F403781

General Info

Members Datasets Scaffolds Average Seq Length
316 190 632 92

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0266373|Ga0395901_0266373_1185_1520
Length 111
Sequence MRRERVEGLLDRLLAAGYCRAMGCILALLALISPRLVLFLLAIFSDVLSRAYDSWIIPLLGFFLLPWTTLAYAAFWDWGPGHHVTGVEWFFVVLAFLIDLGSYFGGRAARG

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
119 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
186 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.33
Nodule 0
Rhizoplane 12.97
Rhizosphere 78.48
Stem 0
Stem Tuber 0
Unclassified 27.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0266373 3300038443 Bacteria 1783
2 JGI25407J50210_10009988 3300003373 Bacteria 2410
3 JGI25407J50210_10184269 3300003373 Bacteria 515
4 Ga0070683_100003884 3300005329 Bacteria 12224
5 Ga0070690_100554054 3300005330 Unclassified 867
6 Ga0070682_101790096 3300005337 Unclassified 536
7 Ga0070687_100347861 3300005343 Unclassified 956
8 Ga0070687_100724806 3300005343 Unclassified 697
9 Ga0070692_10951038 3300005345 Bacteria 597
10 Ga0070668_100759748 3300005347 Unclassified 859
11 Ga0070668_101376771 3300005347 Bacteria 643
12 Ga0070671_100274800 3300005355 Unclassified 1432
13 Ga0070674_100713078 3300005356 Bacteria 859
14 Ga0070674_101383734 3300005356 Unclassified 630
15 Ga0070688_101303703 3300005365 Unclassified 586
16 Ga0070659_100452108 3300005366 Bacteria 1090
17 Ga0070659_101725770 3300005366 Bacteria 560
18 Ga0070667_100003085 3300005367 Bacteria 14325
19 Ga0070709_10106413 3300005434 Bacteria 1878
20 Ga0070714_100061366 3300005435 Bacteria 3229
21 Ga0070714_100182713 3300005435 Bacteria 1909
22 Ga0070714_100213618 3300005435 Bacteria 1769
23 Ga0070713_100148504 3300005436 Bacteria 2083
24 Ga0070713_100254223 3300005436 Bacteria 1604
25 Ga0070713_101350635 3300005436 Unclassified 691
26 Ga0070713_101422166 3300005436 Bacteria 673
27 Ga0070710_10036293 3300005437 Bacteria 2694
28 Ga0070710_10249127 3300005437 Unclassified 1141
29 Ga0070710_10334975 3300005437 Unclassified 997
30 Ga0070710_10370232 3300005437 Bacteria 953
31 Ga0070710_10524116 3300005437 Bacteria 815
32 Ga0070701_10225970 3300005438 Bacteria 1119
33 Ga0070701_10464479 3300005438 Unclassified 815
34 Ga0070701_10601213 3300005438 Unclassified 728
35 Ga0070711_100031132 3300005439 Bacteria 3539
36 Ga0070700_100238567 3300005441 Bacteria 1298
37 Ga0070700_101761349 3300005441 Unclassified 533
38 Ga0070663_101119291 3300005455 Bacteria 689
39 Ga0068867_101469623 3300005459 Unclassified 634
40 Ga0070672_100466929 3300005543 Unclassified 1089
41 Ga0070672_101373290 3300005543 Bacteria 632
42 Ga0070686_100800571 3300005544 Unclassified 760
43 Ga0070686_100891956 3300005544 Unclassified 723
44 Ga0070696_101507346 3300005546 Bacteria 576
45 Ga0070665_100176083 3300005548 Unclassified 2140
46 Ga0070665_100374902 3300005548 Unclassified 1430
47 Ga0070704_100782743 3300005549 Bacteria 851
48 Ga0070704_101638843 3300005549 Bacteria 594
49 Ga0070664_101196809 3300005564 Bacteria 717
