F404064

General Info

Members Datasets Scaffolds Average Seq Length
317 200 634 327

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100383769|Ga0070679_1003837691
Length 371
Sequence MMAGMAAGAGVRRAVARGAAYTGYAAWRHREPVALPAPSGSALVSHANAALTPRARLKVAKLVVDRHVPVAEVAARFQCSWPTVKRWADRYAAGEPMADRSSRPHTMPAKTDLCVTRRIVSLRLRKRLGPVQLAALTGVAPSTAHRVLTRCRLNRLAHVDRATGEPVRRYEHPYPGAMIHVDVKKLGNIPDGGGWRFVGRPQGFRNRAATPDKPKNTRHNPRLGHAFVHTVIDDHSRVGYAEVHDDETAATAVAVLTRAVAWFAERGVSIQRVLSDNGSAYRSVAWADACSELGIKVSKTRPYRPQTNGKIERFHRTLADGWGYARCYESEAERRAALSAWIHEYNHHRPHTACENKPPITRLTNLSGQYS

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
112 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
113 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
114 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
184 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
187 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
188 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
191 2643221711 Terrabacter sp. Root85 Isolate Unclassified
192 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
193 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
194 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
195 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
196 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
197 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
198 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
199 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
200 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.58
Metatranscriptomes 0.63
Isolates 3.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.89
Nodule 0
Rhizoplane 16.4
Rhizosphere 76.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100383769 3300005530 Bacteria 1351
2 JGI25406J46586_10042410 3300003203 Bacteria 1593
3 rootL2_10124732 3300003322 Bacteria 1060
4 Ga0070658_10263977 3300005327 Bacteria 1463
5 Ga0070683_100199516 3300005329 Bacteria 1900
6 Ga0070683_100207604 3300005329 Bacteria 1860
7 Ga0070683_100343467 3300005329 Bacteria 1421
8 Ga0070683_100359416 3300005329 Bacteria 1387
9 Ga0070666_10081241 3300005335 Bacteria 2215
10 Ga0070680_100178037 3300005336 Bacteria 1790
11 Ga0070680_100212057 3300005336 Bacteria 1634
12 Ga0070660_100133522 3300005339 Bacteria 1988
13 Ga0070668_100056863 3300005347 Bacteria 3022
14 Ga0070668_100164787 3300005347 Bacteria 1801
15 Ga0070669_100231207 3300005353 Bacteria 1466
16 Ga0070675_100204720 3300005354 Bacteria 1713
17 Ga0070675_100325748 3300005354 Bacteria 1358
18 Ga0070671_100267282 3300005355 Bacteria 1454
19 Ga0070674_100263292 3300005356 Bacteria 1359
20 Ga0070673_100390817 3300005364 Bacteria 1242
21 Ga0070659_100102829 3300005366 Bacteria 2300
22 Ga0070659_100255181 3300005366 Bacteria 1454
23 Ga0070667_100373331 3300005367 Bacteria 1294
24 Ga0070714_100078476 3300005435 Bacteria 2870
25 Ga0070663_100289011 3300005455 Bacteria 1309
26 Ga0070678_100284732 3300005456 Bacteria 1399
27 Ga0070681_10229531 3300005458 Bacteria 1770
28 Ga0068867_100272749 3300005459 Bacteria 1384
29 Ga0070679_100132057 3300005530 Bacteria 2478
30 Ga0070684_100029623 3300005535 Bacteria 4641
31 Ga0070684_100078589 3300005535 Bacteria 2915
32 Ga0070684_100228790 3300005535 Bacteria 1698
33 Ga0070684_100264599 3300005535 Bacteria 1573
34 Ga0070665_100424392 3300005548 Bacteria 1338
35 Ga0068857_100298885 3300005577 Bacteria 1484
