F404167
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 317 | 194 | 317 | 81 |
Family's Representative Sequence
| Representative Sequence | 3300014969|Ga0157376_11403355|Ga0157376_114033551 |
| Length | 92 |
| Sequence | MFGVSPAQEASMSYQPRHGFTGPSELYTSSAMPPLSLRQRLAVMWAVWRERTEMRRSLAQMDARSLRDAGISPAAAAYESGKPFWERVGCLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 46 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 47 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 48 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 49 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 50 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 51 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 52 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 58 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 88 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 89 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 126 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 130 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 131 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 132 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 134 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 135 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 136 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 137 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 138 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 140 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 141 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 142 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 144 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 145 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 148 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 149 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 150 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 151 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 152 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 153 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 154 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 155 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 156 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 157 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 158 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 159 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 160 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 161 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 162 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 163 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 164 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 165 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 175 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 176 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 177 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 178 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 179 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 180 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 181 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 182 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 184 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 185 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 186 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 187 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 188 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 189 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 190 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 191 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 192 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 193 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 194 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.42 |
| Metatranscriptomes | 1.58 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 25.55 |
| Nodule | 0 |
| Rhizoplane | 0.95 |
| Rhizosphere | 72.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10042148 | 3300003203 | Bacteria | 1600 |
| 2 | Ga0070658_10045503 | 3300005327 | Bacteria | 3549 |
| 3 | Ga0070676_10458286 | 3300005328 | Bacteria | 898 |
| 4 | Ga0070683_100639494 | 3300005329 | Bacteria | 1018 |
| 5 | Ga0070670_101125029 | 3300005331 | Bacteria | 716 |
| 6 | Ga0068869_101075407 | 3300005334 | Unclassified | 703 |
| 7 | Ga0070680_100001241 | 3300005336 | Bacteria | 18376 |
| 8 | Ga0070660_100448028 | 3300005339 | Bacteria | 1071 |
| 9 | Ga0070689_100259909 | 3300005340 | Unclassified | 1435 |
| 10 | Ga0070689_100263217 | 3300005340 | Bacteria | 1426 |
| 11 | Ga0070691_10007631 | 3300005341 | Bacteria | 4958 |
| 12 | Ga0070691_10057509 | 3300005341 | Bacteria | 1866 |
| 13 | Ga0070661_100039838 | 3300005344 | Bacteria | 3425 |
| 14 | Ga0070675_100265006 | 3300005354 | Bacteria | 1506 |
| 15 | Ga0070674_100850788 | 3300005356 | Bacteria | 791 |
| 16 | Ga0070673_101139951 | 3300005364 | Bacteria | 729 |
| 17 | Ga0070673_101880423 | 3300005364 | Bacteria | 567 |
| 18 | Ga0070688_100807913 | 3300005365 | Bacteria | 734 |
| 19 | Ga0070659_100167619 | 3300005366 | Bacteria | 1798 |
| 20 | Ga0070667_101719552 | 3300005367 | Bacteria | 590 |
| 21 | Ga0070701_10695802 | 3300005438 | Unclassified | 683 |
| 22 | Ga0070701_11106736 | 3300005438 | Bacteria | 558 |
| 23 | Ga0070708_100056335 | 3300005445 | Bacteria | 3496 |
| 24 | Ga0070681_10003085 | 3300005458 | Bacteria | 15467 |
| 25 | Ga0070681_10596898 | 3300005458 | Bacteria | 1018 |
| 26 | Ga0070681_10866618 | 3300005458 | Archaea | 821 |
| 27 | Ga0070681_11010744 | 3300005458 | Bacteria | 751 |
| 28 | Ga0068867_101846508 | 3300005459 | Unclassified | 569 |
