F403823

General Info

Members Datasets Scaffolds Average Seq Length
316 155 630 410

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0000111|Ga0495603_0000111_31482_32777
Length 431
Sequence MAARLHSPVSSEKLSVLQIPTPEVFLPLLADTAPDGRPARYKAAHGGRGSGKSHFFGDLWLDENVSGKYDFVCLRETLKSLEFSVKKLLEGKIAQFNAGAYFDVQDRRILSKLGGVTIFEGMQNHTAESIKSLEGFDRAWFEEAQNGSDKSLTMLRPTIRKPGSQLWFGWNPSKATDPVDMLLRGPELPPGAIVVEANYLDNPWLPQELRDEMEFDKRRDPDKYAHVWLGQYQQNSEARVFKNWRVEEFERPEGTIFRLGADWGFSVDPTVLIRCDIQGHLLYVDYEAYQVGCEIVNLPELFMSVPDAEKWPITADSARPETISHMQKNGFPKIRPAIKGAKSLEEGVEFLKSFDIIVHPRCKHLIDELSLYKYKEDPLTGAILPILEDKDNHVIDALRYACEGARRAGKAPKPSKPVVRRPIVGAGGWLA

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
18 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
19 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
20 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
21 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
22 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
23 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
24 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
25 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
27 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
37 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
38 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
39 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
40 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
41 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
42 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
43 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
44 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
45 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
46 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
47 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
48 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
49 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
50 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
51 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
52 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
53 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
54 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
55 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
56 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
57 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
58 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
59 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
60 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
61 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
62 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
63 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
64 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
65 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
66 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
67 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
68 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
69 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
70 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
71 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
72 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
73 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
74 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
75 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
76 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
77 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
78 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
79 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
80 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
81 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
82 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
83 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
84 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
87 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
88 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