36 Ga0068856_100166740 3300005614 Bacteria 2213
37 Ga0070702_100247337 3300005615 Bacteria 1207
38 Ga0068852_100387561 3300005616 Bacteria 1372
39 Ga0068863_100042208 3300005841 Bacteria 4334
40 Ga0068860_100041292 3300005843 Bacteria 4406
41 Ga0081538_10062473 3300005981 Bacteria 2124
42 Ga0081538_10105685 3300005981 Bacteria 1400
43 Ga0081539_10049844 3300005985 Bacteria 2373
44 Ga0081539_10094705 3300005985 Bacteria 1536
45 Ga0081539_10118019 3300005985 Bacteria 1323
46 Ga0070717_10342424 3300006028 Bacteria 1335
47 Ga0075432_10000086 3300006058 Bacteria 19052
48 Ga0070715_10086792 3300006163 Bacteria 1431
49 Ga0075369_10005334 3300006186 Bacteria 4795
50 Ga0105250_10035996 3300009092 Bacteria 1987
51 Ga0105245_10216896 3300009098 Bacteria 1844
52 Ga0105243_10058674 3300009148 Bacteria 3068
53 Ga0105243_10157547 3300009148 Bacteria 1954
54 Ga0105243_10371852 3300009148 Bacteria 1319
55 Ga0105243_10382196 3300009148 Bacteria 1303
56 Ga0105242_10346873 3300009176 Bacteria 1370
57 Ga0105248_10205428 3300009177 Bacteria 2220
58 Ga0105238_10113853 3300009551 Bacteria 2684
59 Ga0105239_10290379 3300010375 Bacteria 1841
60 Ga0105246_10085247 3300011119 Bacteria 2262
61 Ga0105246_10156328 3300011119 Bacteria 1732
62 Ga0105246_10337930 3300011119 Bacteria 1230
63 Ga0157369_10323965 3300013105 Bacteria 1602
64 Ga0157369_10421929 3300013105 Bacteria 1383
65 Ga0157369_10472613 3300013105 Bacteria 1297
66 Ga0163162_10278966 3300013306 Bacteria 1803
67 Ga0163162_10334929 3300013306 Bacteria 1646
68 Ga0157372_10426418 3300013307 Bacteria 1546
69 Ga0157372_10519034 3300013307 Bacteria 1389
70 Ga0157372_10608618 3300013307 Bacteria 1273
71 Ga0157375_10480818 3300013308 Bacteria 1407
72 Ga0157377_10149880 3300014745 Bacteria 1441
73 Ga0206354_10008431 3300020081 Bacteria 3010
74 Ga0206353_12069287 3300020082 Bacteria 2131
75 Ga0207697_10001206 3300025315 Bacteria 14167
76 Ga0207688_10138248 3300025901 Bacteria 1432
77 Ga0207680_10284068 3300025903 Bacteria 1150
78 Ga0207647_10093913 3300025904 Bacteria 1787
79 Ga0207685_10057955 3300025905 Bacteria 1522
80 Ga0207645_10082164 3300025907 Bacteria 2065
81 Ga0207643_10092872 3300025908 Bacteria 1761
82 Ga0207705_10169507 3300025909 Bacteria 1643
83 Ga0207705_10349915 3300025909 Bacteria 1138
84 Ga0207707_10423436 3300025912 Bacteria 1141
85 Ga0207671_10158196 3300025914 Bacteria 1753
86 Ga0207663_10371851 3300025916 Bacteria 1087
87 Ga0207660_10196821 3300025917 Bacteria 1572
88 Ga0207657_10264515 3300025919 Bacteria 1368
89 Ga0207652_10334194 3300025921 Bacteria 1368
90 Ga0207652_10462559 3300025921 Bacteria 1143
91 Ga0207652_10469154 3300025921 Bacteria 1134
92 Ga0207650_10307388 3300025925 Bacteria 1296
93 Ga0207659_10139529 3300025926 Bacteria 1880
94 Ga0207687_10377197 3300025927 Bacteria 1161
95 Ga0207644_10223605 3300025931 Bacteria 1493
96 Ga0207690_10076852 3300025932 Bacteria 2319
97 Ga0207709_10289093 3300025935 Bacteria 1214
98 Ga0207691_10324465 3300025940 Bacteria 1320
99 Ga0207689_10319340 3300025942 Bacteria 1289
100 Ga0207661_10080723 3300025944 Bacteria 2684
101 Ga0207661_10364574 3300025944 Bacteria 1305
102 Ga0207679_10238070 3300025945 Bacteria 1541
103 Ga0207679_10346549 3300025945 Bacteria 1293
104 Ga0207651_10200723 3300025960 Bacteria 1598
105 Ga0207668_10203010 3300025972 Bacteria 1580
106 Ga0207677_10146935 3300026023 Bacteria 1813
107 Ga0207639_10273406 3300026041 Bacteria 1483