| 29 | Ga0070685_10412205 | 3300005466 | Bacteria | 938 |
| 30 | Ga0070685_10447521 | 3300005466 | Bacteria | 904 |
| 31 | Ga0070706_100025293 | 3300005467 | Bacteria | 5463 |
| 32 | Ga0070707_100612116 | 3300005468 | Bacteria | 1052 |
| 33 | Ga0070698_100001208 | 3300005471 | Bacteria | 28691 |
| 34 | Ga0070699_100156522 | 3300005518 | Bacteria | 2016 |
| 35 | Ga0070679_100023728 | 3300005530 | Bacteria | 6010 |
| 36 | Ga0070684_100040638 | 3300005535 | Bacteria | 4006 |
| 37 | Ga0068853_100564944 | 3300005539 | Bacteria | 1078 |
| 38 | Ga0070665_100008704 | 3300005548 | Bacteria | 10271 |
| 39 | Ga0070665_100203508 | 3300005548 | Bacteria | 1980 |
| 40 | Ga0070665_100540960 | 3300005548 | Bacteria | 1177 |
| 41 | Ga0070665_101828708 | 3300005548 | Bacteria | 614 |
| 42 | Ga0070665_101871439 | 3300005548 | Bacteria | 606 |
| 43 | Ga0068855_100017273 | 3300005563 | Bacteria | 8684 |
| 44 | Ga0068855_100234363 | 3300005563 | Bacteria | 2053 |
| 45 | Ga0068855_102147393 | 3300005563 | Unclassified | 561 |
| 46 | Ga0070664_100892206 | 3300005564 | Bacteria | 833 |
| 47 | Ga0068857_100041540 | 3300005577 | Bacteria | 4078 |
| 48 | Ga0068857_100276874 | 3300005577 | Bacteria | 1543 |
| 49 | Ga0068857_101471614 | 3300005577 | Bacteria | 663 |
| 50 | Ga0068854_100641654 | 3300005578 | Bacteria | 911 |
| 51 | Ga0068856_100288737 | 3300005614 | Bacteria | 1657 |
| 52 | Ga0068856_100359964 | 3300005614 | Bacteria | 1473 |
| 53 | Ga0070702_101594194 | 3300005615 | Unclassified | 540 |
| 54 | Ga0068852_102494654 | 3300005616 | Unclassified | 537 |
| 55 | Ga0068859_100122431 | 3300005617 | Bacteria | 2668 |
| 56 | Ga0068859_101311619 | 3300005617 | Bacteria | 798 |
| 57 | Ga0068861_101526950 | 3300005719 | Bacteria | 656 |
| 58 | Ga0068851_10180493 | 3300005834 | Bacteria | 1169 |
| 59 | Ga0068851_10856815 | 3300005834 | Bacteria | 567 |
| 60 | Ga0068858_100557382 | 3300005842 | Bacteria | 1110 |
| 61 | Ga0068858_102247028 | 3300005842 | Unclassified | 539 |
| 62 | Ga0068862_100563640 | 3300005844 | Bacteria | 1089 |
| 63 | Ga0068862_100762779 | 3300005844 | Bacteria | 942 |
| 64 | Ga0081455_10001706 | 3300005937 | Bacteria | 26586 |
| 65 | Ga0081455_10018608 | 3300005937 | Bacteria | 6604 |
| 66 | Ga0081455_10641037 | 3300005937 | Bacteria | 686 |
| 67 | Ga0081539_10001294 | 3300005985 | Bacteria | 43916 |
| 68 | Ga0075365_10054758 | 3300006038 | Bacteria | 2646 |
| 69 | Ga0075365_10095809 | 3300006038 | Bacteria | 2027 |
| 70 | Ga0075365_10152195 | 3300006038 | Bacteria | 1609 |
| 71 | Ga0075365_10177330 | 3300006038 | Bacteria | 1489 |
| 72 | Ga0075365_10381451 | 3300006038 | Bacteria | 994 |
| 73 | Ga0075365_10577241 | 3300006038 | Bacteria | 795 |
| 74 | Ga0075365_10729853 | 3300006038 | Bacteria | 700 |
| 75 | Ga0075365_10927605 | 3300006038 | Unclassified | 614 |
| 76 | Ga0075365_11081519 | 3300006038 | Unclassified | 565 |
| 77 | Ga0075368_10053094 | 3300006042 | Bacteria | 1613 |
| 78 | Ga0075368_10064505 | 3300006042 | Bacteria | 1471 |
| 79 | Ga0075368_10125049 | 3300006042 | Bacteria | 1067 |
| 80 | Ga0075363_100469476 | 3300006048 | Unclassified | 745 |
| 81 | Ga0075363_100581070 | 3300006048 | Bacteria | 670 |
| 82 | Ga0075364_10311557 | 3300006051 | Bacteria | 1072 |
| 83 | Ga0075364_10732094 | 3300006051 | Bacteria | 675 |
| 84 | Ga0075362_10056113 | 3300006177 | Bacteria | 1772 |
| 85 | Ga0075362_10076569 | 3300006177 | Bacteria | 1536 |
| 86 | Ga0075362_10189819 | 3300006177 | Bacteria | 998 |
| 87 | Ga0075367_10017903 | 3300006178 | Bacteria | 3898 |
| 88 | Ga0075367_10133243 | 3300006178 | Bacteria | 1537 |
| 89 | Ga0075367_10232828 | 3300006178 | Bacteria | 1153 |
| 90 | Ga0075367_10364990 | 3300006178 | Bacteria | 912 |
| 91 | Ga0075369_10005835 | 3300006186 | Bacteria | 4627 |
| 92 | Ga0075369_10015859 | 3300006186 | Bacteria | 3031 |
| 93 | Ga0075366_10064769 | 3300006195 | Bacteria | 2174 |
| 94 | Ga0075366_10077487 | 3300006195 | Bacteria | 1984 |
| 95 | Ga0075366_10080732 | 3300006195 | Bacteria | 1942 |
| 96 | Ga0075366_10138887 | 3300006195 | Bacteria | 1468 |
| 97 | Ga0075366_10286719 | 3300006195 | Bacteria | 1007 |
| 98 | Ga0097621_101036926 | 3300006237 | Unclassified | 768 |
| 99 | Ga0075370_10042811 | 3300006353 | Bacteria | 2558 |
| 100 | Ga0075370_10077550 | 3300006353 | Bacteria | 1907 |
| 101 | Ga0075370_10138396 | 3300006353 | Bacteria | 1423 |
| 102 | Ga0068865_100293655 | 3300006881 | Bacteria | 1298 |
| 103 | Ga0068865_100298623 | 3300006881 | Bacteria | 1288 |
| 104 | Ga0097620_100122431 | 3300006931 | Bacteria | 2668 |
| 105 | Ga0097620_101311746 | 3300006931 | Bacteria | 798 |
| 106 | Ga0099794_10037493 | 3300007265 | Bacteria | 2295 |
| 107 | Ga0099794_10335219 | 3300007265 | Bacteria | 786 |
| 108 | Ga0099795_10546051 | 3300007788 | Unclassified | 546 |
| 109 | Ga0105240_10015907 | 3300009093 | Bacteria | 10206 |
| 110 | Ga0105240_10102262 | 3300009093 | Bacteria | 3483 |
| 111 | Ga0105240_10359612 | 3300009093 | Bacteria | 1649 |
| 112 | Ga0111539_10676374 | 3300009094 | Bacteria | 1202 |
| 113 | Ga0105245_10916269 | 3300009098 | Bacteria | 918 |
| 114 | Ga0105245_11307245 | 3300009098 | Unclassified | 774 |
| 115 | Ga0105245_12295918 | 3300009098 | Unclassified | 593 |
| 116 | Ga0105247_10447934 | 3300009101 | Bacteria | 930 |
| 117 | Ga0105243_10803458 | 3300009148 | Bacteria | 927 |
| 118 | Ga0105241_10282377 | 3300009174 | Bacteria | 1418 |
| 119 | Ga0105242_12012201 | 3300009176 | Unclassified | 620 |
| 120 | Ga0105248_11594622 | 3300009177 | Bacteria | 739 |
| 121 | Ga0105248_12320986 | 3300009177 | Unclassified | 611 |
| 122 | Ga0105237_11995717 | 3300009545 | Archaea | 589 |
| 123 | Ga0105238_10056422 | 3300009551 | Bacteria | 3941 |
| 124 | Ga0105238_11048673 | 3300009551 | Unclassified | 837 |
| 125 | Ga0105249_12654523 | 3300009553 | Unclassified | 573 |