89 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
90 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
91 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
92 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
93 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
94 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
99 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
100 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
101 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
102 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
103 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
104 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
107 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
108 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
109 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
112 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
113 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
114 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
115 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
122 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
123 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
124 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
125 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
126 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
127 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
130 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
131 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
146 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
147 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
148 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
149 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
150 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
151 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
152 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
153 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
154 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
155 2818991452 Burkholderia cepacia 561 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 0.32
Isolates 0.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.11
Nodule 0.63
Rhizoplane 6.65
Rhizosphere 85.13
Stem 0
Stem Tuber 0
Unclassified 0.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0000111 3300046455 Bacteria 39110
2 JGI25151J46595_10000503 3300003187 Bacteria 36687
3 JGI25151J46595_10000643 3300003187 Bacteria 30058
4 rootH1_10026516 3300003316 Bacteria 5498
5 rootH2_10003522 3300003320 Bacteria 3571
6 rootL2_10108082 3300003322 Bacteria 13271
7 rootL2_10144164 3300003322 Bacteria 4459
8 rootH1_10047995 3300003323 Unclassified 13904
9 rootH1_10187729 3300003323 Bacteria 3379
10 Ga0055536_1000083 3300003781 Bacteria 81693
11 Ga0055530_10001035 3300003791 Bacteria 22156
12 Ga0055540_1000148 3300003792 Bacteria 70105
13 Ga0055531_10001558 3300003794 Bacteria 16773
14 Ga0065714_10067090 3300005288 Bacteria 5900
15 Ga0070658_10002969 3300005327 Bacteria 14055
16 Ga0068869_100000258 3300005334 Bacteria 27877
17 Ga0070682_100054707 3300005337 Bacteria 2505
18 Ga0070701_10061800 3300005438 Bacteria 1976
19 Ga0068857_100000199 3300005577 Bacteria 38975
20 Ga0068865_100041852 3300006881 Viruses 3120
21 Ga0079104_1000001 3300006946 Bacteria 521847
22 Ga0105250_10003572 3300009092 Bacteria 7331
23 Ga0105248_10116043 3300009177 Bacteria 3020
24 Ga0157370_10054992 3300013104 Bacteria 3794
25 Ga0157369_10000754 3300013105 Bacteria 41721
26 Ga0182006_1000347 3300015261 Bacteria 39368
27 Ga0224712_10036333 3300022467 Bacteria 1825
28 Ga0209676_1000380 3300025292 Bacteria 81727
29 Ga0209025_1001364 3300025294 Bacteria 32753
30 Ga0209025_1001494 3300025294 Bacteria 30270
31 Ga0209050_1000738 3300025298 Bacteria 47442
32 Ga0209051_1000155 3300025303 Bacteria 129560
33 Ga0209257_1000236 3300025304 Bacteria 129543
34 Ga0207696_1021280 3300025711 Viruses 2079
35 Ga0207705_10000545 3300025909 Bacteria 31747