108 Ga0207678_10096381 3300026067 Bacteria 2528
109 Ga0207702_10533026 3300026078 Bacteria 1147
110 Ga0207641_10209640 3300026088 Bacteria 1801
111 Ga0207648_10270277 3300026089 Bacteria 1519
112 Ga0207648_10358724 3300026089 Bacteria 1315
113 Ga0207676_10463234 3300026095 Bacteria 1197
114 Ga0207683_10283958 3300026121 Bacteria 1513
115 Ga0207683_10381221 3300026121 Bacteria 1296
116 Ga0207698_10354598 3300026142 Bacteria 1387
117 Ga0207698_10404594 3300026142 Bacteria 1305
118 Ga0207428_10193834 3300027907 Bacteria 1531
119 Ga0268266_10415339 3300028379 Bacteria 1274
120 Ga0268264_10171160 3300028381 Bacteria 1964
121 Ga0307517_10224743 3300028786 Bacteria 1135
122 Ga0307408_100245650 3300031548 Bacteria 1473
123 Ga0316576_10265423 3300031727 Bacteria 1287
124 Ga0307405_10238873 3300031731 Bacteria 1344
125 Ga0307413_10160574 3300031824 Bacteria 1578
126 Ga0307413_10276844 3300031824 Bacteria 1260
127 Ga0307413_10423290 3300031824 Bacteria 1049
128 Ga0307518_10241891 3300031838 Bacteria 1156
129 Ga0307410_10300604 3300031852 Bacteria 1266
130 Ga0307410_10344670 3300031852 Bacteria 1188
131 Ga0307406_10025185 3300031901 Bacteria 3560
132 Ga0307406_10129553 3300031901 Bacteria 1769
133 Ga0307406_10172281 3300031901 Bacteria 1567
134 Ga0307406_10283592 3300031901 Bacteria 1264
135 Ga0307407_10050043 3300031903 Bacteria 2388
136 Ga0307407_10068153 3300031903 Bacteria 2106
137 Ga0307407_10130391 3300031903 Bacteria 1607
138 Ga0307409_100026171 3300031995 Bacteria 4109
139 Ga0307409_100073760 3300031995 Bacteria 2723
140 Ga0307409_100082269 3300031995 Bacteria 2606
141 Ga0307409_100102539 3300031995 Bacteria 2377
142 Ga0307409_100432549 3300031995 Bacteria 1265
143 Ga0307409_100469339 3300031995 Bacteria 1218
144 Ga0307416_100109732 3300032002 Bacteria 2427
145 Ga0307416_100196333 3300032002 Bacteria 1909
146 Ga0307416_100410065 3300032002 Bacteria 1395
147 Ga0307416_100461491 3300032002 Bacteria 1325
148 Ga0307416_100622489 3300032002 Bacteria 1161
149 Ga0307414_10211237 3300032004 Bacteria 1586
150 Ga0307414_10305669 3300032004 Bacteria 1347
151 Ga0307414_10373517 3300032004 Bacteria 1230
152 Ga0307414_10377765 3300032004 Bacteria 1224
153 Ga0307411_10128107 3300032005 Bacteria 1850
154 Ga0307411_10160154 3300032005 Bacteria 1684
155 Ga0307415_100153449 3300032126 Bacteria 1775
156 Ga0307415_100297926 3300032126 Bacteria 1334
157 Ga0307415_100381794 3300032126 Bacteria 1196
158 Ga0307415_100417346 3300032126 Bacteria 1150
159 Ga0307415_100435213 3300032126 Bacteria 1129
160 Ga0373937_0807379 3300036401 Bacteria 886
161 Ga0316582_0235971 3300036647 Bacteria 1252
162 Ga0316584_0157812 3300036712 Bacteria 1686
163 Ga0395900_0038293 3300037418 Bacteria 4942
164 Ga0395898_0124717 3300037466 Bacteria 2467
165 Ga0395905_0089920 3300037471 Bacteria 2878
166 Ga0395901_0356713 3300038443 Bacteria 1508
167 Ga0395901_0595924 3300038443 Bacteria 1115
168 Ga0436365_1669304 3300039437 Bacteria 1527
169 Ga0451791_0827613 3300041451 Bacteria 1646
170 Ga0451793_0789585 3300041452 Bacteria 1282
171 Ga0451795_1474053 3300041456 Bacteria 1576
172 Ga0466969_0027196 3300044656 Bacteria 2929
173 Ga0466969_0148827 3300044656 Bacteria 1079
174 Ga0466965_0060699 3300044683 Bacteria 1889
175 Ga0466966_0111574 3300044684 Bacteria 1685
176 Ga0466966_0325912 3300044684 Bacteria 923
177 Ga0466961_0124811 3300044693 Bacteria 1615
178 Ga0466961_0178869 3300044693 Bacteria 1317