| 126 | Ga0105028_124652 | 3300009993 | Bacteria | 662 |
| 127 | Ga0105239_10883877 | 3300010375 | Bacteria | 1025 |
| 128 | Ga0105239_11628109 | 3300010375 | Unclassified | 747 |
| 129 | Ga0105246_10213837 | 3300011119 | Bacteria | 1507 |
| 130 | Ga0157373_10119896 | 3300013100 | Bacteria | 1849 |
| 131 | Ga0157370_10168180 | 3300013104 | Bacteria | 2038 |
| 132 | Ga0157369_10142949 | 3300013105 | Bacteria | 2531 |
| 133 | Ga0157374_11495496 | 3300013296 | Archaea | 698 |
| 134 | Ga0157378_13129222 | 3300013297 | Unclassified | 514 |
| 135 | Ga0163162_11474058 | 3300013306 | Bacteria | 775 |
| 136 | Ga0157372_12269693 | 3300013307 | Bacteria | 623 |
| 137 | Ga0157372_12409762 | 3300013307 | Unclassified | 604 |
| 138 | Ga0157372_12525393 | 3300013307 | Archaea | 590 |
| 139 | Ga0157372_13168968 | 3300013307 | Unclassified | 525 |
| 140 | Ga0182008_10409812 | 3300014497 | Unclassified | 730 |
| 141 | Ga0157379_10717378 | 3300014968 | Bacteria | 939 |
| 142 | Ga0157376_10625840 | 3300014969 | Unclassified | 1074 |
| 143 | Ga0157376_11403355 | 3300014969 | Unclassified | 730 |
| 144 | Ga0157376_11894971 | 3300014969 | Bacteria | 633 |
| 145 | Ga0197907_10074666 | 3300020069 | Bacteria | 574 |
| 146 | Ga0206356_10270514 | 3300020070 | Unclassified | 541 |
| 147 | Ga0206354_11230951 | 3300020081 | Archaea | 649 |
| 148 | Ga0206353_11253160 | 3300020082 | Bacteria | 1128 |
| 149 | Ga0213872_10021095 | 3300021361 | Bacteria | 3000 |
| 150 | Ga0213871_10009838 | 3300021441 | Bacteria | 2153 |
| 151 | Ga0224712_10233400 | 3300022467 | Unclassified | 845 |
| 152 | Ga0207426_1022042 | 3300025302 | Bacteria | 2192 |
| 153 | Ga0207697_10081025 | 3300025315 | Bacteria | 1368 |
| 154 | Ga0207656_10573761 | 3300025321 | Archaea | 575 |
| 155 | Ga0207710_10229700 | 3300025900 | Bacteria | 923 |
| 156 | Ga0207688_10376413 | 3300025901 | Bacteria | 878 |
| 157 | Ga0207647_10118477 | 3300025904 | Bacteria | 1562 |
| 158 | Ga0207645_10120830 | 3300025907 | Bacteria | 1700 |
| 159 | Ga0207705_10013851 | 3300025909 | Bacteria | 5814 |
| 160 | Ga0207684_10129217 | 3300025910 | Bacteria | 2168 |
| 161 | Ga0207707_10027217 | 3300025912 | Bacteria | 5000 |
| 162 | Ga0207707_10137952 | 3300025912 | Bacteria | 2132 |
| 163 | Ga0207707_10816836 | 3300025912 | Bacteria | 776 |
| 164 | Ga0207707_11610939 | 3300025912 | Bacteria | 511 |
| 165 | Ga0207695_10031242 | 3300025913 | Bacteria | 5845 |
| 166 | Ga0207695_10167532 | 3300025913 | Bacteria | 2124 |
| 167 | Ga0207660_10137179 | 3300025917 | Bacteria | 1867 |
| 168 | Ga0207660_10484875 | 3300025917 | Archaea | 1002 |
| 169 | Ga0207657_10156849 | 3300025919 | Bacteria | 1851 |
| 170 | Ga0207657_10641824 | 3300025919 | Unclassified | 827 |
| 171 | Ga0207649_10166772 | 3300025920 | Bacteria | 1530 |
| 172 | Ga0207652_10121688 | 3300025921 | Bacteria | 2322 |
| 173 | Ga0207646_10078850 | 3300025922 | Bacteria | 2944 |
| 174 | Ga0207681_10318137 | 3300025923 | Bacteria | 1237 |
| 175 | Ga0207694_10059748 | 3300025924 | Bacteria | 2966 |
| 176 | Ga0207650_10133713 | 3300025925 | Bacteria | 1943 |
| 177 | Ga0207650_11374932 | 3300025925 | Unclassified | 601 |
| 178 | Ga0207659_10538476 | 3300025926 | Bacteria | 991 |
| 179 | Ga0207687_10572691 | 3300025927 | Bacteria | 949 |
| 180 | Ga0207690_10875860 | 3300025932 | Archaea | 744 |
| 181 | Ga0207669_10195983 | 3300025937 | Bacteria | 1462 |
| 182 | Ga0207661_11342919 | 3300025944 | Archaea | 656 |
| 183 | Ga0207679_10370686 | 3300025945 | Bacteria | 1253 |
| 184 | Ga0207667_10041746 | 3300025949 | Bacteria | 4878 |
| 185 | Ga0207667_10342395 | 3300025949 | Bacteria | 1526 |
| 186 | Ga0207651_10668837 | 3300025960 | Unclassified | 913 |
| 187 | Ga0207651_10949400 | 3300025960 | Bacteria | 767 |
| 188 | Ga0207640_11312790 | 3300025981 | Bacteria | 646 |
| 189 | Ga0207677_11639183 | 3300026023 | Unclassified | 596 |
| 190 | Ga0207639_10221169 | 3300026041 | Bacteria | 1635 |
| 191 | Ga0207708_10499597 | 3300026075 | Bacteria | 1019 |
| 192 | Ga0207702_10177453 | 3300026078 | Bacteria | 1959 |
| 193 | Ga0207702_10519627 | 3300026078 | Bacteria | 1162 |
| 194 | Ga0207648_12020874 | 3300026089 | Unclassified | 538 |
| 195 | Ga0207674_10026439 | 3300026116 | Bacteria | 6163 |
| 196 | Ga0207674_10140734 | 3300026116 | Bacteria | 2372 |
| 197 | Ga0207674_10652222 | 3300026116 | Bacteria | 1016 |
| 198 | Ga0207698_11292393 | 3300026142 | Archaea | 744 |
| 199 | Ga0207428_10275178 | 3300027907 | Bacteria | 1251 |
| 200 | Ga0268266_10006545 | 3300028379 | Bacteria | 10659 |
| 201 | Ga0268266_10152629 | 3300028379 | Bacteria | 2083 |
| 202 | Ga0268266_10448558 | 3300028379 | Bacteria | 1226 |
| 203 | Ga0268266_11234510 | 3300028379 | Unclassified | 723 |
| 204 | Ga0268266_11861693 | 3300028379 | Bacteria | 576 |
| 205 | Ga0268265_11189049 | 3300028380 | Bacteria | 760 |
| 206 | Ga0268265_11460486 | 3300028380 | Unclassified | 687 |
| 207 | Ga0268265_11807775 | 3300028380 | Unclassified | 617 |
| 208 | Ga0265332_10279176 | 3300031238 | Unclassified | 690 |
| 209 | Ga0265332_10304342 | 3300031238 | Bacteria | 658 |
| 210 | Ga0265325_10125519 | 3300031241 | Bacteria | 1234 |
| 211 | Ga0265331_10080081 | 3300031250 | Bacteria | 1519 |
| 212 | Ga0265316_10510965 | 3300031344 | Bacteria | 858 |
| 213 | Ga0265314_10580198 | 3300031711 | Unclassified | 580 |
| 214 | Ga0307411_10545095 | 3300032005 | Bacteria | 989 |
| 215 | Ga0373930_0143299 | 3300034816 | Bacteria | 595 |
| 216 | Ga0373928_0178761 | 3300035084 | Unclassified | 602 |
| 217 | Ga0373934_0090837 | 3300035086 | Bacteria | 1231 |
| 218 | Ga0373940_0279340 | 3300035088 | Unclassified | 570 |
| 219 | Ga0373932_0074821 | 3300035112 | Bacteria | 1058 |
| 220 | Ga0373939_0398510 | 3300035114 | Unclassified | 570 |