36 Ga0207662_10070524 3300025918 Viruses 2114
37 Ga0207689_10002891 3300025942 Bacteria 15843
38 Ga0207702_10005124 3300026078 Bacteria 11522
39 Ga0207674_10000893 3300026116 Bacteria 38974
40 Ga0209281_1000057 3300027111 Bacteria 307145
41 Ga0265327_10000965 3300031251 Bacteria 41202
42 Ga0307408_100067328 3300031548 Viruses 2633
43 Ga0307405_10000096 3300031731 Bacteria 37306
44 Ga0307412_10014167 3300031911 Viruses 4695
45 Ga0373947_0014309 3300035725 Viruses 4551
46 Ga0395899_0018102 3300037312 Bacteria 5361
47 Ga0395899_0045472 3300037312 Viruses 3271
48 Ga0395900_0001034 3300037418 Bacteria 35687
49 Ga0395900_0001289 3300037418 Bacteria 30582
50 Ga0395900_0001888 3300037418 Bacteria 23837
51 Ga0395900_0003641 3300037418 Bacteria 16566
52 Ga0395900_0019055 3300037418 Bacteria 6997
53 Ga0395900_0052773 3300037418 Viruses 4185
54 Ga0395900_0201643 3300037418 Viruses 2012
55 Ga0395898_0002112 3300037466 Bacteria 24569
56 Ga0395898_0002641 3300037466 Bacteria 20848
57 Ga0395898_0005854 3300037466 Bacteria 13222
58 Ga0395898_0006702 3300037466 Bacteria 12280
59 Ga0395898_0012048 3300037466 Bacteria 8951
60 Ga0395898_0058169 3300037466 Viruses 3764
61 Ga0395898_0092143 3300037466 Viruses 2914
62 Ga0395898_0173278 3300037466 Bacteria 2062
63 Ga0395898_0332955 3300037466 Viruses 1448
64 Ga0395905_0001218 3300037471 Bacteria 32067
65 Ga0395905_0001313 3300037471 Bacteria 30573
66 Ga0395905_0005790 3300037471 Viruses 12555
67 Ga0395905_0177299 3300037471 Viruses 2000
68 Ga0395901_0000547 3300038443 Bacteria 43355
69 Ga0395901_0000623 3300038443 Bacteria 41125
70 Ga0395901_0000724 3300038443 Bacteria 37510
71 Ga0395901_0016524 3300038443 Bacteria 7521
72 Ga0395901_0086652 3300038443 Viruses 3274
73 Ga0439452_008779 3300042010 Bacteria 3018
74 Ga0439452_010334 3300042010 Viruses 2718
75 Ga0450923_000008 3300042125 Viruses 18260
76 Ga0450890_002259 3300042127 Bacteria 2675
77 Ga0439446_0005656 3300042156 Viruses 3222
78 Ga0439446_0023338 3300042156 Bacteria 1759
79 Ga0451577_0005991 3300042876 Viruses 12243
80 Ga0466969_0000122 3300044656 Bacteria 41561
81 Ga0466969_0001287 3300044656 Viruses 13539
82 Ga0466969_0005797 3300044656 Viruses 6562
83 Ga0466972_0000385 3300044658 Bacteria 23613
84 Ga0453683_0003180 3300044673 Bacteria 12210
85 Ga0453683_0020646 3300044673 Viruses 4209
86 Ga0466966_0000231 3300044684 Bacteria 37224
87 Ga0466966_0003277 3300044684 Viruses 10671
88 Ga0466961_0000250 3300044693 Bacteria 36056
89 Ga0466961_0001150 3300044693 Bacteria 16249
90 Ga0466961_0003280 3300044693 Bacteria 10081
91 Ga0466963_0005040 3300044694 Bacteria 7718
92 Ga0453684_0003776 3300044712 Bacteria 33486
93 Ga0453684_0013710 3300044712 Unclassified 13123
94 Ga0453684_0049499 3300044712 Viruses 5542
95 Ga0453684_0062815 3300044712 Viruses 4754
96 Ga0466968_0025668 3300044735 Bacteria 2414
97 Ga0466970_0000081 3300044765 Bacteria 39013
98 Ga0466970_0000293 3300044765 Bacteria 24468
99 Ga0466957_0001104 3300044842 Bacteria 13959
100 Ga0466959_0000080 3300045049 Bacteria 60034
101 Ga0466959_0000377 3300045049 Bacteria 26404
102 Ga0451576_0006335 3300045051 Bacteria 14541
103 Ga0451576_0014823 3300045051 Viruses 8664
104 Ga0466958_0002697 3300045836 Viruses 9001
105 Ga0495617_002901 3300046452 Bacteria 6594
106 Ga0495603_0003545 3300046455 Bacteria 9289
107 Ga0495603_0010852 3300046455 Bacteria 5527
108 Ga0495590_0004281 3300046457 Bacteria 5769
109 Ga0495629_0002159 3300046459 Bacteria 15189
110 Ga0495629_0009923 3300046459 Bacteria 6948
111 Ga0495629_0016684 3300046459 Bacteria 5270
112 Ga0495629_0033001 3300046459 Bacteria 3663
113 Ga0495629_0033187 3300046459 Bacteria 3652
114 Ga0495641_0000349 3300046461 Bacteria 37952
115 Ga0495651_0000325 3300046462 Viruses 37010
116 Ga0495651_0006753 3300046462 Bacteria 8767
117 Ga0495653_0000730 3300046463 Bacteria 25083
118 Ga0495653_0006777 3300046463 Bacteria 9408
119 Ga0495653_0062130 3300046463 Bacteria 2823
120 Ga0495650_0001381 3300046471 Bacteria 23924
121 Ga0495650_0001414 3300046471 Bacteria 23335