179 Ga0466963_0166285 3300044694 Bacteria 1536
180 Ga0466964_0069870 3300044706 Bacteria 1482
181 Ga0466964_0082681 3300044706 Bacteria 1381
182 Ga0466971_0025695 3300044719 Bacteria 2630
183 Ga0466970_0184398 3300044765 Bacteria 1158
184 Ga0466957_0215642 3300044842 Bacteria 1265
185 Ga0466957_0446850 3300044842 Bacteria 890
186 Ga0466960_0089100 3300044901 Bacteria 1569
187 Ga0466960_0140480 3300044901 Bacteria 1282
188 Ga0466959_0148979 3300045049 Bacteria 1650
189 Ga0466959_0286162 3300045049 Bacteria 1130
190 Ga0466958_0009573 3300045836 Bacteria 5404
191 Ga0466958_0046485 3300045836 Bacteria 2619
192 Ga0466958_0112173 3300045836 Bacteria 1702
193 Ga0466958_0203733 3300045836 Bacteria 1259
194 Ga0466967_0032810 3300045976 Bacteria 4390
195 Ga0466967_0263866 3300045976 Bacteria 1648
196 Ga0466967_0447867 3300045976 Bacteria 1261
197 Ga0466967_0522998 3300045976 Bacteria 1166
198 Ga0466967_0525935 3300045976 Bacteria 1162
199 Ga0466967_0623932 3300045976 Bacteria 1065
200 Ga0495603_0104320 3300046455 Bacteria 1654
201 Ga0495590_0064371 3300046457 Bacteria 1283
202 Ga0495629_0274931 3300046459 Bacteria 1156
203 Ga0495629_0307706 3300046459 Bacteria 1084
204 Ga0495651_0142457 3300046462 Bacteria 1736
205 Ga0495650_0103404 3300046471 Bacteria 1067
206 Ga0495664_0183666 3300046477 Bacteria 1268
207 Ga0495584_0051002 3300046491 Bacteria 2084
208 Ga0495594_0059928 3300046499 Bacteria 2105
209 Ga0495608_0215109 3300046511 Bacteria 1207
210 Ga0495652_0265213 3300046529 Bacteria 1265
211 Ga0495587_0046181 3300046536 Bacteria 2586
212 Ga0495634_0136734 3300046642 Bacteria 1558
213 Ga0495635_0257323 3300046663 Bacteria 1176
214 Ga0495623_0162690 3300046679 Bacteria 1310
215 Ga0495613_0066368 3300046689 Bacteria 2635
216 Ga0495624_0214423 3300046690 Bacteria 1167
217 Ga0495600_0106957 3300046809 Bacteria 1822
218 Ga0495581_0194578 3300047315 Bacteria 1186
219 Ga0495604_0062234 3300047317 Bacteria 2852
220 Ga0495680_0286189 3300047322 Bacteria 1160
221 Ga0495684_0164634 3300047471 Bacteria 1652
222 Ga0495602_0200011 3300048088 Bacteria 1525
223 Ga0495614_0016797 3300048089 Bacteria 3184
224 Ga0496100_0010666 3300048903 Bacteria 5208
225 Ga0496100_0084255 3300048903 Bacteria 2154
226 Ga0496100_0245108 3300048903 Bacteria 1323
227 Ga0496101_0190269 3300048904 Bacteria 1583
228 Ga0496101_0313815 3300048904 Bacteria 1229
229 Ga0496102_0191432 3300048905 Bacteria 1927
230 Ga0496102_0430749 3300048905 Bacteria 1238
231 Ga0496102_0592522 3300048905 Bacteria 1031
232 Ga0496103_0189988 3300048906 Bacteria 1320
233 Ga0496104_0237209 3300048907 Bacteria 1735
234 Ga0496104_0239725 3300048907 Bacteria 1726
235 Ga0496104_0350278 3300048907 Bacteria 1389
236 Ga0496104_0440074 3300048907 Bacteria 1215
237 Ga0496104_0594107 3300048907 Bacteria 1017
238 Ga0496105_0211058 3300048908 Bacteria 1582
239 Ga0496105_0260454 3300048908 Bacteria 1402
240 Ga0496106_0182017 3300048909 Bacteria 1668
241 Ga0496106_0319821 3300048909 Bacteria 1245
242 Ga0496107_0128012 3300048910 Bacteria 1873
243 Ga0496107_0224214 3300048910 Bacteria 1398
244 Ga0496107_0234151 3300048910 Bacteria 1366
245 Ga0496108_0184415 3300048911 Bacteria 1807
246 Ga0496108_0210758 3300048911 Bacteria 1687
247 Ga0496108_0220933 3300048911 Bacteria 1646
248 Ga0496108_0410741 3300048911 Bacteria 1182
249 Ga0496108_0446519 3300048911 Bacteria 1130
250 Ga0496109_0020982 3300048912 Bacteria 5775