50 Ga0068857_100645558 3300005577 Bacteria 1003
51 Ga0068856_100897024 3300005614 Unclassified 905
52 Ga0070702_100461105 3300005615 Bacteria 924
53 Ga0070702_100943648 3300005615 Archaea 679
54 Ga0070702_101137708 3300005615 Bacteria 626
55 Ga0068852_102155724 3300005616 Bacteria 579
56 Ga0068852_102346050 3300005616 Archaea 554
57 Ga0068861_100387269 3300005719 Bacteria 1237
58 Ga0068861_101146912 3300005719 Bacteria 749
59 Ga0068861_102171475 3300005719 Unclassified 556
60 Ga0068870_10485496 3300005840 Bacteria 821
61 Ga0068870_10933613 3300005840 Bacteria 615
62 Ga0068858_101354673 3300005842 Unclassified 701
63 Ga0068860_102660121 3300005843 Unclassified 519
64 Ga0081455_10015683 3300005937 Bacteria 7347
65 Ga0081455_10020563 3300005937 Bacteria 6210
66 Ga0081455_10037303 3300005937 Bacteria 4318
67 Ga0081538_10011210 3300005981 Bacteria 7281
68 Ga0081538_10011723 3300005981 Bacteria 7077
69 Ga0081538_10031602 3300005981 Bacteria 3566
70 Ga0081538_10088869 3300005981 Bacteria 1606
71 Ga0081538_10187154 3300005981 Bacteria 875
72 Ga0081538_10187567 3300005981 Bacteria 874
73 Ga0070717_10537270 3300006028 Bacteria 1058
74 Ga0075365_10007767 3300006038 Bacteria 6040
75 Ga0075365_10731871 3300006038 Unclassified 699
76 Ga0075365_10934749 3300006038 Bacteria 611
77 Ga0075368_10138635 3300006042 Bacteria 1013
78 Ga0075363_100004167 3300006048 Bacteria 6281
79 Ga0075363_101044597 3300006048 Bacteria 505
80 Ga0075364_10131684 3300006051 Bacteria 1678
81 Ga0075364_10755264 3300006051 Bacteria 663
82 Ga0070716_100107524 3300006173 Bacteria 1722
83 Ga0070716_100344149 3300006173 Bacteria 1053
84 Ga0070712_100004642 3300006175 Bacteria 8496
85 Ga0070712_100461509 3300006175 Bacteria 1059
86 Ga0070712_100464693 3300006175 Bacteria 1056
87 Ga0075367_10053988 3300006178 Unclassified 2382
88 Ga0075367_10505075 3300006178 Bacteria 767
89 Ga0075367_10801181 3300006178 Bacteria 600
90 Ga0075428_100681516 3300006844 Bacteria 1095
91 Ga0075431_102137648 3300006847 Unclassified 514
92 Ga0075429_100275033 3300006880 Bacteria 1475
93 Ga0105240_12115643 3300009093 Unclassified 584
94 Ga0111539_10009127 3300009094 Bacteria 12547
95 Ga0111539_10891763 3300009094 Bacteria 1034
96 Ga0111539_11717158 3300009094 Unclassified 728
97 Ga0111539_11938168 3300009094 Bacteria 683
98 Ga0105245_10544432 3300009098 Unclassified 1182
99 Ga0105245_11933288 3300009098 Bacteria 643
100 Ga0105245_12390514 3300009098 Unclassified 582
101 Ga0105247_10304951 3300009101 Bacteria 1106
102 Ga0105247_10575262 3300009101 Bacteria 832
103 Ga0114129_10818641 3300009147 Bacteria 1186
104 Ga0114129_13075901 3300009147 Unclassified 546
105 Ga0105243_10535072 3300009148 Bacteria 1117
106 Ga0105243_10882472 3300009148 Bacteria 888
107 Ga0105241_10658801 3300009174 Bacteria 952
108 Ga0105242_12930394 3300009176 Unclassified 528
109 Ga0105249_10387844 3300009553 Unclassified 1424
110 Ga0105249_11161470 3300009553 Bacteria 843
111 Ga0105249_13451948 3300009553 Bacteria 509
112 Ga0105239_10205029 3300010375 Bacteria 2210