122 Ga0495582_0006396 3300046473 Bacteria 6546
123 Ga0495582_0009892 3300046473 Bacteria 5247
124 Ga0495582_0010126 3300046473 Bacteria 5192
125 Ga0495605_0014970 3300046474 Bacteria 4229
126 Ga0495605_0042553 3300046474 Bacteria 2257
127 Ga0495639_0020415 3300046475 Bacteria 2895
128 Ga0495662_0000107 3300046476 Bacteria 30762
129 Ga0495664_0000126 3300046477 Bacteria 38783
130 Ga0495664_0013751 3300046477 Bacteria 4588
131 Ga0495664_0035305 3300046477 Bacteria 2943
132 Ga0495594_0002595 3300046499 Bacteria 9398
133 Ga0495594_0010330 3300046499 Bacteria 4839
134 Ga0495596_0000237 3300046500 Bacteria 37501
135 Ga0495596_0016485 3300046500 Bacteria 3069
136 Ga0495607_0001511 3300046501 Bacteria 20501
137 Ga0495607_0029637 3300046501 Bacteria 3367
138 Ga0495583_0000802 3300046506 Bacteria 38794
139 Ga0495606_0001090 3300046507 Bacteria 38882
140 Ga0495606_0001187 3300046507 Bacteria 36720
141 Ga0495606_0001867 3300046507 Bacteria 26420
142 Ga0495606_0001944 3300046507 Bacteria 25548
143 Ga0495606_0001954 3300046507 Bacteria 25455
144 Ga0495616_0000144 3300046513 Bacteria 62419
145 Ga0495618_0008292 3300046514 Bacteria 6292
146 Ga0495618_0053939 3300046514 Bacteria 2542
147 Ga0495628_0000426 3300046516 Bacteria 38454
148 Ga0495628_0007412 3300046516 Bacteria 9497
149 Ga0495628_0037683 3300046516 Bacteria 3875
150 Ga0495628_0093774 3300046516 Bacteria 2321
151 Ga0495630_0000384 3300046517 Bacteria 34735
152 Ga0495630_0013690 3300046517 Bacteria 5897
153 Ga0495630_0026684 3300046517 Bacteria 4278
154 Ga0495630_0038231 3300046517 Bacteria 3590
155 Ga0495630_0042097 3300046517 Bacteria 3411
156 Ga0495630_0054433 3300046517 Bacteria 2997
157 Ga0495630_0074447 3300046517 Bacteria 2557
158 Ga0495632_0000622 3300046519 Bacteria 32756
159 Ga0495643_0019008 3300046522 Bacteria 3979
160 Ga0495644_0000103 3300046523 Bacteria 40180
161 Ga0495666_0004217 3300046526 Bacteria 7254
162 Ga0495666_0008427 3300046526 Bacteria 5169
163 Ga0495666_0042357 3300046526 Bacteria 2202
164 Ga0495642_0000185 3300046528 Bacteria 36866
165 Ga0495652_0001009 3300046529 Bacteria 32260
166 Ga0495652_0008266 3300046529 Bacteria 9510
167 Ga0495665_0000299 3300046531 Bacteria 24943
168 Ga0495665_0000317 3300046531 Bacteria 24559
169 Ga0495665_0021526 3300046531 Bacteria 3464
170 Ga0495665_0042246 3300046531 Bacteria 2427
171 Ga0495586_0000030 3300046535 Bacteria 96137
172 Ga0495586_0001465 3300046535 Bacteria 13011
173 Ga0495586_0002457 3300046535 Bacteria 10056
174 Ga0495586_0005465 3300046535 Bacteria 6795
175 Ga0495586_0007330 3300046535 Bacteria 5887
176 Ga0495586_0013351 3300046535 Bacteria 4355
177 Ga0495586_0088359 3300046535 Bacteria 1709
178 Ga0495587_0000527 3300046536 Bacteria 26499
179 Ga0495645_0000179 3300046543 Bacteria 44532
180 Ga0495645_0000263 3300046543 Bacteria 38772
181 Ga0495645_0011538 3300046543 Bacteria 6221
182 Ga0495645_0013283 3300046543 Bacteria 5820
183 Ga0495645_0061381 3300046543 Bacteria 2723
184 Ga0495645_0104554 3300046543 Bacteria 2010
185 Ga0495622_0002955 3300046557 Bacteria 8098
186 Ga0495622_0025202 3300046557 Bacteria 2777
187 Ga0495622_0045229 3300046557 Bacteria 2045
188 Ga0495667_0000706 3300046559 Bacteria 21382
189 Ga0495667_0000799 3300046559 Bacteria 20253
190 Ga0495656_0004739 3300046615 Bacteria 4675
191 Ga0495668_0001583 3300046616 Bacteria 21451
192 Ga0495668_0001763 3300046616 Bacteria 19797
193 Ga0495668_0006463 3300046616 Bacteria 7671
194 Ga0495634_0041769 3300046642 Bacteria 3114
195 Ga0495634_0060618 3300046642 Bacteria 2517
196 Ga0495611_0005758 3300046648 Bacteria 5284
197 Ga0495635_0018966 3300046663 Bacteria 4801
198 Ga0495635_0055725 3300046663 Bacteria 2723
199 Ga0495661_0000533 3300046665 Bacteria 39208
200 Ga0495661_0000604 3300046665 Bacteria 36720
201 Ga0495661_0024963 3300046665 Bacteria 3868
202 Ga0495661_0106699 3300046665 Bacteria 1567
203 Ga0495588_0002373 3300046674 Bacteria 8056
204 Ga0495588_0008379 3300046674 Bacteria 4743
205 Ga0495588_0046486 3300046674 Bacteria 2226
206 Ga0495657_0038832 3300046675 Bacteria 3274
