga0yw44_13422_c1 nmdc:mga0yw44_13422_c1_1213_1458 81
290 3300050492 nmdc:mga0yw44_196439_c2 nmdc:mga0yw44_196439_c2_214_459 81
291 3300050492 nmdc:mga0yw44_220108_c1 nmdc:mga0yw44_220108_c1_562_807 81
292 3300050492 nmdc:mga0yw44_229090_c1 nmdc:mga0yw44_229090_c1_934_1191 81
293 3300050492 nmdc:mga0yw44_985965_c1 nmdc:mga0yw44_985965_c1_143_388 81
294 3300050493 nmdc:mga0k408_236404_c1 nmdc:mga0k408_236404_c1_735_992 81
295 3300050493 nmdc:mga0k408_73480_c1 nmdc:mga0k408_73480_c1_441_686 81
296 3300050493 nmdc:mga0k408_78215_c1 nmdc:mga0k408_78215_c1_247_492 81
297 3300050494 nmdc:mga06z11_13450_c1 nmdc:mga06z11_13450_c1_77_322 81
298 3300050494 nmdc:mga06z11_304571_c1 nmdc:mga06z11_304571_c1_81_326 81
299 3300050494 nmdc:mga06z11_901337_c1 nmdc:mga06z11_901337_c1_218_463 81
300 3300050496 nmdc:mga07m45_32923_c1 nmdc:mga07m45_32923_c1_1321_1566 81
301 3300050496 nmdc:mga07m45_892094_c1 nmdc:mga07m45_892094_c1_154_411 81
302 3300050511 nmdc:mga08y16_543668_c1 nmdc:mga08y16_543668_c1_880_1125 81
303 3300050516 nmdc:mga0sz30_75875_c1 nmdc:mga0sz30_75875_c1_89_346 81
304 3300050516 nmdc:mga0sz30_77_c1 nmdc:mga0sz30_77_c1_23648_23893 81
305 3300053086 Ga0500578_0653904 Ga0500578_0653904_38_283 81
306 3300053087 Ga0500643_065529 Ga0500643_065529_199_456 81
307 3300053087 Ga0500643_137002 Ga0500643_137002_363_641 81
308 3300053088 Ga0500644_0010230 Ga0500644_0010230_2153_2398 81
309 3300053088 Ga0500644_0261617 Ga0500644_0261617_274_531 81
310 3300053092 Ga0500583_0588846 Ga0500583_0588846_64_321 81
311 3300053093 Ga0500651_0017479 Ga0500651_0017479_3141_3386 81
312 3300053093 Ga0500651_0514290 Ga0500651_0514290_353_610 81
313 3300053093 Ga0500651_0529645 Ga0500651_0529645_318_575 81
314 3300053098 Ga0500650_0208643 Ga0500650_0208643_73_330 81
315 3300053119 Ga0500595_120430 Ga0500595_120430_165_425 81
316 3300053142 Ga0500577_0282846 Ga0500577_0282846_127_384 81
317 3300053153 Ga0500616_0004217 Ga0500616_0004217_8191_8448 81

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06568

DUF1127

Domain of unknown function (DUF1127)

41

77

0.93

Feature Viewer

pLDDT pTM Quality
68.4 0.36 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map