113 Ga0105246_10411231 3300011119 Unclassified 1126
114 Ga0157340_1021190 3300012473 Bacteria 549
115 Ga0157369_10358257 3300013105 Bacteria 1515
116 Ga0157369_12110334 3300013105 Bacteria 571
117 Ga0157378_11164450 3300013297 Unclassified 810
118 Ga0163162_10371244 3300013306 Bacteria 1564
119 Ga0163162_10661555 3300013306 Bacteria 1168
120 Ga0163162_10992270 3300013306 Bacteria 949
121 Ga0163162_12442923 3300013306 Unclassified 601
122 Ga0157372_10891182 3300013307 Unclassified 1032
123 Ga0157372_12677126 3300013307 Unclassified 572
124 Ga0157372_13417983 3300013307 Bacteria 505
125 Ga0157375_10798345 3300013308 Unclassified 1093
126 Ga0157375_11728755 3300013308 Bacteria 741
127 Ga0163163_10266642 3300014325 Bacteria 1764
128 Ga0163163_10618089 3300014325 Bacteria 1147
129 Ga0163163_10996077 3300014325 Unclassified 901
130 Ga0157380_10000007 3300014326 Bacteria 157634
131 Ga0157380_12433144 3300014326 Bacteria 589
132 Ga0157380_13213635 3300014326 Unclassified 522
133 Ga0157377_10895297 3300014745 Unclassified 663
134 Ga0157379_10009518 3300014968 Bacteria 8462
135 Ga0157376_10746727 3300014969 Bacteria 987
136 Ga0157376_11648348 3300014969 Unclassified 676
137 Ga0163161_10547945 3300017792 Bacteria 948
138 Ga0207692_10173576 3300025898 Unclassified 1251
139 Ga0207692_10272838 3300025898 Unclassified 1021
140 Ga0207692_10418690 3300025898 Bacteria 838
141 Ga0207642_10267944 3300025899 Bacteria 977
142 Ga0207688_10048121 3300025901 Bacteria 2382
143 Ga0207643_10520833 3300025908 Bacteria 761
144 Ga0207693_10022355 3300025915 Bacteria 5025
145 Ga0207663_10083371 3300025916 Bacteria 2100
146 Ga0207662_10362561 3300025918 Unclassified 975
147 Ga0207662_10727356 3300025918 Unclassified 697
148 Ga0207687_10703524 3300025927 Unclassified 858
149 Ga0207700_10341534 3300025928 Bacteria 1302
150 Ga0207700_10500474 3300025928 Bacteria 1075
151 Ga0207700_11718840 3300025928 Bacteria 553
152 Ga0207664_10073277 3300025929 Bacteria 2763
153 Ga0207664_11564230 3300025929 Unclassified 581
154 Ga0207644_11523078 3300025931 Bacteria 561
155 Ga0207686_11057127 3300025934 Bacteria 660
156 Ga0207709_10655482 3300025935 Unclassified 836
157 Ga0207669_10351954 3300025937 Bacteria 1138
158 Ga0207669_10638224 3300025937 Bacteria 870
159 Ga0207669_11717817 3300025937 Bacteria 536
160 Ga0207665_10178531 3300025939 Bacteria 1537
161 Ga0207691_10391567 3300025940 Unclassified 1185
162 Ga0207679_10283432 3300025945 Bacteria 1422
163 Ga0207679_10316412 3300025945 Bacteria 1350
164 Ga0207651_11525202 3300025960 Bacteria 602
165 Ga0207668_12073646 3300025972 Archaea 512
166 Ga0207640_10114956 3300025981 Bacteria 1916
167 Ga0207703_11430507 3300026035 Bacteria 665
168 Ga0207708_11034030 3300026075 Bacteria 715
169 Ga0207708_11098629 3300026075 Bacteria 693
170 Ga0207708_11855104 3300026075 Unclassified 529
171 Ga0207702_11636657 3300026078 Unclassified 637
172 Ga0207676_10389761 3300026095 Unclassified 1299
173 Ga0207675_100162604 3300026118 Bacteria 2130
174 Ga0207675_100342695 3300026118 Bacteria 1463