207 Ga0495657_0039676 3300046675 Bacteria 3234
208 Ga0495599_0020155 3300046678 Bacteria 4153
209 Ga0495623_0000486 3300046679 Bacteria 26283
210 Ga0495646_0021789 3300046680 Bacteria 4047
211 Ga0495646_0033260 3300046680 Bacteria 3206
212 Ga0495669_0011785 3300046684 Bacteria 3717
213 Ga0495613_0000963 3300046689 Bacteria 22016
214 Ga0495624_0000359 3300046690 Bacteria 36081
215 Ga0495624_0000506 3300046690 Bacteria 30565
216 Ga0495624_0007578 3300046690 Bacteria 7616
217 Ga0495624_0016331 3300046690 Bacteria 4996
218 Ga0495624_0034023 3300046690 Bacteria 3299
219 Ga0495624_0040598 3300046690 Bacteria 2980
220 Ga0495670_0000101 3300046691 Bacteria 37617
221 Ga0495671_0005426 3300046692 Bacteria 7463
222 Ga0495671_0024819 3300046692 Bacteria 3118
223 Ga0495671_0027681 3300046692 Bacteria 2925
224 Ga0495649_0000366 3300046694 Bacteria 39012
225 Ga0495649_0000405 3300046694 Bacteria 37426
226 Ga0495649_0004507 3300046694 Bacteria 9092
227 Ga0495649_0015413 3300046694 Bacteria 4351
228 Ga0495589_0000302 3300046794 Bacteria 39294
229 Ga0495589_0000331 3300046794 Bacteria 37131
230 Ga0495589_0000796 3300046794 Bacteria 19977
231 Ga0495589_0013563 3300046794 Bacteria 4203
232 Ga0495589_0033984 3300046794 Bacteria 2560
233 Ga0495589_0079841 3300046794 Bacteria 1591
234 Ga0495600_0000377 3300046809 Bacteria 23189
235 Ga0495600_0000516 3300046809 Bacteria 20037
236 Ga0495600_0001009 3300046809 Bacteria 15189
237 Ga0495581_0004220 3300047315 Bacteria 8282
238 Ga0495581_0007991 3300047315 Bacteria 6128
239 Ga0495581_0022351 3300047315 Bacteria 3665
240 Ga0495581_0023084 3300047315 Bacteria 3605
241 Ga0495604_0006069 3300047317 Bacteria 9587
242 Ga0495604_0013368 3300047317 Bacteria 6536
243 Ga0495604_0018543 3300047317 Bacteria 5575
244 Ga0495604_0031981 3300047317 Bacteria 4171
245 Ga0495604_0034971 3300047317 Bacteria 3969
246 Ga0495604_0112588 3300047317 Bacteria 1982
247 Ga0495636_0001438 3300047318 Viruses 9006
248 Ga0495674_0004586 3300047319 Bacteria 13287
249 Ga0495674_0006164 3300047319 Bacteria 11513
250 Ga0495674_0021237 3300047319 Bacteria 6006
251 Ga0495674_0029726 3300047319 Bacteria 4972
252 Ga0495674_0046934 3300047319 Bacteria 3832
253 Ga0495674_0166205 3300047319 Bacteria 1843
254 Ga0495676_0000306 3300047321 Bacteria 39691
255 Ga0495676_0021118 3300047321 Bacteria 5697
256 Ga0495680_0000733 3300047322 Bacteria 36823
257 Ga0495680_0003223 3300047322 Bacteria 16208
258 Ga0495680_0095958 3300047322 Bacteria 2216
259 Ga0495683_0000861 3300047323 Bacteria 21465
260 Ga0495683_0001718 3300047323 Bacteria 13885
261 Ga0495683_0003106 3300047323 Bacteria 9731
262 Ga0495683_0004685 3300047323 Bacteria 7704
263 Ga0495683_0008704 3300047323 Bacteria 5417
264 Ga0495683_0028724 3300047323 Bacteria 2842
265 Ga0495675_0000266 3300047444 Bacteria 37895
266 Ga0495675_0000542 3300047444 Bacteria 24422
267 Ga0495675_0012244 3300047444 Bacteria 5398
268 Ga0495675_0121361 3300047444 Bacteria 1627
269 Ga0495679_002965 3300047446 Bacteria 8376
270 Ga0495673_0015555 3300047469 Viruses 3916
271 Ga0495681_0000796 3300047470 Bacteria 24277
272 Ga0495686_0001553 3300047472 Bacteria 24519
273 Ga0495593_0000844 3300047673 Bacteria 17786
274 Ga0495593_0008828 3300047673 Bacteria 5851
275 Ga0495593_0038313 3300047673 Bacteria 2589
276 Ga0495602_0000650 3300048088 Bacteria 32567
277 Ga0495602_0014166 3300048088 Bacteria 8105
278 Ga0495602_0016098 3300048088 Bacteria 7525
279 Ga0495602_0035827 3300048088 Bacteria 4623
280 Ga0495602_0091811 3300048088 Bacteria 2517
281 Ga0495614_0000009 3300048089 Bacteria 61634
282 Ga0495614_0000040 3300048089 Bacteria 39350
283 Ga0495614_0014929 3300048089 Bacteria 3393
284 Ga0496100_0001693 3300048903 Bacteria 10957
285 Ga0496100_0004946 3300048903 Bacteria 7124
286 Ga0496101_0000250 3300048904 Bacteria 38858
287 Ga0496101_0000356 3300048904 Bacteria 30839
288 Ga0496102_0000507 3300048905 Bacteria 42722
289 Ga0496102_0063122 3300048905 Bacteria 3392
290 Ga0496104_0000412 3300048907 Bacteria 37496
291 Ga0496104_0004427 3300048907 Bacteria 12240