251 Ga0496109_0104856 3300048912 Bacteria 2625
252 Ga0496109_0391785 3300048912 Bacteria 1312
253 Ga0496109_0394756 3300048912 Bacteria 1307
254 Ga0496109_0433141 3300048912 Bacteria 1242
255 Ga0496109_0642192 3300048912 Bacteria 998
256 Ga0496110_0055056 3300048913 Bacteria 3500
257 Ga0496110_0250056 3300048913 Bacteria 1613
258 Ga0496110_0308536 3300048913 Bacteria 1441
259 Ga0496110_0499140 3300048913 Bacteria 1108
260 Ga0496110_0728850 3300048913 Bacteria 894
261 Ga0496111_0099847 3300048914 Bacteria 2132
262 Ga0496111_0106660 3300048914 Bacteria 2062
263 Ga0496111_0188455 3300048914 Bacteria 1533
264 Ga0496112_0265895 3300048915 Bacteria 1664
265 Ga0496112_0419932 3300048915 Bacteria 1276
266 Ga0496113_0086561 3300048916 Bacteria 2408
267 Ga0496113_0318861 3300048916 Bacteria 1245
268 Ga0496114_0007426 3300048917 Bacteria 8665
269 Ga0496114_0072924 3300048917 Bacteria 2888
270 Ga0496114_0093064 3300048917 Bacteria 2562
271 Ga0496114_0364472 3300048917 Bacteria 1278
272 Ga0496115_0310819 3300048918 Bacteria 1290
273 Ga0496117_0048246 3300048920 Bacteria 3044
274 Ga0496118_0176312 3300048921 Bacteria 1298
275 Ga0496119_0035341 3300048922 Bacteria 3276
276 Ga0496119_0055457 3300048922 Bacteria 2407
277 Ga0496125_0054837 3300048928 Bacteria 3254
278 Ga0496125_0109911 3300048928 Bacteria 2000
279 Ga0501034_0114266 3300049571 Bacteria 2688
280 Ga0501034_0325726 3300049571 Bacteria 1468
281 Ga0501034_0343769 3300049571 Bacteria 1421
282 Ga0501037_0061808 3300049573 Bacteria 2731
283 Ga0501043_0240503 3300049579 Bacteria 1396
284 Ga0501047_0321358 3300049581 Bacteria 1387
285 Ga0501070_0015744 3300049586 Bacteria 6359
286 Ga0501070_0060875 3300049586 Bacteria 3129
287 Ga0501073_0064840 3300049589 Bacteria 2547
288 Ga0501075_0163656 3300049591 Bacteria 1697
289 Ga0501080_0149155 3300049742 Bacteria 2162
290 Ga0501083_0063429 3300049744 Bacteria 2464
291 Ga0501083_0187842 3300049744 Bacteria 1349
292 Ga0501270_004853 3300049767 Bacteria 1531
293 Ga0501035_0278697 3300049822 Bacteria 1414
294 nmdc:mga0sz30_928_c2 3300050516 Bacteria 9558
295 Ga0495601_0030642 3300053077 Bacteria 3341
296 Ga0500610_0205232 3300053079 Bacteria 946
297 Ga0495595_0099728 3300053084 Bacteria 1401
298 Ga0495619_0168207 3300053085 Bacteria 1515
299 Ga0500588_0041939 3300053146 Bacteria 1383
300 Ga0500609_013314 3300053731 Bacteria 1113
301 Ga0500587_011053 3300053739 Bacteria 1142
302 Ga0501084_0179833 3300054114 Bacteria 1785
303 Ga0466962_0134923 3300061719 Bacteria 1194
304 Ga0466962_0135399 3300061719 Bacteria 1192
305 Ga0466962_0167080 3300061719 Bacteria 1070
306 2644609755 2643221711 Bacteria 4865335
307 2731905806 2731639228 Bacteria 4187555
308 2862291605 2862290372 Bacteria 7471434
309 2870790511 2870782633 Bacteria 9624083
310 2870790568 2870782633 Bacteria 9624083
311 2939749122 2939743619 Bacteria 5762299
312 2954727410 2954721474 Bacteria 10456478
313 2954740231 2954731030 Bacteria 10243860
314 2954740501 2954740390 Bacteria 10229294
315 2954766770 2954759201 Bacteria 9358192
316 8033685534 8033684223 Bacteria 6906479
317 8033690930 8033684223 Bacteria 6906479
318 Ga0070679_100383769
319 JGI25406J46586_10042410
320 rootL2_10124732
321 Ga0070658_10263977
322 Ga0070683_100199516
323 Ga0070683_100207604
324 Ga0070683_100343467
325 Ga0070683_100359416
326 Ga0070666_10081241
327 Ga0070680_100178037
328 Ga0070680_100212057
329 Ga0070660_100133522
330 Ga0070668_100056863