| 221 | Ga0373941_0095971 | 3300035115 | Bacteria | 1025 |
| 222 | Ga0373961_0315929 | 3300035241 | Unclassified | 581 |
| 223 | Ga0373931_0084610 | 3300035691 | Bacteria | 1757 |
| 224 | Ga0373927_0156311 | 3300035695 | Bacteria | 1494 |
| 225 | Ga0373933_0241453 | 3300035724 | Bacteria | 1162 |
| 226 | Ga0373937_0123180 | 3300036401 | Bacteria | 2417 |
| 227 | Ga0373937_0829647 | 3300036401 | Unclassified | 873 |
| 228 | Ga0373925_1010362 | 3300037068 | Bacteria | 685 |
| 229 | Ga0395899_0038719 | 3300037312 | Bacteria | 3570 |
| 230 | Ga0395899_0046489 | 3300037312 | Bacteria | 3233 |
| 231 | Ga0395899_0069432 | 3300037312 | Bacteria | 2580 |
| 232 | Ga0395900_0191298 | 3300037418 | Bacteria | 2075 |
| 233 | Ga0395900_0271450 | 3300037418 | Bacteria | 1690 |
| 234 | Ga0395900_1089684 | 3300037418 | Bacteria | 716 |
| 235 | Ga0395898_0177693 | 3300037466 | Bacteria | 2034 |
| 236 | Ga0395905_1363495 | 3300037471 | Unclassified | 613 |
| 237 | Ga0395901_0001004 | 3300038443 | Bacteria | 30516 |
| 238 | Ga0395901_0057519 | 3300038443 | Bacteria | 4044 |
| 239 | Ga0395901_0106386 | 3300038443 | Bacteria | 2944 |
| 240 | Ga0436365_0957444 | 3300039437 | Bacteria | 975 |
| 241 | Ga0436360_0041678 | 3300039438 | Unclassified | 948 |
| 242 | Ga0436360_0048664 | 3300039438 | Bacteria | 3795 |
| 243 | Ga0436361_0705189 | 3300039447 | Bacteria | 5316 |
| 244 | Ga0436362_1069785 | 3300039453 | Bacteria | 2222 |
| 245 | Ga0436362_1275183 | 3300039453 | Bacteria | 730 |
| 246 | Ga0451789_0991220 | 3300041443 | Unclassified | 858 |
| 247 | Ga0451791_0896702 | 3300041451 | Unclassified | 893 |
| 248 | Ga0451807_0841591 | 3300041486 | Unclassified | 763 |
| 249 | Ga0451833_1261752 | 3300041491 | Bacteria | 719 |
| 250 | Ga0439458_0023025 | 3300042157 | Bacteria | 1451 |
| 251 | Ga0466963_0056364 | 3300044694 | Bacteria | 2615 |
| 252 | Ga0466964_0753221 | 3300044706 | Unclassified | 547 |
| 253 | Ga0466957_0221113 | 3300044842 | Bacteria | 1250 |
| 254 | Ga0466967_0753899 | 3300045976 | Unclassified | 965 |
| 255 | Ga0495675_0760616 | 3300047444 | Unclassified | 539 |
| 256 | Ga0501034_0001445 | 3300049571 | Bacteria | 31511 |
| 257 | Ga0501034_0004609 | 3300049571 | Bacteria | 15277 |
| 258 | Ga0501034_0409998 | 3300049571 | Unclassified | 1277 |
| 259 | Ga0501034_0516064 | 3300049571 | Bacteria | 1107 |
| 260 | Ga0501043_0314221 | 3300049579 | Bacteria | 1195 |
| 261 | Ga0501046_0076488 | 3300049580 | Bacteria | 2593 |
| 262 | Ga0501047_0368113 | 3300049581 | Bacteria | 1272 |
| 263 | Ga0501068_0020664 | 3300049584 | Bacteria | 3839 |
| 264 | Ga0501070_0181279 | 3300049586 | Bacteria | 1733 |
| 265 | Ga0501070_0181738 | 3300049586 | Bacteria | 1731 |
| 266 | Ga0501083_0485677 | 3300049744 | Unclassified | 804 |
| 267 | Ga0501044_0008008 | 3300049823 | Bacteria | 11614 |
| 268 | Ga0501044_1017269 | 3300049823 | Unclassified | 700 |
| 269 | nmdc:mga03683_129650_c1 | 3300050489 | Bacteria | 1127 |
| 270 | nmdc:mga03683_1326_c3 | 3300050489 | Bacteria | 1896 |
| 271 | nmdc:mga03683_264157_c1 | 3300050489 | Bacteria | 802 |
| 272 | nmdc:mga03683_307638_c1 | 3300050489 | Bacteria | 744 |
| 273 | nmdc:mga03683_638767_c1 | 3300050489 | Unclassified | 523 |
| 274 | nmdc:mga03683_79543_c1 | 3300050489 | Bacteria | 1413 |
| 275 | nmdc:mga03683_96962_c1 | 3300050489 | Unclassified | 1292 |
| 276 | nmdc:mga03n38_257252_c1 | 3300050490 | Bacteria | 924 |
| 277 | nmdc:mga03n38_427683_c1 | 3300050490 | Bacteria | 733 |
| 278 | nmdc:mga00v17_249254_c1 | 3300050491 | Bacteria | 1151 |
| 279 | nmdc:mga00v17_576800_c1 | 3300050491 | Bacteria | 726 |
| 280 | nmdc:mga00v17_864596_c1 | 3300050491 | Unclassified | 574 |
| 281 | nmdc:mga0yw44_114792_c1 | 3300050492 | Bacteria | 1729 |
| 282 | nmdc:mga0yw44_134164_c1 | 3300050492 | Bacteria | 1605 |
| 283 | nmdc:mga0yw44_13422_c1 | 3300050492 | Bacteria | 4314 |
| 284 | nmdc:mga0yw44_196439_c2 | 3300050492 | Unclassified | 532 |
| 285 | nmdc:mga0yw44_220108_c1 | 3300050492 | Bacteria | 1258 |
| 286 | nmdc:mga0yw44_229090_c1 | 3300050492 | Bacteria | 1233 |
| 287 | nmdc:mga0yw44_865620_c1 | 3300050492 | Unclassified | 613 |
| 288 | nmdc:mga0yw44_985965_c1 | 3300050492 | Bacteria | 570 |
| 289 | nmdc:mga0k408_236404_c1 | 3300050493 | Bacteria | 1091 |
| 290 | nmdc:mga0k408_51799_c1 | 3300050493 | Bacteria | 2378 |
| 291 | nmdc:mga0k408_73480_c1 | 3300050493 | Bacteria | 1997 |
| 292 | nmdc:mga0k408_78215_c1 | 3300050493 | Bacteria | 1934 |
| 293 | nmdc:mga06z11_13450_c1 | 3300050494 | Bacteria | 3594 |
| 294 | nmdc:mga06z11_304571_c1 | 3300050494 | Bacteria | 948 |
| 295 | nmdc:mga06z11_901337_c1 | 3300050494 | Unclassified | 539 |
| 296 | nmdc:mga04h51_180099_c1 | 3300050495 | Bacteria | 822 |
| 297 | nmdc:mga07m45_32923_c1 | 3300050496 | Bacteria | 2876 |
| 298 | nmdc:mga07m45_892094_c1 | 3300050496 | Unclassified | 509 |
| 299 | nmdc:mga08y16_543668_c1 | 3300050511 | Bacteria | 1176 |
| 300 | nmdc:mga08y16_715120_c1 | 3300050511 | Bacteria | 1000 |
| 301 | nmdc:mga0sz30_75875_c1 | 3300050516 | Bacteria | 1451 |
| 302 | nmdc:mga0sz30_77_c1 | 3300050516 | Bacteria | 37634 |
| 303 | Ga0500578_0653904 | 3300053086 | Bacteria | 571 |
| 304 | Ga0500643_065529 | 3300053087 | Bacteria | 1014 |
| 305 | Ga0500643_137002 | 3300053087 | Unclassified | 658 |
| 306 | Ga0500644_0010230 | 3300053088 | Bacteria | 2533 |
| 307 | Ga0500644_0261617 | 3300053088 | Bacteria | 732 |
| 308 | Ga0500647_0022657 | 3300053091 | Bacteria | 2941 |
| 309 | Ga0500583_0588846 | 3300053092 | Bacteria | 513 |
| 310 | Ga0500651_0017479 | 3300053093 | Bacteria | 4426 |
| 311 | Ga0500651_0514290 | 3300053093 | Unclassified | 659 |
| 312 | Ga0500651_0529645 | 3300053093 | Bacteria | 647 |
| 313 | Ga0500650_0208643 | 3300053098 | Bacteria | 888 |
| 314 | Ga0500595_120430 | 3300053119 | Unclassified | 742 |