292 Ga0496105_0000236 3300048908 Bacteria 37377
293 Ga0496105_0017532 3300048908 Bacteria 5744
294 Ga0496106_0000230 3300048909 Bacteria 39078
295 Ga0496107_0000134 3300048910 Bacteria 36329
296 Ga0496108_0025864 3300048911 Bacteria 4840
297 Ga0496109_0019241 3300048912 Bacteria 6016
298 Ga0496110_0000178 3300048913 Bacteria 39386
299 Ga0496110_0000193 3300048913 Bacteria 38394
300 Ga0496111_0000231 3300048914 Bacteria 26700
301 Ga0496114_0010934 3300048917 Bacteria 7235
302 Ga0496115_0000635 3300048918 Bacteria 26387
303 Ga0496115_0001383 3300048918 Bacteria 17325
304 Ga0496115_0003869 3300048918 Bacteria 10793
305 Ga0496119_0049678 3300048922 Bacteria 2591
306 Ga0496123_0031421 3300048926 Bacteria 3864
307 Ga0495682_0000364 3300049460 Bacteria 33017
308 Ga0501300_000030 3300049523 Bacteria 21876
309 Ga0501257_018903 3300049686 Viruses 1610
310 Ga0501267_000084 3300049764 Viruses 5688
311 Ga0500568_0019660 3300053139 Bacteria 2929
312 Ga0466962_0001614 3300061719 Bacteria 10566
313 2501411039 2501025504 Bacteria 8008976
314 2511096508 2510917014 Bacteria 8296963
315 2819634905 2818991452 Bacteria 8442785
316 Ga0495603_0000111
317 JGI25151J46595_10000503
318 JGI25151J46595_10000643
319 rootH1_10026516
320 rootH2_10003522
321 rootL2_10108082
322 rootL2_10144164
323 rootH1_10047995
324 rootH1_10187729
325 Ga0055536_1000083
326 Ga0055530_10001035
327 Ga0055540_1000148
328 Ga0055531_10001558
329 Ga0065714_10067090
330 Ga0070658_10002969
331 Ga0068869_100000258
332 Ga0070682_100054707
333 Ga0070701_10061800
334 Ga0068857_100000199
335 Ga0068865_100041852
336 Ga0079104_1000001
337 Ga0105250_10003572
338 Ga0105248_10116043
339 Ga0157370_10054992
340 Ga0157369_10000754
341 Ga0182006_1000347
342 Ga0224712_10036333
343 Ga0209676_1000380
344 Ga0209025_1001364
345 Ga0209025_1001494
346 Ga0209050_1000738
347 Ga0209051_1000155
348 Ga0209257_1000236
349 Ga0207696_1021280
350 Ga0207705_10000545
351 Ga0207662_10070524
352 Ga0207689_10002891
353 Ga0207702_10005124
354 Ga0207674_10000893
355 Ga0209281_1000057
356 Ga0265327_10000965
357 Ga0307408_100067328
358 Ga0307405_10000096
359 Ga0307412_10014167
360 Ga0373947_0014309
361 Ga0395899_0018102
362 Ga0395899_0045472
363 Ga0395900_0001034
364 Ga0395900_0001289
365 Ga0395900_0001888
366 Ga0395900_0003641
367 Ga0395900_0019055
368 Ga0395900_0052773
369 Ga0395900_0201643
370 Ga0395898_0002112
371 Ga0395898_0002641
372 Ga0395898_0005854
373 Ga0395898_0006702
374 Ga0395898_0012048
375 Ga0395898_0058169
376 Ga0395898_0092143
377 Ga0395898_0173278
378 Ga0395898_0332955
379 Ga0395905_0001218
380 Ga0395905_0001313
381 Ga0395905_0005790
382 Ga0395905_0177299
383 Ga0395901_0000547
384 Ga0395901_0000623
385 Ga0395901_0000724
386 Ga0395901_0016524
387 Ga0395901_0086652
388 Ga0439452_008779
389 Ga0439452_010334
390 Ga0450923_000008
391 Ga0450890_002259
392 Ga0439446_0005656
393 Ga0439446_0023338
394 Ga0451577_0005991
395 Ga0466969_0000122
396 Ga0466969_0001287
397 Ga0466969_0005797
398 Ga0466972_0000385
399 Ga0453683_0003180
400 Ga0453683_0020646
401 Ga0466966_0000231
402 Ga0466966_0003277
403 Ga0466961_0000250
404 Ga0466961_0001150
405 Ga0466961_0003280
406 Ga0466963_0005040
407 Ga0453684_0003776
408 Ga0453684_0013710
409 Ga0453684_0049499
410 Ga0453684_0062815
411 Ga0466968_0025668
412 Ga0466970_0000081
413 Ga0466970_0000293
414 Ga0466957_0001104
415 Ga0466959_0000080
416 Ga0466959_0000377
417 Ga0451576_0006335
418 Ga0451576_0014823
419 Ga0466958_0002697
420 Ga0495617_002901
421 Ga0495603_0003545
422 Ga0495603_0010852
423 Ga0495590_0004281
424 Ga0495629_0002159
425 Ga0495629_0009923
426 Ga0495629_0016684
427 Ga0495629_0033001
428 Ga0495629_0033187
429 Ga0495641_0000349
430 Ga0495651_0000325
431 Ga0495651_0006753
432 Ga0495653_0000730
433 Ga0495653_0006777
434 Ga0495653_0062130
435 Ga0495650_0001381
436 Ga0495650_0001414
437 Ga0495582_0006396
438 Ga0495582_0009892
439 Ga0495582_0010126
440 Ga0495605_0014970
441 Ga0495605_0042553
442 Ga0495639_0020415
443 Ga0495662_0000107
444 Ga0495664_0000126
445 Ga0495664_0013751
446 Ga0495664_0035305