331 Ga0070668_100164787
332 Ga0070669_100231207
333 Ga0070675_100204720
334 Ga0070675_100325748
335 Ga0070671_100267282
336 Ga0070674_100263292
337 Ga0070673_100390817
338 Ga0070659_100102829
339 Ga0070659_100255181
340 Ga0070667_100373331
341 Ga0070714_100078476
342 Ga0070663_100289011
343 Ga0070678_100284732
344 Ga0070681_10229531
345 Ga0068867_100272749
346 Ga0070679_100132057
347 Ga0070684_100029623
348 Ga0070684_100078589
349 Ga0070684_100228790
350 Ga0070684_100264599
351 Ga0070665_100424392
352 Ga0068857_100298885
353 Ga0068856_100166740
354 Ga0070702_100247337
355 Ga0068852_100387561
356 Ga0068863_100042208
357 Ga0068860_100041292
358 Ga0081538_10062473
359 Ga0081538_10105685
360 Ga0081539_10049844
361 Ga0081539_10094705
362 Ga0081539_10118019
363 Ga0070717_10342424
364 Ga0075432_10000086
365 Ga0070715_10086792
366 Ga0075369_10005334
367 Ga0105250_10035996
368 Ga0105245_10216896
369 Ga0105243_10058674
370 Ga0105243_10157547
371 Ga0105243_10371852
372 Ga0105243_10382196
373 Ga0105242_10346873
374 Ga0105248_10205428
375 Ga0105238_10113853
376 Ga0105239_10290379
377 Ga0105246_10085247
378 Ga0105246_10156328
379 Ga0105246_10337930
380 Ga0157369_10323965
381 Ga0157369_10421929
382 Ga0157369_10472613
383 Ga0163162_10278966
384 Ga0163162_10334929
385 Ga0157372_10426418
386 Ga0157372_10519034
387 Ga0157372_10608618
388 Ga0157375_10480818
389 Ga0157377_10149880
390 Ga0206354_10008431
391 Ga0206353_12069287
392 Ga0207697_10001206
393 Ga0207688_10138248
394 Ga0207680_10284068
395 Ga0207647_10093913
396 Ga0207685_10057955
397 Ga0207645_10082164
398 Ga0207643_10092872
399 Ga0207705_10169507
400 Ga0207705_10349915
401 Ga0207707_10423436
402 Ga0207671_10158196
403 Ga0207663_10371851
404 Ga0207660_10196821
405 Ga0207657_10264515
406 Ga0207652_10334194
407 Ga0207652_10462559
408 Ga0207652_10469154
409 Ga0207650_10307388
410 Ga0207659_10139529
411 Ga0207687_10377197
412 Ga0207644_10223605
413 Ga0207690_10076852
414 Ga0207709_10289093
415 Ga0207691_10324465
416 Ga0207689_10319340
417 Ga0207661_10080723
418 Ga0207661_10364574
419 Ga0207679_10238070
420 Ga0207679_10346549
421 Ga0207651_10200723
422 Ga0207668_10203010
423 Ga0207677_10146935
424 Ga0207639_10273406
425 Ga0207678_10096381
426 Ga0207702_10533026
427 Ga0207641_10209640
428 Ga0207648_10270277
429 Ga0207648_10358724
430 Ga0207676_10463234
431 Ga0207683_10283958
432 Ga0207683_10381221
433 Ga0207698_10354598
434 Ga0207698_10404594
435 Ga0207428_10193834
436 Ga0268266_10415339
437 Ga0268264_10171160
438 Ga0307517_10224743
439 Ga0307408_100245650
440 Ga0316576_10265423
441 Ga0307405_10238873
442 Ga0307413_10160574
443 Ga0307413_10276844
444 Ga0307413_10423290
445 Ga0307518_10241891
446 Ga0307410_10300604
447 Ga0307410_10344670
448 Ga0307406_10025185
449 Ga0307406_10129553
450 Ga0307406_10172281
451 Ga0307406_10283592
452 Ga0307407_10050043
453 Ga0307407_10068153
454 Ga0307407_10130391
455 Ga0307409_100026171
456 Ga0307409_100073760
457 Ga0307409_100082269
458 Ga0307409_100102539
459 Ga0307409_100432549
460 Ga0307409_100469339
461 Ga0307416_100109732
462 Ga0307416_100196333
463 Ga0307416_100410065
464 Ga0307416_100461491
465 Ga0307416_100622489
466 Ga0307414_10211237
467 Ga0307414_10305669
468 Ga0307414_10373517
469 Ga0307414_10377765
470 Ga0307411_10128107
471 Ga0307411_10160154
472 Ga0307415_100153449
473 Ga0307415_100297926
474 Ga0307415_100381794
475 Ga0307415_100417346
476 Ga0307415_100435213