| 315 | Ga0500577_0282846 | 3300053142 | Unclassified | 723 |
| 316 | Ga0500616_0004217 | 3300053153 | Bacteria | 10358 |
| 317 | Ga0500552_022064 | 3300053733 | Bacteria | 916 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053733 | Ga0500552_022064 | Ga0500552_022064_348_605 | 77 |
| 2 | 3300039437 | Ga0436365_0957444 | Ga0436365_0957444_294_530 | 78 |
| 3 | 3300005458 | Ga0070681_10596898 | Ga0070681_105968982 | 79 |
| 4 | 3300005548 | Ga0070665_101871439 | Ga0070665_1018714391 | 79 |
| 5 | 3300005577 | Ga0068857_100041540 | Ga0068857_1000415402 | 79 |
| 6 | 3300005937 | Ga0081455_10001706 | Ga0081455_100017066 | 79 |
| 7 | 3300006038 | Ga0075365_10577241 | Ga0075365_105772412 | 79 |
| 8 | 3300006048 | Ga0075363_100581070 | Ga0075363_1005810702 | 79 |
| 9 | 3300006051 | Ga0075364_10311557 | Ga0075364_103115572 | 79 |
| 10 | 3300006195 | Ga0075366_10138887 | Ga0075366_101388872 | 79 |
| 11 | 3300009098 | Ga0105245_10916269 | Ga0105245_109162692 | 79 |
| 12 | 3300025912 | Ga0207707_11610939 | Ga0207707_116109391 | 79 |
| 13 | 3300025949 | Ga0207667_10342395 | Ga0207667_103423952 | 79 |
| 14 | 3300026116 | Ga0207674_10026439 | Ga0207674_100264392 | 79 |
| 15 | 3300028379 | Ga0268266_11234510 | Ga0268266_112345102 | 79 |
| 16 | 3300035115 | Ga0373941_0095971 | Ga0373941_0095971_764_1003 | 79 |
| 17 | 3300050490 | nmdc:mga03n38_257252_c1 | nmdc:mga03n38_257252_c1_641_904 | 79 |
| 18 | 3300005327 | Ga0070658_10045503 | Ga0070658_100455033 | 80 |
| 19 | 3300005329 | Ga0070683_100639494 | Ga0070683_1006394941 | 80 |
| 20 | 3300005336 | Ga0070680_100001241 | Ga0070680_10000124112 | 80 |
| 21 | 3300005339 | Ga0070660_100448028 | Ga0070660_1004480282 | 80 |
| 22 | 3300005340 | Ga0070689_100259909 | Ga0070689_1002599093 | 80 |
| 23 | 3300005340 | Ga0070689_100263217 | Ga0070689_1002632171 | 80 |
| 24 | 3300005341 | Ga0070691_10007631 | Ga0070691_100076314 | 80 |
| 25 | 3300005341 | Ga0070691_10057509 | Ga0070691_100575092 | 80 |
| 26 | 3300005344 | Ga0070661_100039838 | Ga0070661_1000398383 | 80 |
| 27 | 3300005354 | Ga0070675_100265006 | Ga0070675_1002650062 | 80 |
| 28 | 3300005356 | Ga0070674_100850788 | Ga0070674_1008507881 | 80 |
| 29 | 3300005364 | Ga0070673_101880423 | Ga0070673_1018804232 | 80 |
| 30 | 3300005366 | Ga0070659_100167619 | Ga0070659_1001676193 | 80 |
| 31 | 3300005438 | Ga0070701_10695802 | Ga0070701_106958021 | 80 |
| 32 | 3300005458 | Ga0070681_10003085 | Ga0070681_100030857 | 80 |
| 33 | 3300005458 | Ga0070681_10866618 | Ga0070681_108666181 | 80 |
| 34 | 3300005458 | Ga0070681_11010744 | Ga0070681_110107441 | 80 |
| 35 | 3300005466 | Ga0070685_10447521 | Ga0070685_104475211 | 80 |
| 36 | 3300005530 | Ga0070679_100023728 | Ga0070679_1000237283 | 80 |
| 37 | 3300005535 | Ga0070684_100040638 | Ga0070684_1000406381 | 80 |
| 38 | 3300005539 | Ga0068853_100564944 | Ga0068853_1005649442 | 80 |
| 39 | 3300005548 | Ga0070665_100203508 | Ga0070665_1002035082 | 80 |
| 40 | 3300005563 | Ga0068855_100017273 | Ga0068855_1000172735 | 80 |
| 41 | 3300005563 | Ga0068855_100234363 | Ga0068855_1002343633 | 80 |
| 42 | 3300005563 | Ga0068855_102147393 | Ga0068855_1021473931 | 80 |
| 43 | 3300005564 | Ga0070664_100892206 | Ga0070664_1008922062 | 80 |
| 44 | 3300005577 | Ga0068857_100276874 | Ga0068857_1002768743 | 80 |
| 45 | 3300005577 | Ga0068857_101471614 | Ga0068857_1014716141 | 80 |
| 46 | 3300005578 | Ga0068854_100641654 | Ga0068854_1006416542 | 80 |
| 47 | 3300005614 | Ga0068856_100288737 | Ga0068856_1002887373 | 80 |
| 48 | 3300005614 | Ga0068856_100359964 | Ga0068856_1003599642 | 80 |
| 49 | 3300005615 | Ga0070702_101594194 | Ga0070702_1015941941 | 80 |
| 50 | 3300005617 | Ga0068859_100122431 | Ga0068859_1001224313 | 80 |
| 51 | 3300005834 | Ga0068851_10180493 | Ga0068851_101804932 | 80 |
| 52 | 3300005844 | Ga0068862_100762779 | Ga0068862_1007627792 | 80 |
| 53 | 3300006038 | Ga0075365_10095809 | Ga0075365_100958092 | 80 |
| 54 | 3300006038 | Ga0075365_10927605 | Ga0075365_109276052 | 80 |
| 55 | 3300006042 | Ga0075368_10125049 | Ga0075368_101250492 | 80 |
| 56 | 3300006178 | Ga0075367_10017903 | Ga0075367_100179033 | 80 |
| 57 | 3300006195 | Ga0075366_10077487 | Ga0075366_100774872 | 80 |
| 58 | 3300006353 | Ga0075370_10138396 | Ga0075370_101383962 | 80 |
| 59 | 3300006881 | Ga0068865_100293655 | Ga0068865_1002936552 | 80 |
| 60 | 3300006881 | Ga0068865_100298623 | Ga0068865_1002986232 | 80 |
| 61 | 3300006931 | Ga0097620_100122431 | Ga0097620_1001224313 | 80 |
| 62 | 3300009093 | Ga0105240_10015907 | Ga0105240_100159072 | 80 |
| 63 | 3300009093 | Ga0105240_10102262 | Ga0105240_101022624 | 80 |
| 64 | 3300009093 | Ga0105240_10359612 | Ga0105240_103596123 | 80 |
| 65 | 3300009098 | Ga0105245_11307245 | Ga0105245_113072452 | 80 |
| 66 | 3300009174 | Ga0105241_10282377 | Ga0105241_102823772 | 80 |
| 67 | 3300009545 | Ga0105237_11995717 | Ga0105237_119957172 | 80 |
| 68 | 3300009551 | Ga0105238_10056422 | Ga0105238_100564222 | 80 |
| 69 | 3300009551 | Ga0105238_11048673 | Ga0105238_110486732 | 80 |
| 70 | 3300009553 | Ga0105249_12654523 | Ga0105249_126545231 | 80 |
| 71 | 3300010375 | Ga0105239_10883877 | Ga0105239_108838771 | 80 |
| 72 | 3300013100 | Ga0157373_10119896 | Ga0157373_101198962 | 80 |
| 73 | 3300013104 | Ga0157370_10168180 | Ga0157370_101681802 | 80 |
| 74 | 3300013105 | Ga0157369_10142949 | Ga0157369_101429493 | 80 |
| 75 | 3300013296 | Ga0157374_11495496 | Ga0157374_114954962 | 80 |
| 76 | 3300013307 | Ga0157372_12269693 | Ga0157372_122696931 | 80 |
| 77 | 3300013307 | Ga0157372_12409762 | Ga0157372_124097622 | 80 |
| 78 | 3300013307 | Ga0157372_12525393 | Ga0157372_125253931 | 80 |
| 79 | 3300013307 | Ga0157372_13168968 | Ga0157372_131689681 | 80 |
| 80 | 3300014969 | Ga0157376_10625840 | Ga0157376_106258402 | 80 |