447 Ga0495594_0002595
448 Ga0495594_0010330
449 Ga0495596_0000237
450 Ga0495596_0016485
451 Ga0495607_0001511
452 Ga0495607_0029637
453 Ga0495583_0000802
454 Ga0495606_0001090
455 Ga0495606_0001187
456 Ga0495606_0001867
457 Ga0495606_0001944
458 Ga0495606_0001954
459 Ga0495616_0000144
460 Ga0495618_0008292
461 Ga0495618_0053939
462 Ga0495628_0000426
463 Ga0495628_0007412
464 Ga0495628_0037683
465 Ga0495628_0093774
466 Ga0495630_0000384
467 Ga0495630_0013690
468 Ga0495630_0026684
469 Ga0495630_0038231
470 Ga0495630_0042097
471 Ga0495630_0054433
472 Ga0495630_0074447
473 Ga0495632_0000622
474 Ga0495643_0019008
475 Ga0495644_0000103
476 Ga0495666_0004217
477 Ga0495666_0008427
478 Ga0495666_0042357
479 Ga0495642_0000185
480 Ga0495652_0001009
481 Ga0495652_0008266
482 Ga0495665_0000299
483 Ga0495665_0000317
484 Ga0495665_0021526
485 Ga0495665_0042246
486 Ga0495586_0000030
487 Ga0495586_0001465
488 Ga0495586_0002457
489 Ga0495586_0005465
490 Ga0495586_0007330
491 Ga0495586_0013351
492 Ga0495586_0088359
493 Ga0495587_0000527
494 Ga0495645_0000179
495 Ga0495645_0000263
496 Ga0495645_0011538
497 Ga0495645_0013283
498 Ga0495645_0061381
499 Ga0495645_0104554
500 Ga0495622_0002955
501 Ga0495622_0025202
502 Ga0495622_0045229
503 Ga0495667_0000706
504 Ga0495667_0000799
505 Ga0495656_0004739
506 Ga0495668_0001583
507 Ga0495668_0001763
508 Ga0495668_0006463
509 Ga0495634_0041769
510 Ga0495634_0060618
511 Ga0495611_0005758
512 Ga0495635_0018966
513 Ga0495635_0055725
514 Ga0495661_0000533
515 Ga0495661_0000604
516 Ga0495661_0024963
517 Ga0495661_0106699
518 Ga0495588_0002373
519 Ga0495588_0008379
520 Ga0495588_0046486
521 Ga0495657_0038832
522 Ga0495657_0039676
523 Ga0495599_0020155
524 Ga0495623_0000486
525 Ga0495646_0021789
526 Ga0495646_0033260
527 Ga0495669_0011785
528 Ga0495613_0000963
529 Ga0495624_0000359
530 Ga0495624_0000506
531 Ga0495624_0007578
532 Ga0495624_0016331
533 Ga0495624_0034023
534 Ga0495624_0040598
535 Ga0495670_0000101
536 Ga0495671_0005426
537 Ga0495671_0024819
538 Ga0495671_0027681
539 Ga0495649_0000366
540 Ga0495649_0000405
541 Ga0495649_0004507
542 Ga0495649_0015413
543 Ga0495589_0000302
544 Ga0495589_0000331
545 Ga0495589_0000796
546 Ga0495589_0013563
547 Ga0495589_0033984
548 Ga0495589_0079841
549 Ga0495600_0000377
550 Ga0495600_0000516
551 Ga0495600_0001009
552 Ga0495581_0004220
553 Ga0495581_0007991
554 Ga0495581_0022351
555 Ga0495581_0023084
556 Ga0495604_0006069
557 Ga0495604_0013368
558 Ga0495604_0018543
559 Ga0495604_0031981
560 Ga0495604_0034971
561 Ga0495604_0112588
562 Ga0495636_0001438
563 Ga0495674_0004586
564 Ga0495674_0006164
565 Ga0495674_0021237
566 Ga0495674_0029726
567 Ga0495674_0046934
568 Ga0495674_0166205
569 Ga0495676_0000306
570 Ga0495676_0021118
571 Ga0495680_0000733
572 Ga0495680_0003223
573 Ga0495680_0095958
574 Ga0495683_0000861
575 Ga0495683_0001718
576 Ga0495683_0003106
577 Ga0495683_0004685
578 Ga0495683_0008704
579 Ga0495683_0028724
580 Ga0495675_0000266
581 Ga0495675_0000542
582 Ga0495675_0012244
583 Ga0495675_0121361
584 Ga0495679_002965
585 Ga0495673_0015555
586 Ga0495681_0000796
587 Ga0495686_0001553
588 Ga0495593_0000844
589 Ga0495593_0008828
590 Ga0495593_0038313
591 Ga0495602_0000650
592 Ga0495602_0014166
593 Ga0495602_0016098
594 Ga0495602_0035827
595 Ga0495602_0091811
596 Ga0495614_0000009
597 Ga0495614_0000040
598 Ga0495614_0014929
599 Ga0496100_0001693
600 Ga0496100_0004946
601 Ga0496101_0000250
602 Ga0496101_0000356
603 Ga0496102_0000507
604 Ga0496102_0063122
605 Ga0496104_0000412
606 Ga0496104_0004427
607 Ga0496105_0000236
608 Ga0496105_0017532
609 Ga0496106_0000230
610 Ga0496107_0000134
611 Ga0496108_0025864
612 Ga0496109_0019241
613 Ga0496110_0000178
614 Ga0496110_0000193
615 Ga0496111_0000231
616 Ga0496114_0010934
617 Ga0496115_0000635
618 Ga0496115_0001383
619 Ga0496115_0003869
620 Ga0496119_0049678
621 Ga0496123_0031421
622 Ga0495682_0000364
623 Ga0501300_000030
624 Ga0501257_018903
625 Ga0501267_000084
626 Ga0500568_0019660
627 Ga0466962_0001614
628 2501411039
629 2511096508
630 2819634905