175 Ga0207698_10098978 3300026142 Bacteria 2411
176 Ga0209813_10099099 3300027866 Bacteria 989
177 Ga0207428_10028158 3300027907 Bacteria 4671
178 Ga0268266_10257268 3300028379 Unclassified 1617
179 Ga0268266_10694376 3300028379 Bacteria 981
180 Ga0268265_11374199 3300028380 Bacteria 708
181 Ga0265338_11210890 3300028800 Bacteria 506
182 Ga0307408_102033254 3300031548 Unclassified 553
183 Ga0307405_10141570 3300031731 Bacteria 1678
184 Ga0307409_100113849 3300031995 Unclassified 2275
185 Ga0307409_101160417 3300031995 Viruses 795
186 Ga0307416_103194372 3300032002 Bacteria 548
187 Ga0307415_100976185 3300032126 Bacteria 786
188 Ga0373923_0526131 3300035111 Unclassified 578
189 Ga0373953_0015501 3300035117 Bacteria 2764
190 Ga0373924_0084542 3300035410 Bacteria 1353
191 Ga0373933_0661099 3300035724 Unclassified 687
192 Ga0373937_0201794 3300036401 Bacteria 1869
193 Ga0395898_0040339 3300037466 Bacteria 4617
194 Ga0436364_0004740 3300037853 Unclassified 711
195 Ga0395901_0053368 3300038443 Bacteria 4200
196 Ga0395901_0446788 3300038443 Unclassified 1323
197 Ga0436365_0585500 3300039437 Bacteria 3242
198 Ga0436363_1548094 3300039450 Unclassified 839
199 Ga0439461_0050269 3300041410 Bacteria 923
200 Ga0451789_0367087 3300041443 Bacteria 539
201 Ga0451853_2463834 3300041512 Bacteria 1339
202 Ga0466972_0074634 3300044658 Bacteria 1616
203 Ga0466963_0039666 3300044694 Bacteria 3085
204 Ga0466964_0040193 3300044706 Bacteria 1888
205 Ga0466970_0466882 3300044765 Bacteria 725
206 Ga0466960_0015119 3300044901 Bacteria 3323
207 Ga0466967_0005564 3300045976 Bacteria 8753
208 Ga0466967_0159294 3300045976 Bacteria 2117
209 Ga0466967_0485169 3300045976 Unclassified 1211
210 Ga0466967_0505983 3300045976 Bacteria 1186
211 Ga0466967_0905546 3300045976 Bacteria 877
212 Ga0466967_1404315 3300045976 Unclassified 695
213 Ga0466967_1805110 3300045976 Bacteria 609
214 Ga0466967_2379907 3300045976 Unclassified 525
215 Ga0495592_0187931 3300046454 Bacteria 1402
216 Ga0495638_0397170 3300046460 Unclassified 716
217 Ga0495641_0253214 3300046461 Bacteria 792
218 Ga0495651_0007301 3300046462 Bacteria 8449
219 Ga0495664_0325491 3300046477 Bacteria 927
220 Ga0495608_0135715 3300046511 Unclassified 1572
221 Ga0495618_0110698 3300046514 Bacteria 1758
222 Ga0495628_0221957 3300046516 Bacteria 1419
223 Ga0495644_0284971 3300046523 Bacteria 645
224 Ga0495640_0036858 3300046533 Bacteria 3453
225 Ga0495587_0173660 3300046536 Bacteria 1223
226 Ga0495598_0125974 3300046537 Bacteria 873
227 Ga0495635_0694330 3300046663 Unclassified 660
228 Ga0495588_0096260 3300046674 Bacteria 1553
229 Ga0495657_0032820 3300046675 Bacteria 3619
230 Ga0495599_0053622 3300046678 Bacteria 2526
231 Ga0495599_0061494 3300046678 Bacteria 2347
232 Ga0495646_0231967 3300046680 Bacteria 995
233 Ga0495647_0206881 3300046681 Bacteria 862
234 Ga0495624_0000761 3300046690 Bacteria 25413
235 Ga0495600_0062343 3300046809 Bacteria 2436
236 Ga0495674_0088106 3300047319 Bacteria 2655
237 Ga0495674_1384682 3300047319 Bacteria 525