| 81 | 3300020069 | Ga0197907_10074666 | Ga0197907_100746662 | 80 |
| 82 | 3300020070 | Ga0206356_10270514 | Ga0206356_102705142 | 80 |
| 83 | 3300020081 | Ga0206354_11230951 | Ga0206354_112309511 | 80 |
| 84 | 3300020082 | Ga0206353_11253160 | Ga0206353_112531601 | 80 |
| 85 | 3300021361 | Ga0213872_10021095 | Ga0213872_100210954 | 80 |
| 86 | 3300021441 | Ga0213871_10009838 | Ga0213871_100098382 | 80 |
| 87 | 3300022467 | Ga0224712_10233400 | Ga0224712_102334002 | 80 |
| 88 | 3300025302 | Ga0207426_1022042 | Ga0207426_10220422 | 80 |
| 89 | 3300025321 | Ga0207656_10573761 | Ga0207656_105737612 | 80 |
| 90 | 3300025904 | Ga0207647_10118477 | Ga0207647_101184772 | 80 |
| 91 | 3300025909 | Ga0207705_10013851 | Ga0207705_100138514 | 80 |
| 92 | 3300025912 | Ga0207707_10027217 | Ga0207707_100272175 | 80 |
| 93 | 3300025912 | Ga0207707_10137952 | Ga0207707_101379522 | 80 |
| 94 | 3300025912 | Ga0207707_10816836 | Ga0207707_108168361 | 80 |
| 95 | 3300025913 | Ga0207695_10031242 | Ga0207695_100312424 | 80 |
| 96 | 3300025913 | Ga0207695_10167532 | Ga0207695_101675322 | 80 |
| 97 | 3300025917 | Ga0207660_10137179 | Ga0207660_101371792 | 80 |
| 98 | 3300025917 | Ga0207660_10484875 | Ga0207660_104848752 | 80 |
| 99 | 3300025919 | Ga0207657_10156849 | Ga0207657_101568492 | 80 |
| 100 | 3300025919 | Ga0207657_10641824 | Ga0207657_106418241 | 80 |
| 101 | 3300025920 | Ga0207649_10166772 | Ga0207649_101667722 | 80 |
| 102 | 3300025921 | Ga0207652_10121688 | Ga0207652_101216883 | 80 |
| 103 | 3300025923 | Ga0207681_10318137 | Ga0207681_103181372 | 80 |
| 104 | 3300025924 | Ga0207694_10059748 | Ga0207694_100597482 | 80 |
| 105 | 3300025925 | Ga0207650_11374932 | Ga0207650_113749321 | 80 |
| 106 | 3300025926 | Ga0207659_10538476 | Ga0207659_105384762 | 80 |
| 107 | 3300025932 | Ga0207690_10875860 | Ga0207690_108758602 | 80 |
| 108 | 3300025937 | Ga0207669_10195983 | Ga0207669_101959831 | 80 |
| 109 | 3300025944 | Ga0207661_11342919 | Ga0207661_113429191 | 80 |
| 110 | 3300025945 | Ga0207679_10370686 | Ga0207679_103706862 | 80 |
| 111 | 3300025949 | Ga0207667_10041746 | Ga0207667_100417462 | 80 |
| 112 | 3300025981 | Ga0207640_11312790 | Ga0207640_113127901 | 80 |
| 113 | 3300026075 | Ga0207708_10499597 | Ga0207708_104995972 | 80 |
| 114 | 3300026078 | Ga0207702_10177453 | Ga0207702_101774533 | 80 |
| 115 | 3300026078 | Ga0207702_10519627 | Ga0207702_105196272 | 80 |
| 116 | 3300026116 | Ga0207674_10140734 | Ga0207674_101407342 | 80 |
| 117 | 3300026116 | Ga0207674_10652222 | Ga0207674_106522222 | 80 |
| 118 | 3300026142 | Ga0207698_11292393 | Ga0207698_112923932 | 80 |
| 119 | 3300028379 | Ga0268266_10152629 | Ga0268266_101526292 | 80 |
| 120 | 3300028380 | Ga0268265_11807775 | Ga0268265_118077751 | 80 |
| 121 | 3300035114 | Ga0373939_0398510 | Ga0373939_0398510_42_299 | 80 |
| 122 | 3300035724 | Ga0373933_0241453 | Ga0373933_0241453_404_646 | 80 |
| 123 | 3300036401 | Ga0373937_0829647 | Ga0373937_0829647_304_546 | 80 |
| 124 | 3300037312 | Ga0395899_0038719 | Ga0395899_0038719_781_1023 | 80 |
| 125 | 3300037312 | Ga0395899_0046489 | Ga0395899_0046489_2462_2704 | 80 |
| 126 | 3300037312 | Ga0395899_0069432 | Ga0395899_0069432_515_757 | 80 |
| 127 | 3300037418 | Ga0395900_0191298 | Ga0395900_0191298_1627_1869 | 80 |
| 128 | 3300037418 | Ga0395900_0271450 | Ga0395900_0271450_1048_1290 | 80 |
| 129 | 3300037418 | Ga0395900_1089684 | Ga0395900_1089684_418_660 | 80 |
| 130 | 3300037466 | Ga0395898_0177693 | Ga0395898_0177693_454_696 | 80 |
| 131 | 3300037471 | Ga0395905_1363495 | Ga0395905_1363495_212_454 | 80 |
| 132 | 3300038443 | Ga0395901_0001004 | Ga0395901_0001004_13951_14193 | 80 |
| 133 | 3300038443 | Ga0395901_0057519 | Ga0395901_0057519_2294_2536 | 80 |
| 134 | 3300038443 | Ga0395901_0106386 | Ga0395901_0106386_1747_1989 | 80 |
| 135 | 3300039438 | Ga0436360_0041678 | Ga0436360_0041678_395_637 | 80 |
| 136 | 3300039438 | Ga0436360_0048664 | Ga0436360_0048664_2576_2830 | 80 |
| 137 | 3300039447 | Ga0436361_0705189 | Ga0436361_0705189_1663_1917 | 80 |
| 138 | 3300039453 | Ga0436362_1275183 | Ga0436362_1275183_465_707 | 80 |
| 139 | 3300044694 | Ga0466963_0056364 | Ga0466963_0056364_1050_1292 | 80 |
| 140 | 3300044706 | Ga0466964_0753221 | Ga0466964_0753221_64_306 | 80 |
| 141 | 3300044842 | Ga0466957_0221113 | Ga0466957_0221113_866_1108 | 80 |
| 142 | 3300045976 | Ga0466967_0753899 | Ga0466967_0753899_13_255 | 80 |
| 143 | 3300049571 | Ga0501034_0001445 | Ga0501034_0001445_24094_24348 | 80 |
| 144 | 3300049571 | Ga0501034_0004609 | Ga0501034_0004609_1095_1337 | 80 |
| 145 | 3300049571 | Ga0501034_0409998 | Ga0501034_0409998_37_279 | 80 |
| 146 | 3300049571 | Ga0501034_0516064 | Ga0501034_0516064_213_455 | 80 |
| 147 | 3300049584 | Ga0501068_0020664 | Ga0501068_0020664_1915_2169 | 80 |
| 148 | 3300049586 | Ga0501070_0181279 | Ga0501070_0181279_1414_1668 | 80 |
| 149 | 3300049744 | Ga0501083_0485677 | Ga0501083_0485677_347_589 | 80 |
| 150 | 3300049823 | Ga0501044_0008008 | Ga0501044_0008008_3845_4099 | 80 |
| 151 | 3300050489 | nmdc:mga03683_264157_c1 | nmdc:mga03683_264157_c1_336_578 | 80 |
| 152 | 3300050490 | nmdc:mga03n38_427683_c1 | nmdc:mga03n38_427683_c1_470_712 | 80 |
| 153 | 3300050492 | nmdc:mga0yw44_865620_c1 | nmdc:mga0yw44_865620_c1_327_569 | 80 |
| 154 | 3300050493 | nmdc:mga0k408_51799_c1 | nmdc:mga0k408_51799_c1_1392_1634 | 80 |
| 155 | 3300050495 | nmdc:mga04h51_180099_c1 | nmdc:mga04h51_180099_c1_38_280 | 80 |
| 156 | 3300050511 | nmdc:mga08y16_715120_c1 | nmdc:mga08y16_715120_c1_216_473 | 80 |
| 157 | 3300053091 | Ga0500647_0022657 | Ga0500647_0022657_2269_2523 | 80 |
| 158 | 3300003203 | JGI25406J46586_10042148 | JGI25406J46586_100421482 | 81 |
| 159 | 3300005328 | Ga0070676_10458286 | Ga0070676_104582862 | 81 |
| 160 | 3300005331 | Ga0070670_101125029 | Ga0070670_1011250292 | 81 |