477 Ga0373937_0807379
478 Ga0316582_0235971
479 Ga0316584_0157812
480 Ga0395900_0038293
481 Ga0395898_0124717
482 Ga0395905_0089920
483 Ga0395901_0356713
484 Ga0395901_0595924
485 Ga0436365_1669304
486 Ga0451791_0827613
487 Ga0451793_0789585
488 Ga0451795_1474053
489 Ga0466969_0027196
490 Ga0466969_0148827
491 Ga0466965_0060699
492 Ga0466966_0111574
493 Ga0466966_0325912
494 Ga0466961_0124811
495 Ga0466961_0178869
496 Ga0466963_0166285
497 Ga0466964_0069870
498 Ga0466964_0082681
499 Ga0466971_0025695
500 Ga0466970_0184398
501 Ga0466957_0215642
502 Ga0466957_0446850
503 Ga0466960_0089100
504 Ga0466960_0140480
505 Ga0466959_0148979
506 Ga0466959_0286162
507 Ga0466958_0009573
508 Ga0466958_0046485
509 Ga0466958_0112173
510 Ga0466958_0203733
511 Ga0466967_0032810
512 Ga0466967_0263866
513 Ga0466967_0447867
514 Ga0466967_0522998
515 Ga0466967_0525935
516 Ga0466967_0623932
517 Ga0495603_0104320
518 Ga0495590_0064371
519 Ga0495629_0274931
520 Ga0495629_0307706
521 Ga0495651_0142457
522 Ga0495650_0103404
523 Ga0495664_0183666
524 Ga0495584_0051002
525 Ga0495594_0059928
526 Ga0495608_0215109
527 Ga0495652_0265213
528 Ga0495587_0046181
529 Ga0495634_0136734
530 Ga0495635_0257323
531 Ga0495623_0162690
532 Ga0495613_0066368
533 Ga0495624_0214423
534 Ga0495600_0106957
535 Ga0495581_0194578
536 Ga0495604_0062234
537 Ga0495680_0286189
538 Ga0495684_0164634
539 Ga0495602_0200011
540 Ga0495614_0016797
541 Ga0496100_0010666
542 Ga0496100_0084255
543 Ga0496100_0245108
544 Ga0496101_0190269
545 Ga0496101_0313815
546 Ga0496102_0191432
547 Ga0496102_0430749
548 Ga0496102_0592522
549 Ga0496103_0189988
550 Ga0496104_0237209
551 Ga0496104_0239725
552 Ga0496104_0350278
553 Ga0496104_0440074
554 Ga0496104_0594107
555 Ga0496105_0211058
556 Ga0496105_0260454
557 Ga0496106_0182017
558 Ga0496106_0319821
559 Ga0496107_0128012
560 Ga0496107_0224214
561 Ga0496107_0234151
562 Ga0496108_0184415
563 Ga0496108_0210758
564 Ga0496108_0220933
565 Ga0496108_0410741
566 Ga0496108_0446519
567 Ga0496109_0020982
568 Ga0496109_0104856
569 Ga0496109_0391785
570 Ga0496109_0394756
571 Ga0496109_0433141
572 Ga0496109_0642192
573 Ga0496110_0055056
574 Ga0496110_0250056
575 Ga0496110_0308536
576 Ga0496110_0499140
577 Ga0496110_0728850
578 Ga0496111_0099847
579 Ga0496111_0106660
580 Ga0496111_0188455
581 Ga0496112_0265895
582 Ga0496112_0419932
583 Ga0496113_0086561
584 Ga0496113_0318861
585 Ga0496114_0007426
586 Ga0496114_0072924
587 Ga0496114_0093064
588 Ga0496114_0364472
589 Ga0496115_0310819
590 Ga0496117_0048246
591 Ga0496118_0176312
592 Ga0496119_0035341
593 Ga0496119_0055457
594 Ga0496125_0054837
595 Ga0496125_0109911
596 Ga0501034_0114266
597 Ga0501034_0325726
598 Ga0501034_0343769
599 Ga0501037_0061808
600 Ga0501043_0240503
601 Ga0501047_0321358
602 Ga0501070_0015744
603 Ga0501070_0060875
604 Ga0501073_0064840
605 Ga0501075_0163656
606 Ga0501080_0149155
607 Ga0501083_0063429
608 Ga0501083_0187842
609 Ga0501270_004853
610 Ga0501035_0278697
611 nmdc:mga0sz30_928_c2
612 Ga0495601_0030642
613 Ga0500610_0205232
614 Ga0495595_0099728
615 Ga0495619_0168207
616 Ga0500588_0041939
617 Ga0500609_013314
618 Ga0500587_011053
619 Ga0501084_0179833
620 Ga0466962_0134923
621 Ga0466962_0135399
622 Ga0466962_0167080
623 2644609755
624 2731905806
625 2862291605
626 2870790511
627 2870790568
628 2939749122
629 2954727410
630 2954740231
631 2954740501
632 2954766770
633 8033685534
634 8033690930

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13683

rve_3

Integrase core domain

293

359

0.98

PF13542

HTH_Tnp_ISL3

Helix-turn-helix domain of transposase family ISL3

46

92

0.94

PF13384

HTH_23

Homeodomain-like domain

50

96

0.91

PF13518

HTH_28

Helix-turn-helix domain

55

105

0.9

PF00665

rve

Integrase core domain

172

305

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cz2-assembly2.cif.gz_D crystal structure of a two-domain fragment of mmtv integrase 0.8606 133 321
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.8602 72 111
5cz2-assembly1.cif.gz_B crystal structure of a two-domain fragment of mmtv integrase 0.8582 133 321
8a1p-assembly1.cif.gz_D hiv-1 integrase catalytic core domain and c-terminal domain in complex with allosteric integrase inhibitor bi-d 0.8559 185 305
3vfz-assembly3.cif.gz_B crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.855 13 56
ID Description Score Start End Superfamily
af_A0A0P0Y3M7_58_149_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.9076 11 46 1.10.472.10
af_P0CF80_124_283_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8826 131 320 3.30.420.10
3klnC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8786 71 111 1.10.10.10
4l5jC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8755 10 52 1.10.10.10
af_P9WKH9_102_261_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8711 131 317 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A6I5HRN0-F1-model_v4 IS481 family transposase 0.9425 137 330 GO:0003676
GO:0015074
AF-A0A7W9PSM9-F1-model_v4 Transposase InsO family protein 0.9417 186 330 GO:0003676
GO:0015074
AF-A0A7X3I4W4-F1-model_v4 Transposase family protein 0.94 205 330 GO:0003676
GO:0015074
AF-A0A1Y3XXR0-F1-model_v4 Integrase catalytic domain-containing protein 0.9386 216 325 GO:0003676
GO:0015074
AF-A0A6N3S2H1-F1-model_v4 deleted 0.938 141 323

Map