238 Ga0495672_0416000 3300047320 Unclassified 612
239 Ga0495676_0277841 3300047321 Bacteria 1135
240 Ga0495680_0026887 3300047322 Bacteria 4736
241 Ga0495593_0176270 3300047673 Bacteria 1077
242 Ga0495602_0100797 3300048088 Bacteria 2370
243 Ga0496102_0056487 3300048905 Bacteria 3581
244 Ga0496102_0433559 3300048905 Bacteria 1234
245 Ga0496102_1330408 3300048905 Bacteria 637
246 Ga0496102_1849229 3300048905 Unclassified 521
247 Ga0496103_0075925 3300048906 Bacteria 2108
248 Ga0496103_0194059 3300048906 Bacteria 1305
249 Ga0496103_0986399 3300048906 Bacteria 525
250 Ga0496104_0030069 3300048907 Bacteria 5045
251 Ga0496104_0042624 3300048907 Bacteria 4260
252 Ga0496104_0047095 3300048907 Bacteria 4063
253 Ga0496104_0191230 3300048907 Bacteria 1958
254 Ga0496105_0007575 3300048908 Bacteria 8412
255 Ga0496105_0136929 3300048908 Bacteria 2017
256 Ga0496106_1413096 3300048909 Bacteria 537
257 Ga0496106_1520386 3300048909 Unclassified 514
258 Ga0496107_0079006 3300048910 Bacteria 2398
259 Ga0496107_1045090 3300048910 Bacteria 592
260 Ga0496108_0387641 3300048911 Bacteria 1220
261 Ga0496108_0496943 3300048911 Unclassified 1065
262 Ga0496109_0178300 3300048912 Bacteria 1995
263 Ga0496109_0398003 3300048912 Bacteria 1301
264 Ga0496109_0399957 3300048912 Unclassified 1298
265 Ga0496109_0549706 3300048912 Bacteria 1089
266 Ga0496109_0719135 3300048912 Bacteria 936
267 Ga0496109_0851596 3300048912 Bacteria 849
268 Ga0496110_0096797 3300048913 Bacteria 2645
269 Ga0496110_1064204 3300048913 Unclassified 717
270 Ga0496111_0055498 3300048914 Bacteria 2865
271 Ga0496112_0010818 3300048915 Bacteria 8301
272 Ga0496112_0015457 3300048915 Bacteria 7124
273 Ga0496112_0024355 3300048915 Bacteria 5793
274 Ga0496112_0258248 3300048915 Unclassified 1692
275 Ga0496112_0751185 3300048915 Bacteria 902
276 Ga0496112_1561224 3300048915 Unclassified 573
277 Ga0496113_0052631 3300048916 Bacteria 3042
278 Ga0496113_0216844 3300048916 Unclassified 1524
279 Ga0496113_1133677 3300048916 Unclassified 612
280 Ga0496114_0551846 3300048917 Unclassified 1018
281 Ga0496114_1713255 3300048917 Bacteria 517
282 Ga0496115_0592940 3300048918 Bacteria 882
283 Ga0496117_0008506 3300048920 Bacteria 9734
284 Ga0496118_0009221 3300048921 Bacteria 10021
285 Ga0496119_0373093 3300048922 Bacteria 686
286 Ga0501032_0665945 3300049569 Unclassified 661
287 Ga0501069_0437195 3300049585 Bacteria 777
288 Ga0501070_0005588 3300049586 Bacteria 10728
289 Ga0501076_0326359 3300049592 Bacteria 1259
290 nmdc:mga03n38_113842_c1 3300050490 Bacteria 1321
291 nmdc:mga00v17_68872_c1 3300050491 Bacteria 2188
292 nmdc:mga00v17_712344_c1 3300050491 Bacteria 643
293 nmdc:mga0yw44_1140217_c1 3300050492 Unclassified 526
294 nmdc:mga0yw44_873042_c1 3300050492 Bacteria 610
295 nmdc:mga06z11_31372_c1 3300050494 Bacteria 2581
296 nmdc:mga06z11_717411_c1 3300050494 Unclassified 609
297 nmdc:mga04h51_103905_c1 3300050495 Bacteria 1039
298 nmdc:mga05p37_1937339_c1 3300050507 Bacteria 561
299 nmdc:mga05p37_727109_c1 3300050507 Unclassified 1098