| 161 | 3300005334 | Ga0068869_101075407 | Ga0068869_1010754071 | 81 |
| 162 | 3300005364 | Ga0070673_101139951 | Ga0070673_1011399512 | 81 |
| 163 | 3300005365 | Ga0070688_100807913 | Ga0070688_1008079132 | 81 |
| 164 | 3300005367 | Ga0070667_101719552 | Ga0070667_1017195521 | 81 |
| 165 | 3300005438 | Ga0070701_11106736 | Ga0070701_111067361 | 81 |
| 166 | 3300005445 | Ga0070708_100056335 | Ga0070708_1000563354 | 81 |
| 167 | 3300005459 | Ga0068867_101846508 | Ga0068867_1018465081 | 81 |
| 168 | 3300005466 | Ga0070685_10412205 | Ga0070685_104122052 | 81 |
| 169 | 3300005467 | Ga0070706_100025293 | Ga0070706_1000252932 | 81 |
| 170 | 3300005468 | Ga0070707_100612116 | Ga0070707_1006121162 | 81 |
| 171 | 3300005471 | Ga0070698_100001208 | Ga0070698_10000120810 | 81 |
| 172 | 3300005518 | Ga0070699_100156522 | Ga0070699_1001565221 | 81 |
| 173 | 3300005548 | Ga0070665_100008704 | Ga0070665_1000087044 | 81 |
| 174 | 3300005548 | Ga0070665_100540960 | Ga0070665_1005409602 | 81 |
| 175 | 3300005548 | Ga0070665_101828708 | Ga0070665_1018287081 | 81 |
| 176 | 3300005616 | Ga0068852_102494654 | Ga0068852_1024946541 | 81 |
| 177 | 3300005617 | Ga0068859_101311619 | Ga0068859_1013116192 | 81 |
| 178 | 3300005719 | Ga0068861_101526950 | Ga0068861_1015269502 | 81 |
| 179 | 3300005834 | Ga0068851_10856815 | Ga0068851_108568151 | 81 |
| 180 | 3300005842 | Ga0068858_100557382 | Ga0068858_1005573822 | 81 |
| 181 | 3300005842 | Ga0068858_102247028 | Ga0068858_1022470282 | 81 |
| 182 | 3300005844 | Ga0068862_100563640 | Ga0068862_1005636402 | 81 |
| 183 | 3300005937 | Ga0081455_10018608 | Ga0081455_100186088 | 81 |
| 184 | 3300005937 | Ga0081455_10641037 | Ga0081455_106410372 | 81 |
| 185 | 3300005985 | Ga0081539_10001294 | Ga0081539_1000129443 | 81 |
| 186 | 3300006038 | Ga0075365_10054758 | Ga0075365_100547583 | 81 |
| 187 | 3300006038 | Ga0075365_10152195 | Ga0075365_101521952 | 81 |
| 188 | 3300006038 | Ga0075365_10177330 | Ga0075365_101773302 | 81 |
| 189 | 3300006038 | Ga0075365_10381451 | Ga0075365_103814512 | 81 |
| 190 | 3300006038 | Ga0075365_10729853 | Ga0075365_107298532 | 81 |
| 191 | 3300006038 | Ga0075365_11081519 | Ga0075365_110815191 | 81 |
| 192 | 3300006042 | Ga0075368_10053094 | Ga0075368_100530941 | 81 |
| 193 | 3300006042 | Ga0075368_10064505 | Ga0075368_100645051 | 81 |
| 194 | 3300006048 | Ga0075363_100469476 | Ga0075363_1004694762 | 81 |
| 195 | 3300006051 | Ga0075364_10732094 | Ga0075364_107320942 | 81 |
| 196 | 3300006177 | Ga0075362_10056113 | Ga0075362_100561132 | 81 |
| 197 | 3300006177 | Ga0075362_10076569 | Ga0075362_100765692 | 81 |
| 198 | 3300006177 | Ga0075362_10189819 | Ga0075362_101898192 | 81 |
| 199 | 3300006178 | Ga0075367_10133243 | Ga0075367_101332433 | 81 |
| 200 | 3300006178 | Ga0075367_10232828 | Ga0075367_102328282 | 81 |
| 201 | 3300006178 | Ga0075367_10364990 | Ga0075367_103649901 | 81 |
| 202 | 3300006186 | Ga0075369_10005835 | Ga0075369_100058354 | 81 |
| 203 | 3300006186 | Ga0075369_10015859 | Ga0075369_100158593 | 81 |
| 204 | 3300006195 | Ga0075366_10064769 | Ga0075366_100647692 | 81 |
| 205 | 3300006195 | Ga0075366_10080732 | Ga0075366_100807322 | 81 |
| 206 | 3300006195 | Ga0075366_10286719 | Ga0075366_102867192 | 81 |
| 207 | 3300006237 | Ga0097621_101036926 | Ga0097621_1010369261 | 81 |
| 208 | 3300006353 | Ga0075370_10042811 | Ga0075370_100428113 | 81 |
| 209 | 3300006353 | Ga0075370_10077550 | Ga0075370_100775502 | 81 |
| 210 | 3300006931 | Ga0097620_101311746 | Ga0097620_1013117462 | 81 |
| 211 | 3300007265 | Ga0099794_10037493 | Ga0099794_100374933 | 81 |
| 212 | 3300007265 | Ga0099794_10335219 | Ga0099794_103352191 | 81 |
| 213 | 3300007788 | Ga0099795_10546051 | Ga0099795_105460511 | 81 |
| 214 | 3300009094 | Ga0111539_10676374 | Ga0111539_106763741 | 81 |
| 215 | 3300009098 | Ga0105245_12295918 | Ga0105245_122959182 | 81 |
| 216 | 3300009101 | Ga0105247_10447934 | Ga0105247_104479342 | 81 |
| 217 | 3300009148 | Ga0105243_10803458 | Ga0105243_108034582 | 81 |
| 218 | 3300009176 | Ga0105242_12012201 | Ga0105242_120122012 | 81 |
| 219 | 3300009177 | Ga0105248_11594622 | Ga0105248_115946222 | 81 |
| 220 | 3300009177 | Ga0105248_12320986 | Ga0105248_123209861 | 81 |
| 221 | 3300009993 | Ga0105028_124652 | Ga0105028_1246522 | 81 |
| 222 | 3300010375 | Ga0105239_11628109 | Ga0105239_116281092 | 81 |
| 223 | 3300011119 | Ga0105246_10213837 | Ga0105246_102138371 | 81 |
| 224 | 3300013297 | Ga0157378_13129222 | Ga0157378_131292222 | 81 |
| 225 | 3300013306 | Ga0163162_11474058 | Ga0163162_114740582 | 81 |
| 226 | 3300014497 | Ga0182008_10409812 | Ga0182008_104098122 | 81 |
| 227 | 3300014968 | Ga0157379_10717378 | Ga0157379_107173782 | 81 |
| 228 | 3300014969 | Ga0157376_11403355 | Ga0157376_114033551 | 81 |
| 229 | 3300014969 | Ga0157376_11894971 | Ga0157376_118949711 | 81 |
| 230 | 3300025315 | Ga0207697_10081025 | Ga0207697_100810252 | 81 |
| 231 | 3300025900 | Ga0207710_10229700 | Ga0207710_102297002 | 81 |
| 232 | 3300025901 | Ga0207688_10376413 | Ga0207688_103764132 | 81 |
| 233 | 3300025907 | Ga0207645_10120830 | Ga0207645_101208302 | 81 |
| 234 | 3300025910 | Ga0207684_10129217 | Ga0207684_101292172 | 81 |
| 235 | 3300025922 | Ga0207646_10078850 | Ga0207646_100788503 | 81 |
| 236 | 3300025925 | Ga0207650_10133713 | Ga0207650_101337132 | 81 |
| 237 | 3300025927 | Ga0207687_10572691 | Ga0207687_105726911 | 81 |
| 238 | 3300025960 | Ga0207651_10668837 | Ga0207651_106688372 | 81 |
| 239 | 3300025960 | Ga0207651_10949400 | Ga0207651_109494001 | 81 |
| 240 | 3300026023 | Ga0207677_11639183 | Ga0207677_116391831 | 81 |
| 241 | 3300026041 | Ga0207639_10221169 | Ga0207639_102211692 | 81 |
| 242 | 3300026089 | Ga0207648_12020874 | Ga0207648_120208741 | 81 |
| 243 | 3300027907 | Ga0207428_10275178 | Ga0207428_102751782 | 81 |