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04466

Terminase_3

Phage terminase large subunit

38

231

0.93

PF17288

Terminase_3C

Terminase RNAseH like domain

262

404

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wc9-assembly1.cif.gz_A crystal structure of the g2p (large terminase) nuclease domain from the bacteriophage spp1 with bound mn 0.8647 168 325
2wc9-assembly1.cif.gz_A crystal structure of the g2p (large terminase) nuclease domain from the bacteriophage spp1 with bound mn 0.7737 168 325
1rif-assembly2.cif.gz_B crystal structure of the uvsw helicase from bacteriophage t4 0.7271 57 95
4dkw-assembly2.cif.gz_B structure of p22 large terminase nuclease domain 0.7049 166 327
2i00-assembly2.cif.gz_C crystal structure of acetyltransferase (gnat family) from enterococcus faecalis 0.6625 190 209
ID Description Score Start End Superfamily
af_Q2FX51_237_408_3.30.420.280 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.8928 182 327 3.30.420.280
2wc9A00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.8638 168 324 3.30.420.280
4ifeA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8515 2 159 3.40.50.300
af_Q2FX51_17_230_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8237 2 161 3.40.50.300
2wc9A00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7725 168 324 3.30.420.280
ID Description Score Start End GO Terms
AF-A0A554TSC4-F1-model_v4 deleted 0.9758 174 282
AF-A0A0F9JL29-F1-model_v4 Phage terminase large subunit C-terminal domain-containing protein 0.9733 162 327
AF-A0A6G2D6H5-F1-model_v4 PBSX family phage terminase large subunit 0.9504 63 151
AF-G2J7E3-F1-model_v4 Phage terminase 0.9417 162 335
AF-A0A6G2D6H5-F1-model_v4 PBSX family phage terminase large subunit 0.9401 63 151

Map