300 nmdc:mga09592_256379_c1 3300050508 Bacteria 1516
301 nmdc:mga09592_97084_c1 3300050508 Bacteria 2521
302 nmdc:mga06r32_1461960_c1 3300050510 Bacteria 624
303 nmdc:mga08y16_21954_c1 3300050511 Bacteria 6738
304 nmdc:mga08y16_640663_c1 3300050511 Bacteria 1068
305 nmdc:mga08y16_795409_c1 3300050511 Bacteria 939
306 nmdc:mga0a205_346486_c1 3300050515 Bacteria 1353
307 Ga0495601_0241381 3300053077 Bacteria 1180
308 Ga0495601_0954426 3300053077 Bacteria 540
309 Ga0495601_1046374 3300053077 Unclassified 512
310 Ga0495612_0170557 3300053078 Bacteria 953
311 Ga0495612_0193357 3300053078 Unclassified 896
312 Ga0495655_0055753 3300053083 Bacteria 1062
313 Ga0495595_0151524 3300053084 Bacteria 1141
314 Ga0495619_0067782 3300053085 Bacteria 2383
315 Ga0501084_0641275 3300054114 Bacteria 897
316 Ga0530510_0927668 3300061734 Bacteria 666
317 Ga0395901_0266373
318 JGI25407J50210_10009988
319 JGI25407J50210_10184269
320 Ga0070683_100003884
321 Ga0070690_100554054
322 Ga0070682_101790096
323 Ga0070687_100347861
324 Ga0070687_100724806
325 Ga0070692_10951038
326 Ga0070668_100759748
327 Ga0070668_101376771
328 Ga0070671_100274800
329 Ga0070674_100713078
330 Ga0070674_101383734
331 Ga0070688_101303703
332 Ga0070659_100452108
333 Ga0070659_101725770
334 Ga0070667_100003085
335 Ga0070709_10106413
336 Ga0070714_100061366
337 Ga0070714_100182713
338 Ga0070714_100213618
339 Ga0070713_100148504
340 Ga0070713_100254223
341 Ga0070713_101350635
342 Ga0070713_101422166
343 Ga0070710_10036293
344 Ga0070710_10249127
345 Ga0070710_10334975
346 Ga0070710_10370232
347 Ga0070710_10524116
348 Ga0070701_10225970
349 Ga0070701_10464479
350 Ga0070701_10601213
351 Ga0070711_100031132
352 Ga0070700_100238567
353 Ga0070700_101761349
354 Ga0070663_101119291
355 Ga0068867_101469623
356 Ga0070672_100466929
357 Ga0070672_101373290
358 Ga0070686_100800571
359 Ga0070686_100891956
360 Ga0070696_101507346
361 Ga0070665_100176083
362 Ga0070665_100374902
363 Ga0070704_100782743
364 Ga0070704_101638843
365 Ga0070664_101196809
366 Ga0068857_100645558
367 Ga0068856_100897024
368 Ga0070702_100461105
369 Ga0070702_100943648
370 Ga0070702_101137708
371 Ga0068852_102155724
372 Ga0068852_102346050
373 Ga0068861_100387269
374 Ga0068861_101146912
375 Ga0068861_102171475
376 Ga0068870_10485496
377 Ga0068870_10933613
378 Ga0068858_101354673
379 Ga0068860_102660121
380 Ga0081455_10015683
381 Ga0081455_10020563
382 Ga0081455_10037303
383 Ga0081538_10011210
384 Ga0081538_10011723
385 Ga0081538_10031602
386 Ga0081538_10088869
387 Ga0081538_10187154
388 Ga0081538_10187567
389 Ga0070717_10537270
390 Ga0075365_10007767
391 Ga0075365_10731871
392 Ga0075365_10934749
393 Ga0075368_10138635
394 Ga0075363_100004167
395 Ga0075363_101044597
396 Ga0075364_10131684
397 Ga0075364_10755264
398 Ga0070716_100107524
399 Ga0070716_100344149
400 Ga0070712_100004642
401 Ga0070712_100461509
402 Ga0070712_100464693
403 Ga0075367_10053988
404 Ga0075367_10505075
405 Ga0075367_10801181
406 Ga0075428_100681516
407 Ga0075431_102137648
408 Ga0075429_100275033
409 Ga0105240_12115643
410 Ga0111539_10009127
411 Ga0111539_10891763
412 Ga0111539_11717158
413 Ga0111539_11938168
414 Ga0105245_10544432
415 Ga0105245_11933288
416 Ga0105245_12390514
417 Ga0105247_10304951
418 Ga0105247_10575262
419 Ga0114129_10818641
420 Ga0114129_13075901
421 Ga0105243_10535072
422 Ga0105243_10882472
423 Ga0105241_10658801
424 Ga0105242_12930394
425 Ga0105249_10387844
426 Ga0105249_11161470
427 Ga0105249_13451948
428 Ga0105239_10205029
429 Ga0105246_10411231
430 Ga0157340_1021190
431 Ga0157369_10358257
432 Ga0157369_12110334
433 Ga0157378_11164450
434 Ga0163162_10371244
435 Ga0163162_10661555
436 Ga0163162_10992270
437 Ga0163162_12442923
438 Ga0157372_10891182
439 Ga0157372_12677126
440 Ga0157372_13417983
441 Ga0157375_10798345
442 Ga0157375_11728755
443 Ga0163163_10266642
444 Ga0163163_10618089
445 Ga0163163_10996077
446 Ga0157380_10000007
447 Ga0157380_12433144
448 Ga0157380_13213635
449 Ga0157377_10895297
450 Ga0157379_10009518
451 Ga0157376_10746727
452 Ga0157376_11648348
453 Ga0163161_10547945
454 Ga0207692_10173576
455 Ga0207692_10272838
456 Ga0207692_10418690
457 Ga0207642_10267944
458 Ga0207688_10048121
459 Ga0207643_10520833
460 Ga0207693_10022355
461 Ga0207663_10083371
462 Ga0207662_10362561
463 Ga0207662_10727356
464 Ga0207687_10703524
465 Ga0207700_10341534
466 Ga0207700_10500474
467 Ga0207700_11718840
468 Ga0207664_10073277
469 Ga0207664_11564230
470 Ga0207644_11523078
471 Ga0207686_11057127
472 Ga0207709_10655482
473 Ga0207669_10351954
474 Ga0207669_10638224
475 Ga0207669_11717817
476 Ga0207665_10178531
477 Ga0207691_10391567
478 Ga0207679_10283432
479 Ga0207679_10316412
480 Ga0207651_11525202
481 Ga0207668_12073646
482 Ga0207640_10114956
483 Ga0207703_11430507
484 Ga0207708_11034030
485 Ga0207708_11098629
486 Ga0207708_11855104
487 Ga0207702_11636657
488 Ga0207676_10389761
489 Ga0207675_100162604
490 Ga0207675_100342695
491 Ga0207698_10098978
492 Ga0209813_10099099
493 Ga0207428_10028158
494 Ga0268266_10257268
495 Ga0268266_10694376
496 Ga0268265_11374199
497 Ga0265338_11210890
498 Ga0307408_102033254
499 Ga0307405_10141570
500 Ga0307409_100113849
501 Ga0307409_101160417
502 Ga0307416_103194372
503 Ga0307415_100976185
504 Ga0373923_0526131
505 Ga0373953_0015501
506 Ga0373924_0084542
507 Ga0373933_0661099
508 Ga0373937_0201794
509 Ga0395898_0040339
510 Ga0436364_0004740
511 Ga0395901_0053368
512 Ga0395901_0446788
513 Ga0436365_0585500
514 Ga0436363_1548094
515 Ga0439461_0050269
516 Ga0451789_0367087
517 Ga0451853_2463834
518 Ga0466972_0074634
519 Ga0466963_0039666
520 Ga0466964_0040193
521 Ga0466970_0466882
522 Ga0466960_0015119
523 Ga0466967_0005564
524 Ga0466967_0159294
525 Ga0466967_0485169
526 Ga0466967_0505983
527 Ga0466967_0905546
528 Ga0466967_1404315
529 Ga0466967_1805110
530 Ga0466967_2379907
531 Ga0495592_0187931
532 Ga0495638_0397170
533 Ga0495641_0253214
534 Ga0495651_0007301
535 Ga0495664_0325491
536 Ga0495608_0135715
537 Ga0495618_0110698
538 Ga0495628_0221957
539 Ga0495644_0284971
540 Ga0495640_0036858
541 Ga0495587_0173660
542 Ga0495598_0125974
543 Ga0495635_0694330
544 Ga0495588_0096260
545 Ga0495657_0032820
546 Ga0495599_0053622
547 Ga0495599_0061494
548 Ga0495646_0231967
549 Ga0495647_0206881
550 Ga0495624_0000761
551 Ga0495600_0062343
552 Ga0495674_0088106
553 Ga0495674_1384682
554 Ga0495672_0416000
555 Ga0495676_0277841
556 Ga0495680_0026887
557 Ga0495593_0176270
558 Ga0495602_0100797
559 Ga0496102_0056487
560 Ga0496102_0433559
561 Ga0496102_1330408
562 Ga0496102_1849229
563 Ga0496103_0075925
564 Ga0496103_0194059
565 Ga0496103_0986399
566 Ga0496104_0030069
567 Ga0496104_0042624
568 Ga0496104_0047095
569 Ga0496104_0191230
570 Ga0496105_0007575
571 Ga0496105_0136929
572 Ga0496106_1413096
573 Ga0496106_1520386
574 Ga0496107_0079006
575 Ga0496107_1045090
576 Ga0496108_0387641
577 Ga0496108_0496943
578 Ga0496109_0178300
579 Ga0496109_0398003
580 Ga0496109_0399957
581 Ga0496109_0549706
582 Ga0496109_0719135
583 Ga0496109_0851596
584 Ga0496110_0096797
585 Ga0496110_1064204
586 Ga0496111_0055498
587 Ga0496112_0010818
588 Ga0496112_0015457
589 Ga0496112_0024355
590 Ga0496112_0258248
591 Ga0496112_0751185
592 Ga0496112_1561224
593 Ga0496113_0052631
594 Ga0496113_0216844
595 Ga0496113_1133677
596 Ga0496114_0551846
597 Ga0496114_1713255
598 Ga0496115_0592940
599 Ga0496117_0008506
600 Ga0496118_0009221
601 Ga0496119_0373093
602 Ga0501032_0665945
603 Ga0501069_0437195
604 Ga0501070_0005588
605 Ga0501076_0326359
606 nmdc:mga03n38_113842_c1
607 nmdc:mga00v17_68872_c1
608 nmdc:mga00v17_712344_c1
609 nmdc:mga0yw44_1140217_c1
610 nmdc:mga0yw44_873042_c1
611 nmdc:mga06z11_31372_c1
612 nmdc:mga06z11_717411_c1
613 nmdc:mga04h51_103905_c1
614 nmdc:mga05p37_1937339_c1
615 nmdc:mga05p37_727109_c1
616 nmdc:mga09592_256379_c1
617 nmdc:mga09592_97084_c1
618 nmdc:mga06r32_1461960_c1
619 nmdc:mga08y16_21954_c1
620 nmdc:mga08y16_640663_c1
621 nmdc:mga08y16_795409_c1
622 nmdc:mga0a205_346486_c1
623 Ga0495601_0241381
624 Ga0495601_0954426
625 Ga0495601_1046374
626 Ga0495612_0170557
627 Ga0495612_0193357
628 Ga0495655_0055753
629 Ga0495595_0151524
630 Ga0495619_0067782
631 Ga0501084_0641275
632 Ga0530510_0927668

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s7o-assembly1.cif.gz_H cryo-em structure of human oligosaccharyltransferase complex ost-a 0.3163 2 89
6s7o-assembly1.cif.gz_H cryo-em structure of human oligosaccharyltransferase complex ost-a 0.3006 2 89
ID Description Score Start End Superfamily
af_O86339_1_133_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.3343 5 87 1.10.1760.20
af_O86339_1_133_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.2803 5 87 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A523E017-F1-model_v4 deleted 0.9112 4 90
AF-A0A7V9T909-F1-model_v4 Uncharacterized protein 0.9094 14 84 GO:0016020
AF-A0A2D0N7P9-F1-model_v4 Uncharacterized protein 0.9085 6 81 GO:0016020
AF-A0A3M1NMW4-F1-model_v4 Uncharacterized protein 0.8758 14 80 GO:0016020
AF-A0A5C7FFZ9-F1-model_v4 Uncharacterized protein 0.8679 4 87 GO:0016020

Map