| 244 | 3300028379 | Ga0268266_10006545 | Ga0268266_100065454 | 81 |
| 245 | 3300028379 | Ga0268266_10448558 | Ga0268266_104485582 | 81 |
| 246 | 3300028379 | Ga0268266_11861693 | Ga0268266_118616932 | 81 |
| 247 | 3300028380 | Ga0268265_11189049 | Ga0268265_111890492 | 81 |
| 248 | 3300028380 | Ga0268265_11460486 | Ga0268265_114604861 | 81 |
| 249 | 3300031238 | Ga0265332_10279176 | Ga0265332_102791761 | 81 |
| 250 | 3300031238 | Ga0265332_10304342 | Ga0265332_103043421 | 81 |
| 251 | 3300031241 | Ga0265325_10125519 | Ga0265325_101255191 | 81 |
| 252 | 3300031250 | Ga0265331_10080081 | Ga0265331_100800811 | 81 |
| 253 | 3300031344 | Ga0265316_10510965 | Ga0265316_105109652 | 81 |
| 254 | 3300031711 | Ga0265314_10580198 | Ga0265314_105801981 | 81 |
| 255 | 3300032005 | Ga0307411_10545095 | Ga0307411_105450952 | 81 |
| 256 | 3300034816 | Ga0373930_0143299 | Ga0373930_0143299_227_472 | 81 |
| 257 | 3300035084 | Ga0373928_0178761 | Ga0373928_0178761_259_504 | 81 |
| 258 | 3300035086 | Ga0373934_0090837 | Ga0373934_0090837_126_371 | 81 |
| 259 | 3300035088 | Ga0373940_0279340 | Ga0373940_0279340_186_431 | 81 |
| 260 | 3300035112 | Ga0373932_0074821 | Ga0373932_0074821_58_303 | 81 |
| 261 | 3300035241 | Ga0373961_0315929 | Ga0373961_0315929_104_349 | 81 |
| 262 | 3300035691 | Ga0373931_0084610 | Ga0373931_0084610_732_977 | 81 |
| 263 | 3300035695 | Ga0373927_0156311 | Ga0373927_0156311_97_342 | 81 |
| 264 | 3300036401 | Ga0373937_0123180 | Ga0373937_0123180_1020_1265 | 81 |
| 265 | 3300037068 | Ga0373925_1010362 | Ga0373925_1010362_368_613 | 81 |
| 266 | 3300039453 | Ga0436362_1069785 | Ga0436362_1069785_1725_1970 | 81 |
| 267 | 3300041443 | Ga0451789_0991220 | Ga0451789_0991220_524_769 | 81 |
| 268 | 3300041451 | Ga0451791_0896702 | Ga0451791_0896702_270_515 | 81 |
| 269 | 3300041486 | Ga0451807_0841591 | Ga0451807_0841591_351_596 | 81 |
| 270 | 3300041491 | Ga0451833_1261752 | Ga0451833_1261752_441_686 | 81 |
| 271 | 3300042157 | Ga0439458_0023025 | Ga0439458_0023025_225_470 | 81 |
| 272 | 3300047444 | Ga0495675_0760616 | Ga0495675_0760616_176_421 | 81 |
| 273 | 3300049579 | Ga0501043_0314221 | Ga0501043_0314221_422_667 | 81 |
| 274 | 3300049580 | Ga0501046_0076488 | Ga0501046_0076488_1873_2118 | 81 |
| 275 | 3300049581 | Ga0501047_0368113 | Ga0501047_0368113_541_786 | 81 |
| 276 | 3300049586 | Ga0501070_0181738 | Ga0501070_0181738_1197_1442 | 81 |
| 277 | 3300049823 | Ga0501044_1017269 | Ga0501044_1017269_165_410 | 81 |
| 278 | 3300050489 | nmdc:mga03683_129650_c1 | nmdc:mga03683_129650_c1_388_642 | 81 |
| 279 | 3300050489 | nmdc:mga03683_1326_c3 | nmdc:mga03683_1326_c3_856_1101 | 81 |
| 280 | 3300050489 | nmdc:mga03683_307638_c1 | nmdc:mga03683_307638_c1_264_518 | 81 |
| 281 | 3300050489 | nmdc:mga03683_638767_c1 | nmdc:mga03683_638767_c1_243_488 | 81 |
| 282 | 3300050489 | nmdc:mga03683_79543_c1 | nmdc:mga03683_79543_c1_700_957 | 81 |
| 283 | 3300050489 | nmdc:mga03683_96962_c1 | nmdc:mga03683_96962_c1_482_727 | 81 |
| 284 | 3300050491 | nmdc:mga00v17_249254_c1 | nmdc:mga00v17_249254_c1_160_417 | 81 |
| 285 | 3300050491 | nmdc:mga00v17_576800_c1 | nmdc:mga00v17_576800_c1_451_708 | 81 |
| 286 | 3300050491 | nmdc:mga00v17_864596_c1 | nmdc:mga00v17_864596_c1_67_312 | 81 |
| 287 | 3300050492 | nmdc:mga0yw44_114792_c1 | nmdc:mga0yw44_114792_c1_328_585 | 81 |
| 288 | 3300050492 | nmdc:mga0yw44_134164_c1 | nmdc:mga0yw44_134164_c1_58_315 | 81 |
| 289 | 3300050492 | nmdc:mga0yw44_13422_c1 | nmdc:mga0yw44_13422_c1_1213_1458 | 81 |
| 290 | 3300050492 | nmdc:mga0yw44_196439_c2 | nmdc:mga0yw44_196439_c2_214_459 | 81 |
| 291 | 3300050492 | nmdc:mga0yw44_220108_c1 | nmdc:mga0yw44_220108_c1_562_807 | 81 |
| 292 | 3300050492 | nmdc:mga0yw44_229090_c1 | nmdc:mga0yw44_229090_c1_934_1191 | 81 |
| 293 | 3300050492 | nmdc:mga0yw44_985965_c1 | nmdc:mga0yw44_985965_c1_143_388 | 81 |
| 294 | 3300050493 | nmdc:mga0k408_236404_c1 | nmdc:mga0k408_236404_c1_735_992 | 81 |
| 295 | 3300050493 | nmdc:mga0k408_73480_c1 | nmdc:mga0k408_73480_c1_441_686 | 81 |
| 296 | 3300050493 | nmdc:mga0k408_78215_c1 | nmdc:mga0k408_78215_c1_247_492 | 81 |
| 297 | 3300050494 | nmdc:mga06z11_13450_c1 | nmdc:mga06z11_13450_c1_77_322 | 81 |
| 298 | 3300050494 | nmdc:mga06z11_304571_c1 | nmdc:mga06z11_304571_c1_81_326 | 81 |
| 299 | 3300050494 | nmdc:mga06z11_901337_c1 | nmdc:mga06z11_901337_c1_218_463 | 81 |
| 300 | 3300050496 | nmdc:mga07m45_32923_c1 | nmdc:mga07m45_32923_c1_1321_1566 | 81 |
| 301 | 3300050496 | nmdc:mga07m45_892094_c1 | nmdc:mga07m45_892094_c1_154_411 | 81 |
| 302 | 3300050511 | nmdc:mga08y16_543668_c1 | nmdc:mga08y16_543668_c1_880_1125 | 81 |
| 303 | 3300050516 | nmdc:mga0sz30_75875_c1 | nmdc:mga0sz30_75875_c1_89_346 | 81 |
| 304 | 3300050516 | nmdc:mga0sz30_77_c1 | nmdc:mga0sz30_77_c1_23648_23893 | 81 |
| 305 | 3300053086 | Ga0500578_0653904 | Ga0500578_0653904_38_283 | 81 |
| 306 | 3300053087 | Ga0500643_065529 | Ga0500643_065529_199_456 | 81 |
| 307 | 3300053087 | Ga0500643_137002 | Ga0500643_137002_363_641 | 81 |
| 308 | 3300053088 | Ga0500644_0010230 | Ga0500644_0010230_2153_2398 | 81 |
| 309 | 3300053088 | Ga0500644_0261617 | Ga0500644_0261617_274_531 | 81 |
| 310 | 3300053092 | Ga0500583_0588846 | Ga0500583_0588846_64_321 | 81 |
| 311 | 3300053093 | Ga0500651_0017479 | Ga0500651_0017479_3141_3386 | 81 |
| 312 | 3300053093 | Ga0500651_0514290 | Ga0500651_0514290_353_610 | 81 |
| 313 | 3300053093 | Ga0500651_0529645 | Ga0500651_0529645_318_575 | 81 |
| 314 | 3300053098 | Ga0500650_0208643 | Ga0500650_0208643_73_330 | 81 |
| 315 | 3300053119 | Ga0500595_120430 | Ga0500595_120430_165_425 | 81 |
| 316 | 3300053142 | Ga0500577_0282846 | Ga0500577_0282846_127_384 | 81 |
| 317 | 3300053153 | Ga0500616_0004217 | Ga0500616_0004217_8191_8448 | 81 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar